F466473

General Info

Members Datasets Scaffolds Average Seq Length
585 338 1170 342

Family's Representative Sequence

Representative Sequence 3300041410|Ga0439461_0013314|Ga0439461_0013314_285_1502
Length 405
Sequence LGPGERLRLKFIVGAGGPDTEAYASRSAGGLRAQKSRRRFGKAHAIRLTTLFQIAIDNARKESPMTASPQLPRRSFLAKAALGMAAVQLTTMVVPAFAQSAGAGSARRLEPLKSIEAGALDIGYYEAGPANAAPVILLHGWPYDIHMFVDVAPQLAAAGFRVIVPYLRGYGTTRFLSADTPRNGQQSAVAVDIIALMDALKIKTATVAGCDWGARTACIMAALWPERVKALVSVSGYLIGSQEAGKKPLPPQAELQWWYQYYFATDRGRAGYTQYTHDFAKQIWQLASPQWKFDDATFDRSAVALDNPDHVAIVVHNYRWRLGLAEGEPKYAALEQRLAQAPAITVPTITIEGDANGAPHPLPAAYADKFTGKYEHRTFTGGVGHNPPQEAPRQFVQAVIDASRI

Samples

Sample ID Description Type Environment
1 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
38 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
71 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
92 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
93 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
94 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
147 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
154 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
155 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
156 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
157 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
158 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
159 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
160 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
161 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
178 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
179 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
180 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
184 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
187 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
188 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
189 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
190 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
191 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
192 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
193 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
194 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
195 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
196 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
197 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
198 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
199 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
200 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
201 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
202 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
203 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
204 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
207 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
217 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
218 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
219 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
220 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
232 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
240 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
249 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
252 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
260 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
261 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
262 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
263 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
264 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
265 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
266 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
269 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
270 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
271 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
272 2561511199 Enterobacter sp. R4-368 Isolate Nodule
273 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
274 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
275 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
276 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
277 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
278 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
279 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
280 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
281 2643221559 Lysobacter sp. Root559 Isolate Unclassified
282 2643221586 Lysobacter sp. Root667 Isolate Unclassified
283 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
284 2643221612 Lysobacter sp. Root76 Isolate Unclassified
285 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
286 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
287 2643221658 Variovorax sp. Root411 Isolate Unclassified
288 2643221672 Variovorax sp. Root434 Isolate Unclassified
289 2643221683 Variovorax sp. Root473 Isolate Unclassified
290 2643221727 Lysobacter sp. Root96 Isolate Unclassified
291 2643221736 Bosea sp. Root483D1 Isolate Unclassified
292 2734482264 Dyella sp. AD052 Isolate Unclassified
293 2738541277 Variovorax sp. GV051 Isolate Unclassified
294 2738541307 Variovorax sp. GV008 Isolate Unclassified
295 2738541337 Pelomonas sp. BT06 Isolate Unclassified
296 2738543009 Luteibacter sp. OK325 Isolate Unclassified
297 2738543019 Variovorax sp. GV040 Isolate Unclassified
298 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
299 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
300 2818991446 Variovorax sp. 1180 Isolate Unclassified
301 2818991457 Xanthomonas translucens 569 Isolate Unclassified
302 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
303 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
304 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
305 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
306 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
307 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
308 2842677519 Variovorax sp. R-72495 Isolate Unclassified
309 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
310 2884411467 Dyella sp. AD56 Isolate Rhizosphere
311 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
312 2885198086 Variovorax sp. 679 Isolate Unclassified
313 2885211737 Variovorax sp. 553 Isolate Unclassified
314 2899924645 Variovorax sp. 369 Isolate Unclassified
315 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
316 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
317 2904456579 Variovorax sp. 2002 Isolate Unclassified
318 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
319 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
320 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
321 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
322 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
323 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
324 2928037797 Variovorax sp. 1126 Isolate Unclassified
325 2928044640 Variovorax sp. 1128 Isolate Unclassified
326 2928051484 Variovorax sp. 1133 Isolate Unclassified
327 2928058823 Ralstonia sp. 1138 Isolate Unclassified
328 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
329 2928070936 Variovorax gossypii 1167 Isolate Unclassified
330 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
331 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
332 2929520902 Variovorax beijingensis 502 Isolate Unclassified
333 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
334 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
335 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
336 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
337 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
338 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.86
Metatranscriptomes 0.34
Isolates 11.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.48
Nodule 2.05
Rhizoplane 1.54
Rhizosphere 50.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439461_0013314 3300041410 Bacteria 1552
2 SwRhRL2b_contig_3453642 2162886007 Bacteria 2242
3 JGI24736J21556_1000213 3300001904 Bacteria 10513
4 JGI24741J21665_1000455 3300001915 Bacteria 12414
5 JGI24740J21852_10001495 3300001979 Bacteria 10756
6 JGI24740J21852_10007624 3300001979 Bacteria 4384
7 JGI24739J22299_10015747 3300001989 Bacteria 2746
8 JGI24739J22299_10032305 3300001989 Bacteria 1802
9 JGI24737J22298_10003771 3300001990 Bacteria 5334
10 JGI25156J39149_1003003 3300002705 Bacteria 5730
11 JGI25154J39366_1000808 3300002738 Bacteria 13733
12 JGI25158J39367_1005146 3300002739 Bacteria 1930
13 JGI25152J39213_1000125 3300002773 Bacteria 52141
14 JGI25150J39212_1000001 3300002774 Bacteria 1318726
15 JGI25159J45721_1013119 3300002987 Bacteria 1936
16 JGI25151J46595_10000005 3300003187 Bacteria 431598
17 JGI25151J46595_10000484 3300003187 Bacteria 37639
18 JGI25151J46595_10003412 3300003187 Bacteria 8794
19 JGI25151J46595_10011787 3300003187 Bacteria 4005
20 JGI25406J46586_10002593 3300003203 Bacteria 8532
21 JGI25153J46596_10000018 3300003215 Bacteria 269774
22 JGI25153J46596_10003210 3300003215 Bacteria 9188
23 rootL2_10006496 3300003322 Bacteria 10326
24 rootL2_10052868 3300003322 Bacteria 3820
25 rootH1_10030765 3300003323 Bacteria 4680
26 Ga0006562J51391_1101349 3300003578 Bacteria 2440
27 Ga0006562J51391_1125836 3300003578 Bacteria 8135
28 Ga0055539_1000059 3300003752 Bacteria 146394
29 Ga0055533_1000225 3300003756 Bacteria 38201
30 Ga0055532_1000025 3300003758 Bacteria 240145
31 Ga0055525_1000682 3300003759 Bacteria 12767
32 Ga0055527_1000561 3300003760 Bacteria 12300
33 Ga0055535_1000019 3300003761 Bacteria 240145
34 Ga0055535_1001020 3300003761 Bacteria 17798
35 Ga0055542_1000631 3300003762 Bacteria 29605
36 Ga0055542_1002160 3300003762 Bacteria 7121
37 Ga0055529_1000035 3300003763 Bacteria 240145
38 Ga0055537_1000013 3300003773 Bacteria 133522
39 Ga0055537_1000019 3300003773 Bacteria 121414
40 Ga0055537_1001875 3300003773 Bacteria 7566
41 Ga0055524_1001844 3300003775 Bacteria 11603
42 Ga0055524_1017887 3300003775 Bacteria 2483
43 Ga0055536_1000404 3300003781 Bacteria 31254
44 Ga0055536_1001835 3300003781 Bacteria 12455
45 Ga0055536_1019418 3300003781 Bacteria 2138
46 Ga0055534_1000008 3300003784 Bacteria 211098
47 Ga0055534_1000022 3300003784 Bacteria 135637
48 Ga0055534_1001236 3300003784 Bacteria 10586
49 Ga0055528_1000078 3300003790 Bacteria 75471
50 Ga0055528_1000170 3300003790 Bacteria 54883
51 Ga0055528_1010726 3300003790 Bacteria 3701
52 Ga0055528_1025502 3300003790 Bacteria 1734
53 Ga0055530_10000255 3300003791 Bacteria 47942
54 Ga0055530_10017543 3300003791 Bacteria 2240
55 Ga0055530_10017990 3300003791 Bacteria 2195
56 Ga0055540_1000092 3300003792 Bacteria 98476
57 Ga0055540_1001765 3300003792 Bacteria 12335
58 Ga0055540_1002229 3300003792 Bacteria 10495
59 Ga0055540_1005050 3300003792 Bacteria 5716
60 Ga0055540_1019237 3300003792 Bacteria 1844
61 Ga0055531_10000084 3300003794 Bacteria 102550
62 Ga0055531_10001400 3300003794 Bacteria 17849
63 Ga0055531_10008379 3300003794 Bacteria 5466
64 Ga0055531_10035598 3300003794 Bacteria 1555
65 Ga0055541_1000363 3300003841 Bacteria 14049
66 Ga0055541_1002264 3300003841 Bacteria 3884
67 Ga0058692_1000134 3300003856 Bacteria 46732
68 Ga0055543_1003533 3300004625 Bacteria 4555
69 Ga0065165_1000551 3300005262 Bacteria 56364
70 Ga0065165_1000894 3300005262 Bacteria 38520
71 Ga0065165_1006526 3300005262 Bacteria 6082
72 Ga0065165_1012526 3300005262 Bacteria 3447
73 Ga0065714_10005110 3300005288 Bacteria 4160
74 Ga0065704_10073059 3300005289 Bacteria 7619
75 Ga0070682_100034432 3300005337 Bacteria 3085
76 Ga0070661_100000047 3300005344 Bacteria 92087
77 Ga0070661_100051053 3300005344 Bacteria 3026
78 Ga0070661_100123570 3300005344 Bacteria 1940
79 Ga0070668_100011167 3300005347 Bacteria 6687
80 Ga0070675_100068346 3300005354 Bacteria 2942
81 Ga0070659_100000219 3300005366 Bacteria 44254
82 Ga0070667_100038592 3300005367 Bacteria 4004
83 Ga0070663_100000009 3300005455 Bacteria 187718
84 Ga0070663_100019034 3300005455 Bacteria 4515
85 Ga0070678_100194890 3300005456 Bacteria 1668
86 Ga0070697_100188346 3300005536 Bacteria 1751
87 Ga0068853_100008834 3300005539 Bacteria 8105
88 Ga0068853_100076862 3300005539 Bacteria 2916
89 Ga0070672_100108980 3300005543 Bacteria 2255
90 Ga0070665_100023159 3300005548 Bacteria 6255
91 Ga0070664_100000011 3300005564 Bacteria 162277
92 Ga0070664_100071128 3300005564 Bacteria 2981
93 Ga0068857_100008434 3300005577 Bacteria 8906
94 Ga0068854_100000017 3300005578 Bacteria 142796
95 Ga0068854_100026841 3300005578 Bacteria 3962
96 Ga0068854_100110031 3300005578 Bacteria 2077
97 Ga0068856_100001403 3300005614 Bacteria 25255
98 Ga0068856_100039442 3300005614 Bacteria 4637
99 Ga0068852_100031887 3300005616 Bacteria 4356
100 Ga0068852_100104152 3300005616 Bacteria 2568
101 Ga0068851_10006262 3300005834 Bacteria 5430
102 Ga0068851_10007455 3300005834 Bacteria 5024
103 Ga0068851_10011785 3300005834 Bacteria 4107
104 Ga0068862_100080088 3300005844 Bacteria 2832
105 Ga0081455_10010574 3300005937 Bacteria 9345
106 Ga0081540_1008393 3300005983 Bacteria 7221
107 Ga0081540_1014183 3300005983 Bacteria 5125
108 Ga0081539_10004579 3300005985 Bacteria 15102
109 Ga0075363_100156483 3300006048 Bacteria 1288
110 Ga0075362_10008072 3300006177 Bacteria 4012
111 Ga0075367_10020481 3300006178 Bacteria 3684
112 Ga0075369_10020959 3300006186 Bacteria 2680
113 Ga0075366_10012655 3300006195 Bacteria 4791
114 Ga0075370_10000575 3300006353 Bacteria 14121
115 Ga0075370_10005084 3300006353 Bacteria 6484
116 Ga0075370_10017785 3300006353 Bacteria 3845
117 Ga0075370_10031491 3300006353 Bacteria 2961
118 Ga0079104_1008185 3300006946 Bacteria 3694
119 Ga0079104_1018733 3300006946 Bacteria 1953
120 Ga0099826_10000094 3300006948 Bacteria 42512
121 Ga0099826_10000134 3300006948 Bacteria 31806
122 Ga0099826_10080632 3300006948 Bacteria 2028
123 Ga0105251_10002314 3300009011 Bacteria 15101
124 Ga0105244_10026672 3300009036 Bacteria 3123
125 Ga0105240_10031669 3300009093 Bacteria 6853
126 Ga0105240_10150042 3300009093 Bacteria 2777
127 Ga0105245_10418132 3300009098 Bacteria 1343
128 Ga0105243_10000437 3300009148 Bacteria 43696
129 Ga0105243_10000697 3300009148 Bacteria 32602
130 Ga0105241_10028222 3300009174 Bacteria 4181
131 Ga0105242_10001959 3300009176 Bacteria 16204
132 Ga0105238_10020264 3300009551 Bacteria 6770
133 Ga0105238_10067188 3300009551 Bacteria 3586
134 Ga0105246_10016591 3300011119 Bacteria 4665
135 Ga0105246_10051219 3300011119 Bacteria 2834
136 Ga0157373_10001127 3300013100 Bacteria 20527
137 Ga0157373_10004276 3300013100 Bacteria 10747
138 Ga0157373_10014631 3300013100 Bacteria 5752
139 Ga0157371_10000033 3300013102 Bacteria 225328
140 Ga0157371_10165099 3300013102 Bacteria 1581
141 Ga0157370_10000010 3300013104 Bacteria 218199
142 Ga0157370_10027359 3300013104 Bacteria 5624
143 Ga0157369_10000625 3300013105 Bacteria 45958
144 Ga0157369_10049609 3300013105 Bacteria 4550
145 Ga0157372_10000176 3300013307 Bacteria 70656
146 Ga0157372_10034277 3300013307 Bacteria 5580
147 Ga0182008_10000677 3300014497 Bacteria 24604
148 Ga0182008_10002632 3300014497 Bacteria 11135
149 Ga0182008_10027131 3300014497 Bacteria 2903
150 Ga0182008_10126503 3300014497 Bacteria 1273
151 Ga0182006_1000005 3300015261 Bacteria 621201
152 Ga0182006_1002482 3300015261 Bacteria 10055
153 Ga0182006_1003147 3300015261 Bacteria 8631
154 Ga0182006_1005966 3300015261 Bacteria 5721
155 Ga0182006_1009388 3300015261 Bacteria 4385
156 Ga0182006_1014221 3300015261 Bacteria 3433
157 Ga0182006_1034455 3300015261 Bacteria 2025
158 Ga0182007_10000306 3300015262 Bacteria 31526
159 Ga0182007_10001861 3300015262 Bacteria 11003
160 Ga0182007_10005988 3300015262 Bacteria 5274
161 Ga0182007_10006473 3300015262 Bacteria 5024
162 Ga0182005_1000465 3300015265 Bacteria 20997
163 Ga0182005_1001929 3300015265 Bacteria 7854
164 Ga0182005_1008589 3300015265 Bacteria 3004
165 Ga0182005_1049922 3300015265 Bacteria 1137
166 Ga0163161_10000069 3300017792 Bacteria 103861
167 Ga0163161_10037100 3300017792 Bacteria 3493
168 Ga0163161_10086050 3300017792 Bacteria 2320
169 Ga0213873_10000811 3300021358 Bacteria 5043
170 Ga0213871_10000161 3300021441 Bacteria 7214
171 Ga0209435_105789 3300025206 Bacteria 1384
172 Ga0209436_102401 3300025208 Bacteria 5677
173 Ga0209784_100008 3300025224 Bacteria 740293
174 Ga0209784_102442 3300025224 Bacteria 1873
175 Ga0209784_102446 3300025224 Bacteria 1869
176 Ga0209566_100006 3300025225 Bacteria 789272
177 Ga0209566_100886 3300025225 Bacteria 14535
178 Ga0209566_101286 3300025225 Bacteria 8321
179 Ga0209674_100014 3300025226 Bacteria 704989
180 Ga0209674_100045 3300025226 Bacteria 362387
181 Ga0209674_103220 3300025226 Bacteria 3085
182 Ga0209674_107155 3300025226 Bacteria 1437
183 Ga0209672_100150 3300025228 Bacteria 62635
184 Ga0209672_102096 3300025228 Bacteria 5360
185 Ga0209147_100005 3300025229 Bacteria 1036530
186 Ga0209147_101760 3300025229 Bacteria 6935
187 Ga0209563_100016 3300025230 Bacteria 802091
188 Ga0209563_108720 3300025230 Bacteria 1581
189 Ga0209258_100007 3300025242 Bacteria 1036530
190 Ga0209258_100143 3300025242 Bacteria 165551
191 Ga0207425_1000002 3300025245 Bacteria 1362590
192 Ga0207425_1000127 3300025245 Bacteria 72085
193 Ga0209646_1000123 3300025246 Bacteria 142437
194 Ga0209026_1002844 3300025250 Bacteria 6115
195 Ga0209677_100008 3300025253 Bacteria 802091
196 Ga0209677_106812 3300025253 Bacteria 2603
197 Ga0209148_1000007 3300025254 Bacteria 1592273
198 Ga0209148_1000077 3300025254 Bacteria 298133
199 Ga0209148_1002367 3300025254 Bacteria 6622
200 Ga0209759_1001786 3300025256 Bacteria 10918
201 Ga0209759_1011183 3300025256 Bacteria 2571
202 Ga0209759_1027510 3300025256 Bacteria 1173
203 Ga0209129_1000002 3300025258 Bacteria 1359086
204 Ga0209129_1000117 3300025258 Bacteria 140115
205 Ga0209129_1000651 3300025258 Bacteria 23242
206 Ga0209129_1001126 3300025258 Bacteria 15524
207 Ga0209565_1000025 3300025263 Bacteria 377969
208 Ga0209565_1000042 3300025263 Bacteria 239712
209 Ga0209565_1000668 3300025263 Bacteria 21725
210 Ga0209455_1000011 3300025272 Bacteria 947242
211 Ga0209673_1000071 3300025273 Bacteria 239966
212 Ga0209673_1000077 3300025273 Bacteria 229470
213 Ga0209673_1000424 3300025273 Bacteria 73591
214 Ga0209673_1000722 3300025273 Bacteria 45860
215 Ga0209673_1003098 3300025273 Bacteria 10191
216 Ga0209673_1006154 3300025273 Bacteria 5878
217 Ga0209130_1000190 3300025284 Bacteria 86573
218 Ga0209130_1000722 3300025284 Bacteria 29240
219 Ga0209130_1000729 3300025284 Bacteria 29024
220 Ga0209130_1002960 3300025284 Bacteria 7743
221 Ga0209130_1003152 3300025284 Bacteria 7296
222 Ga0209675_1000017 3300025291 Bacteria 378002
223 Ga0209675_1000041 3300025291 Bacteria 239712
224 Ga0209675_1000972 3300025291 Bacteria 18110
225 Ga0209675_1010168 3300025291 Bacteria 3239
226 Ga0209676_1000034 3300025292 Bacteria 460125
227 Ga0209676_1000112 3300025292 Bacteria 208328
228 Ga0209676_1000123 3300025292 Bacteria 195351
229 Ga0209676_1000368 3300025292 Bacteria 83764
230 Ga0209676_1000674 3300025292 Bacteria 48485
231 Ga0209676_1002906 3300025292 Bacteria 11222
232 Ga0209676_1005012 3300025292 Bacteria 7091
233 Ga0209676_1011186 3300025292 Bacteria 3647
234 Ga0209676_1012772 3300025292 Bacteria 3269
235 Ga0209025_1000004 3300025294 Bacteria 1361782
236 Ga0209025_1000038 3300025294 Bacteria 380508
237 Ga0209025_1000207 3300025294 Bacteria 140774
238 Ga0209025_1000233 3300025294 Bacteria 130512
239 Ga0209025_1022555 3300025294 Bacteria 3332
240 Ga0209564_1000108 3300025295 Bacteria 213699
241 Ga0209564_1000212 3300025295 Bacteria 133160
242 Ga0209564_1010080 3300025295 Bacteria 4403
243 Ga0209564_1010647 3300025295 Bacteria 4207
244 Ga0209564_1012008 3300025295 Bacteria 3819
245 Ga0209564_1028426 3300025295 Bacteria 1787
246 Ga0209758_1000006 3300025297 Bacteria 1359562
247 Ga0209758_1000051 3300025297 Bacteria 342477
248 Ga0209758_1000330 3300025297 Bacteria 89233
249 Ga0209758_1001566 3300025297 Bacteria 26231
250 Ga0209758_1002510 3300025297 Bacteria 18630
251 Ga0209050_1000052 3300025298 Bacteria 351785
252 Ga0209050_1000165 3300025298 Bacteria 152109
253 Ga0209050_1000188 3300025298 Bacteria 138865
254 Ga0209050_1002585 3300025298 Bacteria 15027
255 Ga0209050_1004450 3300025298 Bacteria 9458
256 Ga0209050_1009353 3300025298 Bacteria 5029
257 Ga0209256_1000101 3300025299 Bacteria 200246
258 Ga0209256_1000275 3300025299 Bacteria 90061
259 Ga0209256_1001103 3300025299 Bacteria 30965
260 Ga0207426_1000086 3300025302 Bacteria 292089
261 Ga0207426_1000207 3300025302 Bacteria 140594
262 Ga0209051_1000091 3300025303 Bacteria 173683
263 Ga0209051_1000105 3300025303 Bacteria 160893
264 Ga0209051_1000310 3300025303 Bacteria 76181
265 Ga0209051_1000931 3300025303 Bacteria 28957
266 Ga0209051_1001689 3300025303 Bacteria 17720
267 Ga0209051_1001976 3300025303 Bacteria 15764
268 Ga0209051_1010374 3300025303 Bacteria 4715
269 Ga0209051_1010644 3300025303 Bacteria 4616
270 Ga0209051_1022570 3300025303 Bacteria 2646
271 Ga0209051_1040927 3300025303 Bacteria 1655
272 Ga0209257_1000033 3300025304 Bacteria 671006
273 Ga0209257_1000037 3300025304 Bacteria 612915
274 Ga0209257_1000057 3300025304 Bacteria 396985
275 Ga0209257_1000155 3300025304 Bacteria 182928
276 Ga0209257_1000165 3300025304 Bacteria 172773
277 Ga0209257_1001583 3300025304 Bacteria 26197
278 Ga0209257_1001661 3300025304 Bacteria 25211
279 Ga0209257_1002035 3300025304 Bacteria 21550
280 Ga0209257_1015933 3300025304 Bacteria 3080
281 Ga0207656_10011110 3300025321 Bacteria 3394
282 Ga0207656_10020436 3300025321 Bacteria 2632
283 Ga0207656_10025553 3300025321 Bacteria 2399
284 Ga0207655_1001077 3300025728 Bacteria 27081
285 Ga0207713_1003776 3300025735 Bacteria 10156
286 Ga0207647_10000795 3300025904 Bacteria 24482
287 Ga0207647_10025332 3300025904 Bacteria 3900
288 Ga0207643_10102224 3300025908 Bacteria 1681
289 Ga0207695_10001192 3300025913 Bacteria 44681
290 Ga0207695_10133491 3300025913 Bacteria 2438
291 Ga0207695_10186008 3300025913 Bacteria 1996
292 Ga0207649_10000123 3300025920 Bacteria 65761
293 Ga0207649_10126030 3300025920 Bacteria 1733
294 Ga0207694_10039889 3300025924 Bacteria 3614
295 Ga0207650_10009701 3300025925 Bacteria 6581
296 Ga0207659_10009413 3300025926 Bacteria 6103
297 Ga0207690_10007131 3300025932 Bacteria 6639
298 Ga0207706_10018020 3300025933 Bacteria 6353
299 Ga0207709_10001138 3300025935 Bacteria 19380
300 Ga0207709_10002102 3300025935 Bacteria 12830
301 Ga0207709_10022949 3300025935 Bacteria 3546
302 Ga0207669_10233343 3300025937 Bacteria 1359
303 Ga0207691_10111645 3300025940 Bacteria 2430
304 Ga0207691_10139990 3300025940 Bacteria 2133
305 Ga0207679_10000002 3300025945 Bacteria 634491
306 Ga0207679_10037205 3300025945 Bacteria 3458
307 Ga0207640_10000138 3300025981 Bacteria 53518
308 Ga0207639_10043453 3300026041 Bacteria 3374
309 Ga0207678_10000015 3300026067 Bacteria 138937
310 Ga0207678_10014630 3300026067 Bacteria 6905
311 Ga0207702_10000084 3300026078 Bacteria 106893
312 Ga0207702_10000439 3300026078 Bacteria 47451
313 Ga0207674_10029135 3300026116 Bacteria 5818
314 Ga0207683_10002345 3300026121 Bacteria 16591
315 Ga0207698_10013551 3300026142 Bacteria 5385
316 Ga0207698_10062120 3300026142 Bacteria 2915
317 Ga0209281_1007513 3300027111 Bacteria 2730
318 Ga0209371_1000287 3300027312 Bacteria 57449
319 Ga0209282_1000284 3300027666 Bacteria 25112
320 Ga0209282_1000514 3300027666 Bacteria 18748
321 Ga0268266_10014007 3300028379 Bacteria 6904
322 Ga0268266_10020710 3300028379 Bacteria 5605
323 Ga0268265_10215524 3300028380 Bacteria 1676
324 Ga0307517_10121620 3300028786 Bacteria 1927
325 Ga0307515_10216574 3300028794 Bacteria 1744
326 Ga0268256_1000246 3300030500 Bacteria 57449
327 Ga0316177_1065197 3300030731 Bacteria 12064
328 Ga0316177_1126769 3300030731 Bacteria 1798
329 Ga0316176_1111813 3300030732 Bacteria 5509
330 Ga0314311_1003955 3300030733 Bacteria 14033
331 Ga0314311_1025606 3300030733 Bacteria 10180
332 Ga0316178_1010980 3300030735 Bacteria 8170
333 Ga0316180_1083076 3300030736 Bacteria 3252
334 Ga0316183_1004159 3300030742 Bacteria 9138
335 Ga0316181_1031937 3300030744 Bacteria 2883
336 Ga0316182_1309389 3300030745 Bacteria 3213
337 Ga0307408_100000089 3300031548 Bacteria 100712
338 Ga0307408_100025137 3300031548 Bacteria 4075
339 Ga0307408_100037470 3300031548 Bacteria 3416
340 Ga0307408_100044346 3300031548 Bacteria 3169
341 Ga0307408_100062955 3300031548 Bacteria 2712
342 Ga0307408_100067190 3300031548 Bacteria 2635
343 Ga0307408_100080624 3300031548 Bacteria 2431
344 Ga0307408_100203660 3300031548 Bacteria 1603
345 Ga0307408_100318943 3300031548 Bacteria 1308
346 Ga0307514_10010993 3300031649 Bacteria 7554
347 Ga0307405_10117325 3300031731 Bacteria 1814
348 Ga0307405_10158218 3300031731 Bacteria 1601
349 Ga0307405_10173366 3300031731 Bacteria 1541
350 Ga0307405_10256239 3300031731 Bacteria 1304
351 Ga0307406_10000503 3300031901 Bacteria 22402
352 Ga0307406_10004554 3300031901 Bacteria 7550
353 Ga0307406_10039205 3300031901 Bacteria 2938
354 Ga0307406_10053593 3300031901 Bacteria 2570
355 Ga0307406_10314280 3300031901 Bacteria 1209
356 Ga0307412_10002927 3300031911 Bacteria 9474
357 Ga0307412_10033901 3300031911 Bacteria 3249
358 Ga0307412_10090085 3300031911 Bacteria 2143
359 Ga0307412_10192070 3300031911 Bacteria 1544
360 Ga0307416_100117383 3300032002 Bacteria 2362
361 Ga0307416_100246348 3300032002 Bacteria 1736
362 Ga0307414_10073706 3300032004 Bacteria 2471
363 Ga0307414_10259845 3300032004 Bacteria 1448
364 Ga0307411_10043915 3300032005 Bacteria 2863
365 Ga0307510_10000590 3300033180 Bacteria 36615
366 Ga0373936_0003668 3300035113 Bacteria 5763
367 Ga0395900_0001077 3300037418 Bacteria 34739
368 Ga0395905_0002965 3300037471 Bacteria 18449
369 Ga0395905_0004107 3300037471 Bacteria 15255
370 Ga0395905_0006792 3300037471 Bacteria 11467
371 Ga0395905_0184534 3300037471 Bacteria 1958
372 Ga0237816_00053 3300039145 Bacteria 7579
373 Ga0436360_0253978 3300039438 Bacteria 1807
374 Ga0436361_0795914 3300039447 Bacteria 15178
375 Ga0436362_0462054 3300039453 Bacteria 13636
376 Ga0439436_0002621 3300041404 Bacteria 5417
377 Ga0439436_0003496 3300041404 Bacteria 4777
378 Ga0439436_0024437 3300041404 Bacteria 1783
379 Ga0439438_040783 3300041405 Bacteria 1206
380 Ga0439447_022269 3300041407 Bacteria 1661
381 Ga0439461_0006710 3300041410 Bacteria 2012
382 Ga0439461_0011501 3300041410 Bacteria 1644
383 Ga0439466_0000817 3300041411 Bacteria 11861
384 Ga0439466_0009786 3300041411 Bacteria 3573
385 Ga0439465_0000044 3300041413 Bacteria 25602
386 Ga0439465_0000099 3300041413 Bacteria 19766
387 Ga0439465_0002652 3300041413 Bacteria 5845
388 Ga0439465_0010149 3300041413 Bacteria 2960
389 Ga0439465_0013837 3300041413 Bacteria 2512
390 Ga0439465_0034027 3300041413 Bacteria 1630
391 Ga0451789_0073983 3300041443 Bacteria 4563
392 Ga0451802_0472186 3300041460 Bacteria 1605
393 Ga0451807_2373347 3300041486 Bacteria 2215
394 Ga0439431_0002493 3300041997 Bacteria 4074
395 Ga0439433_0008415 3300041999 Bacteria 2237
396 Ga0439442_003511 3300042002 Bacteria 3099
397 Ga0439445_0002459 3300042004 Bacteria 4127
398 Ga0439445_0003107 3300042004 Bacteria 3721
399 Ga0439445_0003288 3300042004 Bacteria 3628
400 Ga0439432_000645 3300042006 Bacteria 13060
401 Ga0439449_0000043 3300042007 Bacteria 38727
402 Ga0439449_0001392 3300042007 Bacteria 9448
403 Ga0439449_0001579 3300042007 Bacteria 8935
404 Ga0439449_0002363 3300042007 Bacteria 7390
405 Ga0439449_0007804 3300042007 Bacteria 4064
406 Ga0439449_0020088 3300042007 Bacteria 2503
407 Ga0439449_0029224 3300042007 Bacteria 2054
408 Ga0439452_001701 3300042010 Bacteria 8652
409 Ga0439452_004538 3300042010 Bacteria 4639
410 Ga0439457_003783 3300042014 Bacteria 4063
411 Ga0439457_017504 3300042014 Bacteria 1592
412 Ga0439462_0004000 3300042015 Bacteria 3573
413 Ga0450917_000950 3300042120 Bacteria 2134
414 Ga0450888_000033 3300042126 Bacteria 9827
415 Ga0450890_000454 3300042127 Bacteria 5983
416 Ga0450891_000485 3300042129 Bacteria 4171
417 Ga0450894_003636 3300042131 Bacteria 2015
418 Ga0450889_000671 3300042144 Bacteria 3752
419 Ga0450906_000479 3300042145 Bacteria 8405
420 Ga0450910_000864 3300042147 Bacteria 3661
421 Ga0439446_0008483 3300042156 Bacteria 2730
422 Ga0450893_0000749 3300042532 Bacteria 4740
423 Ga0450893_0000788 3300042532 Bacteria 4645
424 Ga0466964_0022722 3300044706 Bacteria 2435
425 Ga0466968_0008060 3300044735 Bacteria 4026
426 Ga0466960_0057903 3300044901 Bacteria 1891
427 Ga0466959_0001259 3300045049 Bacteria 15304
428 Ga0451576_0055654 3300045051 Bacteria 4137
429 Ga0451576_0275013 3300045051 Bacteria 1761
430 Ga0495617_000051 3300046452 Bacteria 106590
431 Ga0495617_001023 3300046452 Bacteria 12857
432 Ga0495627_011925 3300046453 Bacteria 3099
433 Ga0495629_0007477 3300046459 Bacteria 8052
434 Ga0495638_0000034 3300046460 Bacteria 282038
435 Ga0495638_0004453 3300046460 Bacteria 10608
436 Ga0495662_0022836 3300046476 Bacteria 3020
437 Ga0495596_0005603 3300046500 Bacteria 5904
438 Ga0495583_0011777 3300046506 Bacteria 5003
439 Ga0495583_0018885 3300046506 Bacteria 3614
440 Ga0495583_0030765 3300046506 Bacteria 2610
441 Ga0495620_0000528 3300046515 Bacteria 24611
442 Ga0495631_0000181 3300046518 Bacteria 42933
443 Ga0495632_0003657 3300046519 Bacteria 10785
444 Ga0495632_0012148 3300046519 Bacteria 4978
445 Ga0495637_0014351 3300046520 Bacteria 3737
446 Ga0495648_0000559 3300046524 Bacteria 39811
447 Ga0495609_0011433 3300046538 Bacteria 4227
448 Ga0495597_0001694 3300046542 Bacteria 15260
449 Ga0495597_0018785 3300046542 Bacteria 3239
450 Ga0495668_0091303 3300046616 Bacteria 1668
451 Ga0495611_0000001 3300046648 Bacteria 2628469
452 Ga0495625_0000001 3300046660 Bacteria 1641829
453 Ga0495625_0002228 3300046660 Bacteria 21425
454 Ga0495625_0014279 3300046660 Bacteria 6347
455 Ga0495661_0001957 3300046665 Bacteria 16346
456 Ga0495588_0031066 3300046674 Bacteria 2687
457 Ga0495624_0090673 3300046690 Bacteria 1886
458 Ga0495670_0011602 3300046691 Bacteria 4336
459 Ga0495671_0000480 3300046692 Bacteria 31034
460 Ga0495589_0000016 3300046794 Bacteria 209027
461 Ga0495589_0000033 3300046794 Bacteria 162794
462 Ga0495600_0023363 3300046809 Bacteria 3977
463 Ga0495660_0000116 3300046810 Bacteria 85798
464 Ga0495660_0039333 3300046810 Bacteria 2627
465 Ga0495604_0016513 3300047317 Bacteria 5902
466 Ga0495673_0006015 3300047469 Bacteria 7213
467 Ga0496101_0137187 3300048904 Bacteria 1862
468 Ga0496109_0217840 3300048912 Bacteria 1795
469 Ga0496116_0022642 3300048919 Bacteria 4703
470 Ga0496116_0032689 3300048919 Bacteria 3704
471 Ga0496116_0092669 3300048919 Bacteria 1832
472 Ga0496117_0020176 3300048920 Bacteria 5443
473 Ga0496119_0000140 3300048922 Bacteria 101373
474 Ga0496120_0000011 3300048923 Bacteria 365549
475 Ga0496122_0000253 3300048925 Bacteria 120534
476 Ga0496123_0000206 3300048926 Bacteria 120598
477 Ga0496123_0034010 3300048926 Bacteria 3659
478 Ga0496124_0000148 3300048927 Bacteria 144782
479 Ga0496124_0019236 3300048927 Bacteria 6365
480 Ga0496125_0003277 3300048928 Bacteria 19903
481 Ga0496125_0004592 3300048928 Bacteria 15784
482 Ga0496125_0015965 3300048928 Bacteria 7232
483 Ga0496125_0018669 3300048928 Bacteria 6578
484 Ga0496125_0185946 3300048928 Bacteria 1378
485 Ga0496126_0055411 3300048929 Bacteria 3587
486 Ga0495678_000475 3300049459 Bacteria 39998
487 Ga0495682_0000576 3300049460 Bacteria 24893
488 Ga0501034_0000192 3300049571 Bacteria 115486
489 Ga0501225_0000443 3300049705 Bacteria 12897
490 Ga0501225_0003433 3300049705 Bacteria 4803
491 Ga0501262_000053 3300049759 Bacteria 14398
492 Ga0501262_000168 3300049759 Bacteria 8158
493 nmdc:mga03683_2333_c1 3300050489 Bacteria 5873
494 nmdc:mga03683_7387_c1 3300050489 Bacteria 3815
495 nmdc:mga03n38_148455_c1 3300050490 Bacteria 1178
496 nmdc:mga0k408_16219_c1 3300050493 Bacteria 4131
497 nmdc:mga0k408_38416_c1 3300050493 Bacteria 2747
498 nmdc:mga07m45_1263_c1 3300050496 Bacteria 11509
499 nmdc:mga07m45_7762_c1 3300050496 Bacteria 2878
500 nmdc:mga0n895_102241_c1 3300050512 Bacteria 2876
501 nmdc:mga0sz30_35295_c1 3300050516 Bacteria 2086
502 Ga0500578_0000007 3300053086 Bacteria 229642
503 Ga0500643_000002 3300053087 Bacteria 1277657
504 Ga0500643_009293 3300053087 Bacteria 3764
505 Ga0500644_0020853 3300053088 Bacteria 1955
506 Ga0500651_0063488 3300053093 Bacteria 2304
507 Ga0500555_000288 3300053103 Bacteria 21733
508 Ga0500652_000180 3300053131 Bacteria 24388
509 Ga0500658_0000038 3300053134 Bacteria 84273
510 Ga0500658_0001016 3300053134 Bacteria 11446
511 Ga0500568_0000906 3300053139 Bacteria 20454
512 Ga0500616_0018226 3300053153 Bacteria 3972
513 Ga0500622_0000317 3300053156 Bacteria 48503
514 Ga0500645_001386 3300053730 Bacteria 12362
515 Ga0500645_002224 3300053730 Bacteria 8847
516 Ga0466962_0005855 3300061719 Bacteria 5905
517 2513226984 2513020051 Bacteria 6053213
518 2562464120 2561511199 Bacteria 5155034
519 2587726471 2585428057 Bacteria 6737412
520 2587734624 2585428058 Bacteria 6853932
521 2588291073 2588253510 Bacteria 6901809
522 2599446292 2599185178 Bacteria 5365746
523 2599621096 2599185214 Bacteria 8209958
524 2599675114 2599185226 Bacteria 8233575
525 2599678288 2599185227 Bacteria 8246414
526 2599690607 2599185229 Bacteria 8216126
527 2643818972 2643221559 Bacteria 4424915
528 2643941357 2643221586 Bacteria 4446529
529 2643971987 2643221592 Bacteria 6608788
530 2644080398 2643221612 Bacteria 4361984
531 2644142186 2643221625 Bacteria 6512927
532 2644275880 2643221648 Bacteria 6521465
533 2644324138 2643221658 Bacteria 6064537
534 2644397264 2643221672 Bacteria 6322190
535 2644467714 2643221683 Bacteria 5749203
536 2644697011 2643221727 Bacteria 4415595
537 2644745486 2643221736 Bacteria 6608466
538 2735837088 2734482264 Unclassified 5014763
539 2738718423 2738541277 Bacteria 7458140
540 2738882871 2738541307 Bacteria 8606193
541 2739056342 2738541337 Bacteria 6183410
542 2739226546 2738543009 Bacteria 4944499
543 2739281610 2738543019 Bacteria 7459457
544 2792313835 2791355010 Bacteria 4864581
545 2819564310 2818991440 Bacteria 4774720
546 2819602405 2818991446 Bacteria 7757362
547 2819664001 2818991457 Bacteria 5323295
548 2819713776 2818991466 Bacteria 4748179
549 2831270059 2831265667 Bacteria 7184833
550 2834643196 2834641062 Bacteria 5559922
551 2838054932 2838054893 Bacteria 7451788
552 2841915351 2841911363 Bacteria 6173697
553 2841922248 2841917233 Bacteria 6173500
554 2842679377 2842677519 Bacteria 5615038
555 2842680357 2842677519 Bacteria 5615038
556 2852685746 2852684882 Bacteria 5463342
557 2884413428 2884411467 Bacteria 5246714
558 2885195174 2885192300 Bacteria 5882526
559 2885202099 2885198086 Bacteria 7212419
560 2885215191 2885211737 Bacteria 7212420
561 2899927013 2899924645 Bacteria 7487985
562 2900579115 2900577576 Bacteria 5438534
563 2904453496 2904449895 Bacteria 6927402
564 2904463072 2904456579 Bacteria 6819253
565 2904464953 2904463128 Bacteria 4775606
566 2904542333 2904541872 Bacteria 8915136
567 2904581731 2904578770 Bacteria 5302906
568 2919123398 2919119836 Bacteria 5208557
569 2919466490 2919462493 Bacteria 5817112
570 2920826495 2920822456 Bacteria 6897201
571 2928042488 2928037797 Bacteria 7273642
572 2928048513 2928044640 Bacteria 7271509
573 2928054838 2928051484 Bacteria 7773759
574 2928059438 2928058823 Bacteria 5520022
575 2928068276 2928064002 Bacteria 7419480
576 2928073829 2928070936 Bacteria 8062541
577 2928089885 2928084124 Bacteria 7159212
578 2929167605 2929160207 Bacteria 9075316
579 2929525085 2929520902 Bacteria 6765052
580 2945912925 2945909444 Bacteria 7065066
581 2945950543 2945945610 Bacteria 5951079
582 2945972210 2945972063 Bacteria 6086495
583 2945984793 2945984333 Bacteria 7358892
584 2954768279 2954767861 Bacteria 5535784
585 3003671615 3003665799 Bacteria 7279786
586 Ga0439461_0013314
587 SwRhRL2b_contig_3453642
588 JGI24736J21556_1000213
589 JGI24741J21665_1000455
590 JGI24740J21852_10001495
591 JGI24740J21852_10007624
592 JGI24739J22299_10015747
593 JGI24739J22299_10032305
594 JGI24737J22298_10003771
595 JGI25156J39149_1003003
596 JGI25154J39366_1000808
597 JGI25158J39367_1005146
598 JGI25152J39213_1000125
599 JGI25150J39212_1000001
600 JGI25159J45721_1013119
601 JGI25151J46595_10000005
602 JGI25151J46595_10000484
603 JGI25151J46595_10003412
604 JGI25151J46595_10011787
605 JGI25406J46586_10002593
606 JGI25153J46596_10000018
607 JGI25153J46596_10003210
608 rootL2_10006496
609 rootL2_10052868
610 rootH1_10030765
611 Ga0006562J51391_1101349
612 Ga0006562J51391_1125836
613 Ga0055539_1000059
614 Ga0055533_1000225
615 Ga0055532_1000025
616 Ga0055525_1000682
617 Ga0055527_1000561
618 Ga0055535_1000019
619 Ga0055535_1001020
620 Ga0055542_1000631
621 Ga0055542_1002160
622 Ga0055529_1000035
623 Ga0055537_1000013
624 Ga0055537_1000019
625 Ga0055537_1001875
626 Ga0055524_1001844
627 Ga0055524_1017887
628 Ga0055536_1000404
629 Ga0055536_1001835
630 Ga0055536_1019418
631 Ga0055534_1000008
632 Ga0055534_1000022
633 Ga0055534_1001236
634 Ga0055528_1000078
635 Ga0055528_1000170
636 Ga0055528_1010726
637 Ga0055528_1025502
638 Ga0055530_10000255
639 Ga0055530_10017543
640 Ga0055530_10017990
641 Ga0055540_1000092
642 Ga0055540_1001765
643 Ga0055540_1002229
644 Ga0055540_1005050
645 Ga0055540_1019237
646 Ga0055531_10000084
647 Ga0055531_10001400
648 Ga0055531_10008379
649 Ga0055531_10035598
650 Ga0055541_1000363
651 Ga0055541_1002264
652 Ga0058692_1000134
653 Ga0055543_1003533
654 Ga0065165_1000551
655 Ga0065165_1000894
656 Ga0065165_1006526
657 Ga0065165_1012526
658 Ga0065714_10005110
659 Ga0065704_10073059
660 Ga0070682_100034432
661 Ga0070661_100000047
662 Ga0070661_100051053
663 Ga0070661_100123570
664 Ga0070668_100011167
665 Ga0070675_100068346
666 Ga0070659_100000219
667 Ga0070667_100038592
668 Ga0070663_100000009
669 Ga0070663_100019034
670 Ga0070678_100194890
671 Ga0070697_100188346
672 Ga0068853_100008834
673 Ga0068853_100076862
674 Ga0070672_100108980
675 Ga0070665_100023159
676 Ga0070664_100000011
677 Ga0070664_100071128
678 Ga0068857_100008434
679 Ga0068854_100000017
680 Ga0068854_100026841
681 Ga0068854_100110031
682 Ga0068856_100001403
683 Ga0068856_100039442
684 Ga0068852_100031887
685 Ga0068852_100104152
686 Ga0068851_10006262
687 Ga0068851_10007455
688 Ga0068851_10011785
689 Ga0068862_100080088
690 Ga0081455_10010574
691 Ga0081540_1008393
692 Ga0081540_1014183
693 Ga0081539_10004579
694 Ga0075363_100156483
695 Ga0075362_10008072
696 Ga0075367_10020481
697 Ga0075369_10020959
698 Ga0075366_10012655
699 Ga0075370_10000575
700 Ga0075370_10005084
701 Ga0075370_10017785
702 Ga0075370_10031491
703 Ga0079104_1008185
704 Ga0079104_1018733
705 Ga0099826_10000094
706 Ga0099826_10000134
707 Ga0099826_10080632
708 Ga0105251_10002314
709 Ga0105244_10026672
710 Ga0105240_10031669
711 Ga0105240_10150042
712 Ga0105245_10418132
713 Ga0105243_10000437
714 Ga0105243_10000697
715 Ga0105241_10028222
716 Ga0105242_10001959
717 Ga0105238_10020264
718 Ga0105238_10067188
719 Ga0105246_10016591
720 Ga0105246_10051219
721 Ga0157373_10001127
722 Ga0157373_10004276
723 Ga0157373_10014631
724 Ga0157371_10000033
725 Ga0157371_10165099
726 Ga0157370_10000010
727 Ga0157370_10027359
728 Ga0157369_10000625
729 Ga0157369_10049609
730 Ga0157372_10000176
731 Ga0157372_10034277
732 Ga0182008_10000677
733 Ga0182008_10002632
734 Ga0182008_10027131
735 Ga0182008_10126503
736 Ga0182006_1000005
737 Ga0182006_1002482
738 Ga0182006_1003147
739 Ga0182006_1005966
740 Ga0182006_1009388
741 Ga0182006_1014221
742 Ga0182006_1034455
743 Ga0182007_10000306
744 Ga0182007_10001861
745 Ga0182007_10005988
746 Ga0182007_10006473
747 Ga0182005_1000465
748 Ga0182005_1001929
749 Ga0182005_1008589
750 Ga0182005_1049922
751 Ga0163161_10000069
752 Ga0163161_10037100
753 Ga0163161_10086050
754 Ga0213873_10000811
755 Ga0213871_10000161
756 Ga0209435_105789
757 Ga0209436_102401
758 Ga0209784_100008
759 Ga0209784_102442
760 Ga0209784_102446
761 Ga0209566_100006
762 Ga0209566_100886
763 Ga0209566_101286
764 Ga0209674_100014
765 Ga0209674_100045
766 Ga0209674_103220
767 Ga0209674_107155
768 Ga0209672_100150
769 Ga0209672_102096
770 Ga0209147_100005
771 Ga0209147_101760
772 Ga0209563_100016
773 Ga0209563_108720
774 Ga0209258_100007
775 Ga0209258_100143
776 Ga0207425_1000002
777 Ga0207425_1000127
778 Ga0209646_1000123
779 Ga0209026_1002844
780 Ga0209677_100008
781 Ga0209677_106812
782 Ga0209148_1000007
783 Ga0209148_1000077
784 Ga0209148_1002367
785 Ga0209759_1001786
786 Ga0209759_1011183
787 Ga0209759_1027510
788 Ga0209129_1000002
789 Ga0209129_1000117
790 Ga0209129_1000651
791 Ga0209129_1001126
792 Ga0209565_1000025
793 Ga0209565_1000042
794 Ga0209565_1000668
795 Ga0209455_1000011
796 Ga0209673_1000071
797 Ga0209673_1000077
798 Ga0209673_1000424
799 Ga0209673_1000722
800 Ga0209673_1003098
801 Ga0209673_1006154
802 Ga0209130_1000190
803 Ga0209130_1000722
804 Ga0209130_1000729
805 Ga0209130_1002960
806 Ga0209130_1003152
807 Ga0209675_1000017
808 Ga0209675_1000041
809 Ga0209675_1000972
810 Ga0209675_1010168
811 Ga0209676_1000034
812 Ga0209676_1000112
813 Ga0209676_1000123
814 Ga0209676_1000368
815 Ga0209676_1000674
816 Ga0209676_1002906
817 Ga0209676_1005012
818 Ga0209676_1011186
819 Ga0209676_1012772
820 Ga0209025_1000004
821 Ga0209025_1000038
822 Ga0209025_1000207
823 Ga0209025_1000233
824 Ga0209025_1022555
825 Ga0209564_1000108
826 Ga0209564_1000212
827 Ga0209564_1010080
828 Ga0209564_1010647
829 Ga0209564_1012008
830 Ga0209564_1028426
831 Ga0209758_1000006
832 Ga0209758_1000051
833 Ga0209758_1000330
834 Ga0209758_1001566
835 Ga0209758_1002510
836 Ga0209050_1000052
837 Ga0209050_1000165
838 Ga0209050_1000188
839 Ga0209050_1002585
840 Ga0209050_1004450
841 Ga0209050_1009353
842 Ga0209256_1000101
843 Ga0209256_1000275
844 Ga0209256_1001103
845 Ga0207426_1000086
846 Ga0207426_1000207
847 Ga0209051_1000091
848 Ga0209051_1000105
849 Ga0209051_1000310
850 Ga0209051_1000931
851 Ga0209051_1001689
852 Ga0209051_1001976
853 Ga0209051_1010374
854 Ga0209051_1010644
855 Ga0209051_1022570
856 Ga0209051_1040927
857 Ga0209257_1000033
858 Ga0209257_1000037
859 Ga0209257_1000057
860 Ga0209257_1000155
861 Ga0209257_1000165
862 Ga0209257_1001583
863 Ga0209257_1001661
864 Ga0209257_1002035
865 Ga0209257_1015933
866 Ga0207656_10011110
867 Ga0207656_10020436
868 Ga0207656_10025553
869 Ga0207655_1001077
870 Ga0207713_1003776
871 Ga0207647_10000795
872 Ga0207647_10025332
873 Ga0207643_10102224
874 Ga0207695_10001192
875 Ga0207695_10133491
876 Ga0207695_10186008
877 Ga0207649_10000123
878 Ga0207649_10126030
879 Ga0207694_10039889
880 Ga0207650_10009701
881 Ga0207659_10009413
882 Ga0207690_10007131
883 Ga0207706_10018020
884 Ga0207709_10001138
885 Ga0207709_10002102
886 Ga0207709_10022949
887 Ga0207669_10233343
888 Ga0207691_10111645
889 Ga0207691_10139990
890 Ga0207679_10000002
891 Ga0207679_10037205
892 Ga0207640_10000138
893 Ga0207639_10043453
894 Ga0207678_10000015
895 Ga0207678_10014630
896 Ga0207702_10000084
897 Ga0207702_10000439
898 Ga0207674_10029135
899 Ga0207683_10002345
900 Ga0207698_10013551
901 Ga0207698_10062120
902 Ga0209281_1007513
903 Ga0209371_1000287
904 Ga0209282_1000284
905 Ga0209282_1000514
906 Ga0268266_10014007
907 Ga0268266_10020710
908 Ga0268265_10215524
909 Ga0307517_10121620
910 Ga0307515_10216574
911 Ga0268256_1000246
912 Ga0316177_1065197
913 Ga0316177_1126769
914 Ga0316176_1111813
915 Ga0314311_1003955
916 Ga0314311_1025606
917 Ga0316178_1010980
918 Ga0316180_1083076
919 Ga0316183_1004159
920 Ga0316181_1031937
921 Ga0316182_1309389
922 Ga0307408_100000089
923 Ga0307408_100025137
924 Ga0307408_100037470
925 Ga0307408_100044346
926 Ga0307408_100062955
927 Ga0307408_100067190
928 Ga0307408_100080624
929 Ga0307408_100203660
930 Ga0307408_100318943
931 Ga0307514_10010993
932 Ga0307405_10117325
933 Ga0307405_10158218
934 Ga0307405_10173366
935 Ga0307405_10256239
936 Ga0307406_10000503
937 Ga0307406_10004554
938 Ga0307406_10039205
939 Ga0307406_10053593
940 Ga0307406_10314280
941 Ga0307412_10002927
942 Ga0307412_10033901
943 Ga0307412_10090085
944 Ga0307412_10192070
945 Ga0307416_100117383
946 Ga0307416_100246348
947 Ga0307414_10073706
948 Ga0307414_10259845
949 Ga0307411_10043915
950 Ga0307510_10000590
951 Ga0373936_0003668
952 Ga0395900_0001077
953 Ga0395905_0002965
954 Ga0395905_0004107
955 Ga0395905_0006792
956 Ga0395905_0184534
957 Ga0237816_00053
958 Ga0436360_0253978
959 Ga0436361_0795914
960 Ga0436362_0462054
961 Ga0439436_0002621
962 Ga0439436_0003496
963 Ga0439436_0024437
964 Ga0439438_040783
965 Ga0439447_022269
966 Ga0439461_0006710
967 Ga0439461_0011501
968 Ga0439466_0000817
969 Ga0439466_0009786
970 Ga0439465_0000044
971 Ga0439465_0000099
972 Ga0439465_0002652
973 Ga0439465_0010149
974 Ga0439465_0013837
975 Ga0439465_0034027
976 Ga0451789_0073983
977 Ga0451802_0472186
978 Ga0451807_2373347
979 Ga0439431_0002493
980 Ga0439433_0008415
981 Ga0439442_003511
982 Ga0439445_0002459
983 Ga0439445_0003107
984 Ga0439445_0003288
985 Ga0439432_000645
986 Ga0439449_0000043
987 Ga0439449_0001392
988 Ga0439449_0001579
989 Ga0439449_0002363
990 Ga0439449_0007804
991 Ga0439449_0020088
992 Ga0439449_0029224
993 Ga0439452_001701
994 Ga0439452_004538
995 Ga0439457_003783
996 Ga0439457_017504
997 Ga0439462_0004000
998 Ga0450917_000950
999 Ga0450888_000033
1000 Ga0450890_000454
1001 Ga0450891_000485
1002 Ga0450894_003636
1003 Ga0450889_000671
1004 Ga0450906_000479
1005 Ga0450910_000864
1006 Ga0439446_0008483
1007 Ga0450893_0000749
1008 Ga0450893_0000788
1009 Ga0466964_0022722
1010 Ga0466968_0008060
1011 Ga0466960_0057903
1012 Ga0466959_0001259
1013 Ga0451576_0055654
1014 Ga0451576_0275013
1015 Ga0495617_000051
1016 Ga0495617_001023
1017 Ga0495627_011925
1018 Ga0495629_0007477
1019 Ga0495638_0000034
1020 Ga0495638_0004453
1021 Ga0495662_0022836
1022 Ga0495596_0005603
1023 Ga0495583_0011777
1024 Ga0495583_0018885
1025 Ga0495583_0030765
1026 Ga0495620_0000528
1027 Ga0495631_0000181
1028 Ga0495632_0003657
1029 Ga0495632_0012148
1030 Ga0495637_0014351
1031 Ga0495648_0000559
1032 Ga0495609_0011433
1033 Ga0495597_0001694
1034 Ga0495597_0018785
1035 Ga0495668_0091303
1036 Ga0495611_0000001
1037 Ga0495625_0000001
1038 Ga0495625_0002228
1039 Ga0495625_0014279
1040 Ga0495661_0001957
1041 Ga0495588_0031066
1042 Ga0495624_0090673
1043 Ga0495670_0011602
1044 Ga0495671_0000480
1045 Ga0495589_0000016
1046 Ga0495589_0000033
1047 Ga0495600_0023363
1048 Ga0495660_0000116
1049 Ga0495660_0039333
1050 Ga0495604_0016513
1051 Ga0495673_0006015
1052 Ga0496101_0137187
1053 Ga0496109_0217840
1054 Ga0496116_0022642
1055 Ga0496116_0032689
1056 Ga0496116_0092669
1057 Ga0496117_0020176
1058 Ga0496119_0000140
1059 Ga0496120_0000011
1060 Ga0496122_0000253
1061 Ga0496123_0000206
1062 Ga0496123_0034010
1063 Ga0496124_0000148
1064 Ga0496124_0019236
1065 Ga0496125_0003277
1066 Ga0496125_0004592
1067 Ga0496125_0015965
1068 Ga0496125_0018669
1069 Ga0496125_0185946
1070 Ga0496126_0055411
1071 Ga0495678_000475
1072 Ga0495682_0000576
1073 Ga0501034_0000192
1074 Ga0501225_0000443
1075 Ga0501225_0003433
1076 Ga0501262_000053
1077 Ga0501262_000168
1078 nmdc:mga03683_2333_c1
1079 nmdc:mga03683_7387_c1
1080 nmdc:mga03n38_148455_c1
1081 nmdc:mga0k408_16219_c1
1082 nmdc:mga0k408_38416_c1
1083 nmdc:mga07m45_1263_c1
1084 nmdc:mga07m45_7762_c1
1085 nmdc:mga0n895_102241_c1
1086 nmdc:mga0sz30_35295_c1
1087 Ga0500578_0000007
1088 Ga0500643_000002
1089 Ga0500643_009293
1090 Ga0500644_0020853
1091 Ga0500651_0063488
1092 Ga0500555_000288
1093 Ga0500652_000180
1094 Ga0500658_0000038
1095 Ga0500658_0001016
1096 Ga0500568_0000906
1097 Ga0500616_0018226
1098 Ga0500622_0000317
1099 Ga0500645_001386
1100 Ga0500645_002224
1101 Ga0466962_0005855
1102 2513226984
1103 2562464120
1104 2587726471
1105 2587734624
1106 2588291073
1107 2599446292
1108 2599621096
1109 2599675114
1110 2599678288
1111 2599690607
1112 2643818972
1113 2643941357
1114 2643971987
1115 2644080398
1116 2644142186
1117 2644275880
1118 2644324138
1119 2644397264
1120 2644467714
1121 2644697011
1122 2644745486
1123 2735837088
1124 2738718423
1125 2738882871
1126 2739056342
1127 2739226546
1128 2739281610
1129 2792313835
1130 2819564310
1131 2819602405
1132 2819664001
1133 2819713776
1134 2831270059
1135 2834643196
1136 2838054932
1137 2841915351
1138 2841922248
1139 2842679377
1140 2842680357
1141 2852685746
1142 2884413428
1143 2885195174
1144 2885202099
1145 2885215191
1146 2899927013
1147 2900579115
1148 2904453496
1149 2904463072
1150 2904464953
1151 2904542333
1152 2904581731
1153 2919123398
1154 2919466490
1155 2920826495
1156 2928042488
1157 2928048513
1158 2928054838
1159 2928059438
1160 2928068276
1161 2928073829
1162 2928089885
1163 2929167605
1164 2929525085
1165 2945912925
1166 2945950543
1167 2945972210
1168 2945984793
1169 2954768279
1170 3003671615

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

133

316

0.84

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

135

398

0.56

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bov-assembly2.cif.gz_B crystal structure of a putative epoxide hydrolase (kpn_01808) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.60 a resolution 0.997 54 346
5bov-assembly2.cif.gz_B crystal structure of a putative epoxide hydrolase (kpn_01808) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.60 a resolution 0.9642 54 346
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.8973 54 172
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8843 54 172
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8841 54 172
ID Description Score Start End Superfamily
5bovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9964 54 346 3.40.50.1820
5bovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9665 54 346 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9084 54 142 3.40.50.12270
af_A0A0P0WIT7_2_163_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8572 64 176 3.40.50.1820
af_I1KMX1_1_216_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8479 48 193 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0L8NT71-F1-model_v4 deleted 1.004 54 163
AF-A0A528AUY4-F1-model_v4 Alpha/beta hydrolase 0.9995 227 346 GO:0016787
AF-A0A270QK74-F1-model_v4 deleted 0.9986 152 346
AF-A0A431P1Y8-F1-model_v4 deleted 0.9985 199 346
AF-A0A1H3G878-F1-model_v4 Alpha/beta hydrolase fold 0.9981 54 150 GO:0016787

Map