F466474

General Info

Members Datasets Scaffolds Average Seq Length
585 373 1169 97

Family's Representative Sequence

Representative Sequence 3300041491|Ga0451833_1293279|Ga0451833_1293279_140_466
Length 108
Sequence VRTEEGREIMAESLSGPRRNRIHRALSRPNLLMGADRELVLITGLAAVILIFVVLTVYSALFGVAVWIVIVGLLRMMAKSDPLMRQVYIRHISYKSTYKATTSPWRRY

Samples

Sample ID Description Type Environment
1 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
42 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
43 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
44 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
45 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
46 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
65 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
79 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
80 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
89 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
90 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
91 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
92 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
93 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
94 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
95 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
96 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
97 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
98 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
99 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
100 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
101 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
102 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
103 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
104 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
107 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
108 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
109 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
115 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
119 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
120 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
121 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
127 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
128 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
143 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
167 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
182 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
183 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
184 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
185 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
186 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
187 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
188 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
189 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
190 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
191 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
192 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
193 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
196 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
197 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
198 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
199 2509276019 Ensifer aridi TW10 Isolate Nodule
200 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
201 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
202 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
203 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
204 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
205 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
206 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
207 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
208 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
209 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
210 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
211 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
212 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
213 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
214 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
215 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
216 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
217 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
218 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
219 2516143018 Ensifer sp. BR816 Isolate Nodule
220 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
221 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
222 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
223 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
224 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
225 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
226 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
227 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
228 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
229 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
230 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
231 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
232 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
233 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
234 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
235 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
236 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
237 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
238 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
239 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
240 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
241 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
242 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
243 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
244 2643221557 Ensifer sp. Root558 Isolate Unclassified
245 2643221558 Rhizobium sp. Root149 Isolate Unclassified
246 2643221568 Rhizobium sp. Root564 Isolate Unclassified
247 2643221582 Rhizobium sp. Root651 Isolate Unclassified
248 2643221610 Ensifer sp. Root74 Isolate Unclassified
249 2643221626 Ensifer sp. Root31 Isolate Unclassified
250 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
251 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
252 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
253 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
254 2643221668 Ensifer sp. Root423 Isolate Unclassified
255 2643221675 Ensifer sp. Root1298 Isolate Unclassified
256 2643221680 Ensifer sp. Root1312 Isolate Unclassified
257 2643221718 Rhizobium sp. Root268 Isolate Unclassified
258 2643221719 Rhizobium sp. Root274 Isolate Unclassified
259 2643221723 Ensifer sp. Root278 Isolate Unclassified
260 2643221726 Ensifer sp. Root954 Isolate Unclassified
261 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
262 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
263 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
264 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
265 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
266 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
267 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
268 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
269 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
270 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
271 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
272 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
273 2791355256 Rhizobium sp. M10 Isolate Nodule
274 2791355263 Rhizobium chutanense C5 Isolate Nodule
275 2791355266 Rhizobium sp. L43 Isolate Nodule
276 2791355267 Rhizobium sp. L18 Isolate Nodule
277 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
278 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
279 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
280 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
281 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
282 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
283 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
284 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
285 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
286 2802429633 Rhizobium anhuiense J3 Isolate Nodule
287 2802429634 Rhizobium anhuiense S10 Isolate Nodule
288 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
289 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
290 2802429637 Rhizobium anhuiense C15 Isolate Nodule
291 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
292 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
293 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
294 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
295 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
296 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
297 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
298 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
299 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
300 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
301 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
302 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
303 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
304 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
305 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
306 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
307 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
308 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
309 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
310 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
311 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
312 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
313 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
314 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
315 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
316 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
317 2844163670 Ensifer sp. 1H6 Isolate Unclassified
318 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
319 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
320 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
321 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
322 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
323 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
324 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
325 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
326 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
327 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
328 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
329 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
330 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
331 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
332 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
333 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
334 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
335 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
336 2936381700 Rhizobium chutanense C16 Isolate Unclassified
337 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
338 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
339 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
340 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
341 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
342 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
343 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
344 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
345 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
346 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
347 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
348 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
349 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
350 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
351 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
352 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
353 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
354 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
355 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
356 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
357 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
358 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
359 8005395548 Rhizobium sp. R339 Isolate Nodule
360 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
361 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
362 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
363 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
364 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
365 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
366 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
367 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
368 8018176218 Rhizobium sp. N122 Isolate Nodule
369 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
370 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
371 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
372 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
373 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.93
Metatranscriptomes 0
Isolates 36.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.22
Nodule 28.38
Rhizoplane 2.05
Rhizosphere 25.64
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451833_1293279 3300041491 Bacteria 531
2 JGI25152J39213_1001183 3300002773 Bacteria 12050
3 JGI25152J39213_1019991 3300002773 Bacteria 1207
4 JGI25152J39213_1041718 3300002773 Bacteria 640
5 JGI25151J46595_10001708 3300003187 Bacteria 14340
6 JGI25151J46595_10004310 3300003187 Bacteria 7557
7 JGI25153J46596_10001647 3300003215 Bacteria 13244
8 JGI25153J46596_10003224 3300003215 Bacteria 9170
9 JGI25153J46596_10047369 3300003215 Bacteria 1265
10 JGI25153J46596_10049846 3300003215 Bacteria 1212
11 JGI25153J46596_10097691 3300003215 Bacteria 696
12 rootH1_10002814 3300003316 Bacteria 40375
13 rootH1_10002814 3300003323 Bacteria 12796
14 rootH2_10029723 3300003320 Bacteria 13503
15 rootH2_10139809 3300003320 Bacteria 3650
16 rootL2_10010387 3300003322 Bacteria 55016
17 rootH1_10025473 3300003323 Bacteria 4607
18 rootH1_10076352 3300003323 Bacteria 8662
19 rootH1_10207768 3300003323 Bacteria 1853
20 JGI25161J50226_1004304 3300003374 Bacteria 3008
21 Ga0055526_1001150 3300003771 Bacteria 19182
22 Ga0055526_1001750 3300003771 Bacteria 15071
23 Ga0055526_1005680 3300003771 Bacteria 7081
24 Ga0055526_1037371 3300003771 Bacteria 1271
25 Ga0055524_1000369 3300003775 Bacteria 39814
26 Ga0055524_1000407 3300003775 Bacteria 36421
27 Ga0055524_1003922 3300003775 Bacteria 7048
28 Ga0055524_1026558 3300003775 Bacteria 1785
29 Ga0055524_1036550 3300003775 Bacteria 1318
30 Ga0055536_1003999 3300003781 Bacteria 7700
31 Ga0055536_1063675 3300003781 Bacteria 754
32 Ga0055528_1000039 3300003790 Bacteria 112899
33 Ga0055528_1010450 3300003790 Bacteria 3772
34 Ga0055528_1055426 3300003790 Bacteria 775
35 Ga0055528_1058154 3300003790 Bacteria 743
36 Ga0055530_10008130 3300003791 Bacteria 4262
37 Ga0055530_10052845 3300003791 Bacteria 935
38 Ga0055540_1000094 3300003792 Bacteria 97733
39 Ga0055540_1000381 3300003792 Bacteria 37015
40 Ga0055540_1050520 3300003792 Bacteria 859
41 Ga0055531_10000389 3300003794 Bacteria 42420
42 Ga0055531_10006353 3300003794 Bacteria 6725
43 Ga0058692_1000019 3300003856 Bacteria 255580
44 Ga0058692_1000083 3300003856 Bacteria 66222
45 Ga0065165_1001497 3300005262 Bacteria 24706
46 Ga0065165_1001509 3300005262 Bacteria 24602
47 Ga0065165_1011007 3300005262 Bacteria 3833
48 Ga0070671_100025248 3300005355 Bacteria 4874
49 Ga0070663_100107445 3300005455 Bacteria 2092
50 Ga0070685_10844099 3300005466 Bacteria 678
51 Ga0068854_101579082 3300005578 Bacteria 597
52 Ga0068862_100994155 3300005844 Bacteria 829
53 Ga0075365_10320722 3300006038 Bacteria 1091
54 Ga0075364_10003243 3300006051 Bacteria 9214
55 Ga0075362_10519386 3300006177 Bacteria 610
56 Ga0075362_10601504 3300006177 Bacteria 568
57 Ga0075367_10321964 3300006178 Bacteria 974
58 Ga0075369_10313522 3300006186 Bacteria 733
59 Ga0075366_10318815 3300006195 Bacteria 952
60 Ga0075366_10385299 3300006195 Bacteria 862
61 Ga0075370_10080554 3300006353 Bacteria 1871
62 Ga0079104_1019593 3300006946 Bacteria 1886
63 Ga0099826_10032287 3300006948 Bacteria 3776
64 Ga0105251_10029813 3300009011 Bacteria 2745
65 Ga0105244_10288922 3300009036 Bacteria 760
66 Ga0105250_10026117 3300009092 Bacteria 2352
67 Ga0105247_10057299 3300009101 Bacteria 2409
68 Ga0105248_10045733 3300009177 Bacteria 4907
69 Ga0105249_10331140 3300009553 Bacteria 1537
70 Ga0157372_11106112 3300013307 Bacteria 917
71 Ga0163161_10551344 3300017792 Bacteria 945
72 Ga0163161_11227831 3300017792 Bacteria 649
73 Ga0214544_1000097 3300021320 Bacteria 116548
74 Ga0214544_1000584 3300021320 Bacteria 68638
75 Ga0214544_1015545 3300021320 Bacteria 7875
76 Ga0214542_1000418 3300021321 Bacteria 75807
77 Ga0214542_1017888 3300021321 Bacteria 6219
78 Ga0214542_1031313 3300021321 Bacteria 1987
79 Ga0214543_1000929 3300021327 Bacteria 53976
80 Ga0214543_1003317 3300021327 Bacteria 31302
81 Ga0214543_1004049 3300021327 Bacteria 28048
82 Ga0214543_1038252 3300021327 Bacteria 1385
83 Ga0228711_1026720 3300022739 Bacteria 3646
84 Ga0228710_1011825 3300022740 Bacteria 11087
85 Ga0207425_1000083 3300025245 Bacteria 96984
86 Ga0209129_1000098 3300025258 Bacteria 163406
87 Ga0209129_1000719 3300025258 Bacteria 21372
88 Ga0209129_1000821 3300025258 Bacteria 19527
89 Ga0209129_1014080 3300025258 Bacteria 1721
90 Ga0209673_1000126 3300025273 Bacteria 167949
91 Ga0209673_1000161 3300025273 Bacteria 142073
92 Ga0209673_1001573 3300025273 Bacteria 20332
93 Ga0209673_1016374 3300025273 Bacteria 2776
94 Ga0209130_1041637 3300025284 Bacteria 883
95 Ga0209130_1047867 3300025284 Bacteria 791
96 Ga0209676_1003351 3300025292 Bacteria 9985
97 Ga0209676_1006418 3300025292 Bacteria 5812
98 Ga0209025_1000142 3300025294 Bacteria 183903
99 Ga0209025_1000532 3300025294 Bacteria 72555
100 Ga0209025_1001930 3300025294 Bacteria 24020
101 Ga0209025_1005458 3300025294 Bacteria 10361
102 Ga0209025_1150797 3300025294 Bacteria 642
103 Ga0209025_1168096 3300025294 Bacteria 580
104 Ga0209025_1181875 3300025294 Bacteria 539
105 Ga0209564_1000368 3300025295 Bacteria 83910
106 Ga0209564_1000450 3300025295 Bacteria 69909
107 Ga0209564_1001053 3300025295 Bacteria 33613
108 Ga0209564_1006478 3300025295 Bacteria 6300
109 Ga0209564_1011104 3300025295 Bacteria 4070
110 Ga0209564_1041591 3300025295 Bacteria 1231
111 Ga0209758_1000300 3300025297 Bacteria 97000
112 Ga0209758_1000396 3300025297 Bacteria 75453
113 Ga0209758_1001917 3300025297 Bacteria 22638
114 Ga0209758_1004261 3300025297 Bacteria 12094
115 Ga0209758_1008506 3300025297 Bacteria 6622
116 Ga0209758_1008866 3300025297 Bacteria 6394
117 Ga0209758_1036651 3300025297 Bacteria 1909
118 Ga0209758_1159156 3300025297 Bacteria 563
119 Ga0209050_1003671 3300025298 Bacteria 11078
120 Ga0209050_1008740 3300025298 Bacteria 5333
121 Ga0209256_1000228 3300025299 Bacteria 102990
122 Ga0209256_1000613 3300025299 Bacteria 49419
123 Ga0209256_1000999 3300025299 Bacteria 33608
124 Ga0209256_1001076 3300025299 Bacteria 31547
125 Ga0209256_1002109 3300025299 Bacteria 17299
126 Ga0209256_1003352 3300025299 Bacteria 11356
127 Ga0209256_1022384 3300025299 Bacteria 1914
128 Ga0207426_1001108 3300025302 Bacteria 24750
129 Ga0207426_1002581 3300025302 Bacteria 11267
130 Ga0207426_1029567 3300025302 Bacteria 1805
131 Ga0209051_1000032 3300025303 Bacteria 383445
132 Ga0209051_1000132 3300025303 Bacteria 139145
133 Ga0209051_1004297 3300025303 Bacteria 8858
134 Ga0209051_1011693 3300025303 Bacteria 4311
135 Ga0209051_1034883 3300025303 Bacteria 1879
136 Ga0209257_1000209 3300025304 Bacteria 141383
137 Ga0209257_1001963 3300025304 Bacteria 22169
138 Ga0209257_1016877 3300025304 Bacteria 2918
139 Ga0209257_1099421 3300025304 Bacteria 712
140 Ga0207647_10255943 3300025904 Bacteria 1003
141 Ga0207709_10899768 3300025935 Bacteria 719
142 Ga0207711_10111913 3300025941 Bacteria 2429
143 Ga0207678_10295517 3300026067 Bacteria 1391
144 Ga0207676_10422400 3300026095 Bacteria 1251
145 Ga0209281_1000348 3300027111 Bacteria 76877
146 Ga0209371_1000107 3300027312 Bacteria 141889
147 Ga0209371_1000251 3300027312 Bacteria 66325
148 Ga0209371_1051965 3300027312 Unclassified 783
149 Ga0209282_1000070 3300027666 Bacteria 85274
150 Ga0268266_11602663 3300028379 Bacteria 626
151 Ga0268265_10873481 3300028380 Bacteria 881
152 Ga0307515_10058270 3300028794 Bacteria 5566
153 Ga0307515_10291777 3300028794 Bacteria 1326
154 Ga0268256_1000093 3300030500 Bacteria 141889
155 Ga0268256_1001634 3300030500 Bacteria 12958
156 Ga0268256_1058368 3300030500 Unclassified 783
157 Ga0307513_10014116 3300031456 Bacteria 9776
158 Ga0307513_10075160 3300031456 Bacteria 3510
159 Ga0307408_100369520 3300031548 Bacteria 1223
160 Ga0307408_100546227 3300031548 Bacteria 1022
161 Ga0307514_10182934 3300031649 Bacteria 1348
162 Ga0307406_10480992 3300031901 Bacteria 1003
163 Ga0307412_11627558 3300031911 Bacteria 590
164 Ga0315914_1000082 3300031967 Bacteria 78317
165 Ga0307510_10004792 3300033180 Bacteria 16009
166 Ga0315913_1000028 3300033430 Bacteria 78319
167 Ga0315915_1000004 3300033464 Bacteria 403083
168 Ga0373926_0063757 3300035083 Bacteria 1346
169 Ga0373927_0001245 3300035695 Bacteria 19322
170 Ga0373925_0000579 3300037068 Bacteria 35494
171 Ga0395899_0684984 3300037312 Bacteria 644
172 Ga0395900_0464342 3300037418 Bacteria 1220
173 Ga0395898_0000840 3300037466 Bacteria 50812
174 Ga0395905_0004538 3300037471 Bacteria 14378
175 Ga0395901_0000132 3300038443 Bacteria 96418
176 Ga0439436_0004799 3300041404 Bacteria 4149
177 Ga0439438_048465 3300041405 Bacteria 1087
178 Ga0439447_106120 3300041407 Bacteria 645
179 Ga0439466_0156386 3300041411 Bacteria 698
180 Ga0439465_0000118 3300041413 Bacteria 18781
181 Ga0439465_0001766 3300041413 Bacteria 7072
182 Ga0439465_0046970 3300041413 Bacteria 1406
183 Ga0439465_0162128 3300041413 Bacteria 802
184 Ga0451793_0879669 3300041452 Bacteria 721
185 Ga0451798_0684008 3300041458 Bacteria 1337
186 Ga0451833_0186191 3300041491 Bacteria 3268
187 Ga0451833_0377058 3300041491 Bacteria 2886
188 Ga0451833_0858088 3300041491 Bacteria 7564
189 Ga0451835_0100703 3300041492 Bacteria 552
190 Ga0451835_0104935 3300041492 Bacteria 3167
191 Ga0451835_1242391 3300041492 Bacteria 4960
192 Ga0451837_0165450 3300041494 Bacteria 1860
193 Ga0451837_0249402 3300041494 Bacteria 672
194 Ga0451837_0629808 3300041494 Bacteria 753
195 Ga0451837_1458164 3300041494 Bacteria 1118
196 Ga0451839_0352628 3300041496 Bacteria 15201
197 Ga0451839_1460354 3300041496 Bacteria 1587
198 Ga0451839_1571223 3300041496 Bacteria 901
199 Ga0451841_0110022 3300041498 Bacteria 6995
200 Ga0451841_0176674 3300041498 Bacteria 2107
201 Ga0451845_0361663 3300041501 Bacteria 8485
202 Ga0451845_0715021 3300041501 Bacteria 1866
203 Ga0451847_0075758 3300041503 Bacteria 2448
204 Ga0451847_0206364 3300041503 Bacteria 12047
205 Ga0451849_0181325 3300041505 Bacteria 11677
206 Ga0451849_0692168 3300041505 Bacteria 2184
207 Ga0451849_1136831 3300041505 Bacteria 506
208 Ga0451849_1311520 3300041505 Bacteria 3515
209 Ga0451849_1313199 3300041505 Bacteria 703
210 Ga0451849_1476207 3300041505 Bacteria 4672
211 Ga0451851_0003572 3300041507 Bacteria 27523
212 Ga0451851_0545725 3300041507 Bacteria 1221
213 Ga0451843_0163406 3300041509 Bacteria 2597
214 Ga0451843_0286922 3300041509 Bacteria 9565
215 Ga0451843_1204107 3300041509 Bacteria 1286
216 Ga0451855_0138740 3300041511 Bacteria 3142
217 Ga0451855_0302858 3300041511 Bacteria 1661
218 Ga0451855_1291389 3300041511 Bacteria 2980
219 Ga0451853_0334798 3300041512 Bacteria 5514
220 Ga0451853_1298236 3300041512 Bacteria 963
221 Ga0451853_2245295 3300041512 Bacteria 819
222 Ga0439449_0054969 3300042007 Bacteria 1470
223 Ga0439449_0059762 3300042007 Bacteria 1407
224 Ga0439449_0254279 3300042007 Bacteria 661
225 Ga0439452_088965 3300042010 Bacteria 668
226 Ga0439462_0071524 3300042015 Bacteria 942
227 Ga0439462_0145536 3300042015 Bacteria 665
228 Ga0495627_010666 3300046453 Bacteria 3331
229 Ga0495638_0007091 3300046460 Bacteria 8083
230 Ga0495650_0159915 3300046471 Bacteria 804
231 Ga0495605_0054976 3300046474 Bacteria 1925
232 Ga0495585_0002471 3300046492 Bacteria 13197
233 Ga0495585_0037727 3300046492 Bacteria 2721
234 Ga0495596_0020036 3300046500 Bacteria 2741
235 Ga0495607_0059013 3300046501 Bacteria 2190
236 Ga0495607_0203550 3300046501 Bacteria 978
237 Ga0495607_0350850 3300046501 Bacteria 681
238 Ga0495583_0012955 3300046506 Bacteria 4684
239 Ga0495583_0141675 3300046506 Bacteria 1000
240 Ga0495606_0017129 3300046507 Bacteria 5493
241 Ga0495610_0022958 3300046512 Bacteria 3399
242 Ga0495610_0140817 3300046512 Bacteria 1038
243 Ga0495610_0155411 3300046512 Bacteria 972
244 Ga0495616_0070499 3300046513 Bacteria 1692
245 Ga0495620_0000107 3300046515 Bacteria 66810
246 Ga0495620_0001213 3300046515 Bacteria 15761
247 Ga0495620_0344642 3300046515 Bacteria 565
248 Ga0495631_0001797 3300046518 Bacteria 12717
249 Ga0495631_0196051 3300046518 Bacteria 864
250 Ga0495632_0011639 3300046519 Bacteria 5125
251 Ga0495637_0006745 3300046520 Bacteria 5746
252 Ga0495637_0117152 3300046520 Bacteria 1028
253 Ga0495643_0003041 3300046522 Bacteria 12611
254 Ga0495648_0030894 3300046524 Bacteria 3535
255 Ga0495663_0159475 3300046525 Bacteria 773
256 Ga0495654_0004327 3300046530 Bacteria 8462
257 Ga0495609_0007882 3300046538 Bacteria 5265
258 Ga0495622_0329725 3300046557 Bacteria 662
259 Ga0495633_0012813 3300046558 Bacteria 4442
260 Ga0495633_0031063 3300046558 Bacteria 2592
261 Ga0495633_0504524 3300046558 Bacteria 545
262 Ga0495656_0020493 3300046615 Bacteria 2565
263 Ga0495668_0042877 3300046616 Bacteria 2518
264 Ga0495611_0144159 3300046648 Bacteria 1112
265 Ga0495625_0004571 3300046660 Bacteria 13017
266 Ga0495625_0011236 3300046660 Bacteria 7322
267 Ga0495625_0018841 3300046660 Bacteria 5374
268 Ga0495625_0057994 3300046660 Bacteria 2752
269 Ga0495625_0143335 3300046660 Bacteria 1610
270 Ga0495661_0400498 3300046665 Bacteria 667
271 Ga0495588_0016014 3300046674 Bacteria 3618
272 Ga0495588_0036095 3300046674 Bacteria 2506
273 Ga0495588_0086832 3300046674 Bacteria 1636
274 Ga0495588_0364812 3300046674 Bacteria 759
275 Ga0495670_0050275 3300046691 Bacteria 2087
276 Ga0495671_0002228 3300046692 Bacteria 12330
277 Ga0495671_0166133 3300046692 Bacteria 1073
278 Ga0495671_0243608 3300046692 Bacteria 868
279 Ga0495649_0040391 3300046694 Bacteria 2555
280 Ga0495649_0059852 3300046694 Bacteria 2050
281 Ga0495600_0957550 3300046809 Bacteria 503
282 Ga0495660_0111281 3300046810 Bacteria 1397
283 Ga0495687_027851 3300047443 Bacteria 2638
284 Ga0495687_032729 3300047443 Bacteria 2369
285 Ga0495679_109075 3300047446 Bacteria 763
286 Ga0495681_0008822 3300047470 Bacteria 6274
287 Ga0495681_0055527 3300047470 Bacteria 1846
288 Ga0495681_0080431 3300047470 Bacteria 1456
289 Ga0495686_0054389 3300047472 Bacteria 2506
290 Ga0495686_0344089 3300047472 Bacteria 812
291 Ga0495615_0087130 3300048090 Bacteria 865
292 Ga0495615_0292930 3300048090 Bacteria 525
293 Ga0496100_0152488 3300048903 Bacteria 1650
294 Ga0496102_0098274 3300048905 Bacteria 2716
295 Ga0496103_0297945 3300048906 Bacteria 1037
296 Ga0496104_0016015 3300048907 Bacteria 6807
297 Ga0496105_0000087 3300048908 Bacteria 65230
298 Ga0496106_0235010 3300048909 Bacteria 1464
299 Ga0496107_0292682 3300048910 Bacteria 1212
300 Ga0496109_0026714 3300048912 Bacteria 5150
301 Ga0496116_0000601 3300048919 Bacteria 47643
302 Ga0496116_0001726 3300048919 Bacteria 23861
303 Ga0496116_0038702 3300048919 Bacteria 3307
304 Ga0496117_0002417 3300048920 Bacteria 23697
305 Ga0496117_0093904 3300048920 Bacteria 1922
306 Ga0496118_0079213 3300048921 Bacteria 2320
307 Ga0496118_0177968 3300048921 Bacteria 1289
308 Ga0496119_0000569 3300048922 Bacteria 49819
309 Ga0496119_0011170 3300048922 Bacteria 7478
310 Ga0496119_0020439 3300048922 Bacteria 4832
311 Ga0496119_0498274 3300048922 Bacteria 567
312 Ga0496120_0012525 3300048923 Bacteria 5769
313 Ga0496120_0020913 3300048923 Bacteria 4146
314 Ga0496121_0011301 3300048924 Bacteria 9940
315 Ga0496121_0191439 3300048924 Bacteria 1466
316 Ga0496121_0487923 3300048924 Bacteria 785
317 Ga0496121_0725498 3300048924 Bacteria 594
318 Ga0496121_0725780 3300048924 Bacteria 594
319 Ga0496122_0005173 3300048925 Bacteria 15693
320 Ga0496122_0010254 3300048925 Bacteria 9701
321 Ga0496122_0010574 3300048925 Bacteria 9480
322 Ga0496122_0061402 3300048925 Bacteria 2759
323 Ga0496123_0002390 3300048926 Bacteria 23485
324 Ga0496123_0114871 3300048926 Bacteria 1529
325 Ga0496124_0010911 3300048927 Bacteria 9141
326 Ga0496124_0018666 3300048927 Bacteria 6487
327 Ga0496124_0020377 3300048927 Bacteria 6129
328 Ga0496124_0027146 3300048927 Bacteria 5145
329 Ga0496125_0000182 3300048928 Bacteria 137747
330 Ga0496126_0001273 3300048929 Bacteria 40531
331 Ga0496126_0055713 3300048929 Bacteria 3575
332 Ga0496126_0158904 3300048929 Bacteria 1932
333 Ga0495678_096969 3300049459 Bacteria 1028
334 Ga0495682_0163967 3300049460 Bacteria 791
335 Ga0501032_0388342 3300049569 Bacteria 897
336 Ga0501033_0000054 3300049570 Bacteria 108163
337 Ga0501033_0077354 3300049570 Bacteria 2442
338 Ga0501034_0054016 3300049571 Bacteria 4045
339 Ga0501034_0170044 3300049571 Bacteria 2147
340 Ga0501036_1235131 3300049572 Bacteria 608
341 Ga0501280_000892 3300049776 Bacteria 6379
342 Ga0501035_0001626 3300049822 Bacteria 22754
343 Ga0501035_0668635 3300049822 Bacteria 840
344 Ga0501044_0438234 3300049823 Bacteria 1215
345 nmdc:mga03683_69828_c1 3300050489 Bacteria 1499
346 nmdc:mga00v17_85_c1 3300050491 Bacteria 57269
347 nmdc:mga0yw44_446206_c1 3300050492 Bacteria 877
348 nmdc:mga0k408_78177_c1 3300050493 Bacteria 1935
349 nmdc:mga06z11_278895_c1 3300050494 Bacteria 990
350 nmdc:mga07m45_23918_c2 3300050496 Bacteria 1811
351 nmdc:mga0sz30_155921_c1 3300050516 Bacteria 1011
352 nmdc:mga0sz30_196157_c1 3300050516 Bacteria 896
353 Ga0500610_0131126 3300053079 Bacteria 1274
354 Ga0500643_058119 3300053087 Bacteria 1091
355 Ga0500556_0314621 3300053104 Bacteria 610
356 Ga0500557_001176 3300053105 Bacteria 4076
357 Ga0500593_159323 3300053117 Bacteria 865
358 Ga0500594_0001801 3300053118 Bacteria 4645
359 Ga0500594_0022369 3300053118 Bacteria 1594
360 Ga0500618_000097 3300053125 Bacteria 71932
361 Ga0500618_008258 3300053125 Bacteria 2919
362 Ga0500658_0287227 3300053134 Bacteria 756
363 Ga0500559_0408854 3300053136 Bacteria 631
364 Ga0500561_0060087 3300053137 Bacteria 1062
365 Ga0500573_0003603 3300053140 Bacteria 8036
366 Ga0500606_044720 3300053152 Bacteria 1470
367 Ga0500616_0000438 3300053153 Bacteria 55072
368 Ga0500622_0000278 3300053156 Bacteria 52272
369 Ga0500636_0000231 3300053177 Bacteria 30492
370 Ga0500636_0017031 3300053177 Bacteria 4286
371 Ga0500636_0088661 3300053177 Bacteria 1774
372 Ga0500636_0132696 3300053177 Bacteria 1385
373 Ga0500636_0136935 3300053177 Bacteria 1359
374 Ga0500611_253049 3300053727 Bacteria 508
375 2509111906 2508501122 Bacteria 6292184
376 2509378648 2509276019 Bacteria 6802256
377 2511173545 2510917026 Bacteria 7046020
378 2512531268 2512047086 Bacteria 6850303
379 2512975102 2512875026 Bacteria 6861065
380 2513573046 2513237084 Bacteria 7231967
381 2513580875 2513237085 Bacteria 7695351
382 2513598456 2513237088 Bacteria 6927906
383 2513600616 2513237088 Bacteria 6927906
384 2513605138 2513237089 Bacteria 6553624
385 2513869942 2513237138 Bacteria 7368160
386 2513881840 2513237140 Bacteria 7076289
387 2513885917 2513237140 Bacteria 7076289
388 2513914244 2513237144 Bacteria 7530820
389 2513930110 2513237146 Bacteria 7166346
390 2513989293 2513237156 Bacteria 6402557
391 2513998923 2513237159 Bacteria 6810126
392 2514007831 2513237160 Bacteria 6650282
393 2514024727 2513237162 Bacteria 7468464
394 2515108389 2515075009 Bacteria 7288508
395 2515109929 2515075009 Bacteria 7288508
396 2515611282 2515154107 Bacteria 6795637
397 2515611855 2515154107 Bacteria 6795637
398 2515635675 2515154113 Bacteria 7807172
399 2515661298 2515154116 Bacteria 7552979
400 2516210367 2516143018 Bacteria 6951533
401 2517042912 2516653077 Bacteria 7555578
402 2517099937 2517093000 Bacteria 7412387
403 2517567746 2517487022 Bacteria 7227575
404 2524451572 2524023207 Bacteria 6813453
405 2524460891 2524023209 Bacteria 6679728
406 2524462820 2524023209 Bacteria 6679728
407 2524462873 2524023209 Bacteria 6679728
408 2535521024 2534681796 Bacteria 7146037
409 2558864273 2558860100 Bacteria 8458965
410 2558867018 2558860100 Bacteria 8458965
411 2558867705 2558860100 Bacteria 8458965
412 2585205204 2582581294 Bacteria 6626667
413 2585258066 2582581304 Bacteria 5831370
414 2585268306 2582581306 Bacteria 6450535
415 2585281746 2582581308 Bacteria 7413247
416 2585334820 2582581316 Bacteria 7774528
417 2585534394 2585427527 Bacteria 7273426
418 2585841008 2585427593 Bacteria 7141551
419 2585846022 2585427594 Bacteria 6180594
420 2585897382 2585427608 Bacteria 6544331
421 2585908927 2585427609 Bacteria 6667127
422 2585994095 2585427633 Bacteria 6413184
423 2587984250 2585428125 Bacteria 6662905
424 2599413970 2599185170 Bacteria 7295545
425 2599606329 2599185210 Bacteria 5624189
426 2599723326 2599185236 Bacteria 6875203
427 2616310040 2615840626 Bacteria 7921970
428 2616311764 2615840626 Bacteria 7921970
429 2616551460 2615840698 Bacteria 7319877
430 2643806757 2643221557 Bacteria 7184309
431 2643810874 2643221558 Bacteria 5460675
432 2643815077 2643221558 Bacteria 5460675
433 2643858400 2643221568 Bacteria 5187270
434 2643918125 2643221582 Bacteria 5804683
435 2644066810 2643221610 Bacteria 7480339
436 2644147390 2643221626 Bacteria 8069654
437 2644192466 2643221634 Bacteria 6705461
438 2644200551 2643221636 Bacteria 6583769
439 2644208164 2643221637 Bacteria 5345260
440 2644300762 2643221653 Bacteria 4569637
441 2644381255 2643221668 Bacteria 7306521
442 2644417756 2643221675 Bacteria 7473456
443 2644451032 2643221680 Bacteria 7473610
444 2644651922 2643221718 Bacteria 5345506
445 2644658984 2643221719 Bacteria 4568197
446 2644674462 2643221723 Bacteria 7095460
447 2644691749 2643221726 Bacteria 7455827
448 2657686528 2657244999 Bacteria 5946535
449 2692320945 2690316117 Bacteria 6800650
450 2720617069 2718218233 Bacteria 6662049
451 2725949141 2724679232 Bacteria 7646494
452 2739037591 2738541333 Bacteria 7106503
453 2753462847 2751185821 Bacteria 6189929
454 2766064446 2765235942 Bacteria 7445910
455 2778176770 2775507266 Bacteria 7392367
456 2778179989 2775507266 Bacteria 7392367
457 2778180295 2775507266 Bacteria 7392367
458 2792623754 2791355091 Bacteria 6135441
459 2792624678 2791355091 Bacteria 6135441
460 2792630013 2791355092 Bacteria 6248105
461 2792630798 2791355092 Bacteria 6248105
462 2792641091 2791355094 Bacteria 7011481
463 2792642043 2791355094 Bacteria 7011481
464 2793283264 2791355253 Bacteria 5171699
465 2793298073 2791355256 Bacteria 6798008
466 2793343378 2791355263 Bacteria 6872478
467 2793343569 2791355263 Bacteria 6872478
468 2793363140 2791355266 Bacteria 7116587
469 2793363448 2791355266 Bacteria 7116587
470 2793364263 2791355266 Bacteria 7116587
471 2793370592 2791355267 Bacteria 7222458
472 2802721039 2802428858 Bacteria 6636079
473 2802728128 2802428859 Bacteria 6667919
474 2802733593 2802428860 Bacteria 6525526
475 2802736662 2802428861 Bacteria 6534206
476 2802746730 2802428862 Bacteria 6633353
477 2802749773 2802428863 Bacteria 6410669
478 2804750492 2802429268 Bacteria 6094027
479 2805931152 2802429605 Bacteria 6875453
480 2805936954 2802429606 Bacteria 6346811
481 2805937708 2802429606 Bacteria 6346811
482 2806048255 2802429633 Bacteria 7341974
483 2806055723 2802429634 Bacteria 7083200
484 2806062562 2802429635 Bacteria 7650140
485 2806070900 2802429636 Bacteria 7597525
486 2806076288 2802429637 Bacteria 7067217
487 2819612131 2818991448 Bacteria 6772224
488 2838033490 2838029111 Bacteria 6603031
489 2838034522 2838029111 Bacteria 6603031
490 2838042539 2838035591 Bacteria 7166484
491 2838080829 2838074704 Bacteria 6785777
492 2838668383 2838661181 Bacteria 7385261
493 2838691058 2838686498 Bacteria 7807632
494 2841856374 2841851746 Bacteria 7532261
495 2841870173 2841864319 Bacteria 6742987
496 2842083225 2842077413 Bacteria 6508645
497 2842114004 2842110456 Bacteria 7656360
498 2842117296 2842110456 Bacteria 7656360
499 2842202710 2842198810 Bacteria 6608673
500 2842275533 2842271015 Bacteria 7807131
501 2842290219 2842285085 Bacteria 6011953
502 2842302333 2842298080 Bacteria 6123127
503 2842303814 2842298080 Bacteria 6123127
504 2842324049 2842317721 Bacteria 6793725
505 2842363295 2842357229 Bacteria 6485165
506 2842402005 2842395702 Bacteria 6780583
507 2842407953 2842402390 Bacteria 6681310
508 2842408273 2842402390 Bacteria 6681310
509 2842414540 2842409023 Bacteria 6687331
510 2842414635 2842409023 Bacteria 6687331
511 2842421024 2842415677 Bacteria 6596907
512 2842421610 2842415677 Bacteria 6596907
513 2842480239 2842475841 Bacteria 6603183
514 2842481269 2842475841 Bacteria 6603183
515 2842488243 2842482326 Bacteria 7212537
516 2842494731 2842489311 Bacteria 6620893
517 2842507651 2842502639 Bacteria 6604161
518 2842508146 2842502639 Bacteria 6604161
519 2842513973 2842509118 Bacteria 6850950
520 2842514811 2842509118 Bacteria 6850950
521 2842524148 2842521101 Bacteria 6569494
522 2844164519 2844163670 Bacteria 7266046
523 2844461923 2844454524 Bacteria 7952546
524 2844462249 2844454524 Bacteria 7952546
525 2847421867 2847417321 Bacteria 6913799
526 2848996640 2848992105 Bacteria 6810864
527 2850083353 2850079185 Bacteria 6848280
528 2852392943 2852387548 Bacteria 8025568
529 2855876218 2855872281 Bacteria 6964271
530 2857522883 2857516855 Bacteria 7787325
531 2857524565 2857516855 Bacteria 7787325
532 2858804488 2858800743 Bacteria 6603254
533 2896389603 2896384573 Bacteria 7700774
534 2899804829 2899803654 Bacteria 5577784
535 2913298779 2913295892 Bacteria 6333755
536 2915986716 2915980308 Bacteria 6624279
537 2916064161 2916061851 Bacteria 6737736
538 2919107359 2919100787 Bacteria 7710546
539 2920762318 2920760137 Bacteria 7427611
540 2920767020 2920760137 Bacteria 7427611
541 2921254079 2921250672 Bacteria 6677771
542 2933023045 2933016740 Bacteria 6355406
543 2933589719 2933586486 Bacteria 7667493
544 2933590022 2933586486 Bacteria 7667493
545 2936386387 2936381700 Bacteria 7006523
546 2937035490 2937029754 Bacteria 6424026
547 2937039921 2937036028 Bacteria 6846469
548 2937078945 2937078374 Bacteria 6610289
549 2937087480 2937084907 Bacteria 6618516
550 2941503550 2941499720 Bacteria 7599444
551 2957376331 2957375807 Bacteria 6425588
552 2957440504 2957437181 Bacteria 6568994
553 2960597373 2960591022 Bacteria 6622873
554 2960636566 2960631154 Bacteria 6732508
555 2960686077 2960680706 Bacteria 6624464
556 2960695816 2960693952 Bacteria 6749742
557 2967690984 2967686174 Bacteria 6678622
558 2967733695 2967728569 Bacteria 6641507
559 2970029037 2970026789 Bacteria 6785236
560 2970125131 2970122695 Bacteria 6625855
561 2970148074 2970143518 Bacteria 6446480
562 2977533379 2977530762 Bacteria 6951399
563 2977548864 2977544691 Bacteria 6875412
564 643692046 643692032 Bacteria 6891900
565 8003574980 8003570095 Bacteria 5747666
566 8003575141 8003570095 Bacteria 5747666
567 8004005292 8003999396 Bacteria 7063185
568 8005301750 8005301065 Bacteria 6614431
569 8005402181 8005395548 Bacteria 6806915
570 8005465963 8005460587 Bacteria 7157962
571 8005488250 8005484373 Bacteria 6297373
572 8005549964 8005542996 Bacteria 7077758
573 8005571516 8005570704 Bacteria 6957481
574 8005648492 8005645114 Bacteria 6950293
575 8005687156 8005682033 Bacteria 6726518
576 8005689679 8005688590 Bacteria 6610080
577 8005693074 8005688590 Bacteria 6610080
578 8018169614 8018163183 Bacteria 7277977
579 8018179069 8018176218 Bacteria 6896178
580 8046767826 8046767195 Bacteria 7547379
581 8046770037 8046767195 Bacteria 7547379
582 8056377376 8056375014 Bacteria 7006639
583 8056877930 8056875544 Bacteria 4355797
584 8057581439 8057575449 Bacteria 7367519
585 8057880203 8057874678 Bacteria 7494653
586 Ga0451833_1293279
587 JGI25152J39213_1001183
588 JGI25152J39213_1019991
589 JGI25152J39213_1041718
590 JGI25151J46595_10001708
591 JGI25151J46595_10004310
592 JGI25153J46596_10001647
593 JGI25153J46596_10003224
594 JGI25153J46596_10047369
595 JGI25153J46596_10049846
596 JGI25153J46596_10097691
597 rootH1_10002814
598 rootH2_10029723
599 rootH2_10139809
600 rootL2_10010387
601 rootH1_10025473
602 rootH1_10076352
603 rootH1_10207768
604 JGI25161J50226_1004304
605 Ga0055526_1001150
606 Ga0055526_1001750
607 Ga0055526_1005680
608 Ga0055526_1037371
609 Ga0055524_1000369
610 Ga0055524_1000407
611 Ga0055524_1003922
612 Ga0055524_1026558
613 Ga0055524_1036550
614 Ga0055536_1003999
615 Ga0055536_1063675
616 Ga0055528_1000039
617 Ga0055528_1010450
618 Ga0055528_1055426
619 Ga0055528_1058154
620 Ga0055530_10008130
621 Ga0055530_10052845
622 Ga0055540_1000094
623 Ga0055540_1000381
624 Ga0055540_1050520
625 Ga0055531_10000389
626 Ga0055531_10006353
627 Ga0058692_1000019
628 Ga0058692_1000083
629 Ga0065165_1001497
630 Ga0065165_1001509
631 Ga0065165_1011007
632 Ga0070671_100025248
633 Ga0070663_100107445
634 Ga0070685_10844099
635 Ga0068854_101579082
636 Ga0068862_100994155
637 Ga0075365_10320722
638 Ga0075364_10003243
639 Ga0075362_10519386
640 Ga0075362_10601504
641 Ga0075367_10321964
642 Ga0075369_10313522
643 Ga0075366_10318815
644 Ga0075366_10385299
645 Ga0075370_10080554
646 Ga0079104_1019593
647 Ga0099826_10032287
648 Ga0105251_10029813
649 Ga0105244_10288922
650 Ga0105250_10026117
651 Ga0105247_10057299
652 Ga0105248_10045733
653 Ga0105249_10331140
654 Ga0157372_11106112
655 Ga0163161_10551344
656 Ga0163161_11227831
657 Ga0214544_1000097
658 Ga0214544_1000584
659 Ga0214544_1015545
660 Ga0214542_1000418
661 Ga0214542_1017888
662 Ga0214542_1031313
663 Ga0214543_1000929
664 Ga0214543_1003317
665 Ga0214543_1004049
666 Ga0214543_1038252
667 Ga0228711_1026720
668 Ga0228710_1011825
669 Ga0207425_1000083
670 Ga0209129_1000098
671 Ga0209129_1000719
672 Ga0209129_1000821
673 Ga0209129_1014080
674 Ga0209673_1000126
675 Ga0209673_1000161
676 Ga0209673_1001573
677 Ga0209673_1016374
678 Ga0209130_1041637
679 Ga0209130_1047867
680 Ga0209676_1003351
681 Ga0209676_1006418
682 Ga0209025_1000142
683 Ga0209025_1000532
684 Ga0209025_1001930
685 Ga0209025_1005458
686 Ga0209025_1150797
687 Ga0209025_1168096
688 Ga0209025_1181875
689 Ga0209564_1000368
690 Ga0209564_1000450
691 Ga0209564_1001053
692 Ga0209564_1006478
693 Ga0209564_1011104
694 Ga0209564_1041591
695 Ga0209758_1000300
696 Ga0209758_1000396
697 Ga0209758_1001917
698 Ga0209758_1004261
699 Ga0209758_1008506
700 Ga0209758_1008866
701 Ga0209758_1036651
702 Ga0209758_1159156
703 Ga0209050_1003671
704 Ga0209050_1008740
705 Ga0209256_1000228
706 Ga0209256_1000613
707 Ga0209256_1000999
708 Ga0209256_1001076
709 Ga0209256_1002109
710 Ga0209256_1003352
711 Ga0209256_1022384
712 Ga0207426_1001108
713 Ga0207426_1002581
714 Ga0207426_1029567
715 Ga0209051_1000032
716 Ga0209051_1000132
717 Ga0209051_1004297
718 Ga0209051_1011693
719 Ga0209051_1034883
720 Ga0209257_1000209
721 Ga0209257_1001963
722 Ga0209257_1016877
723 Ga0209257_1099421
724 Ga0207647_10255943
725 Ga0207709_10899768
726 Ga0207711_10111913
727 Ga0207678_10295517
728 Ga0207676_10422400
729 Ga0209281_1000348
730 Ga0209371_1000107
731 Ga0209371_1000251
732 Ga0209371_1051965
733 Ga0209282_1000070
734 Ga0268266_11602663
735 Ga0268265_10873481
736 Ga0307515_10058270
737 Ga0307515_10291777
738 Ga0268256_1000093
739 Ga0268256_1001634
740 Ga0268256_1058368
741 Ga0307513_10014116
742 Ga0307513_10075160
743 Ga0307408_100369520
744 Ga0307408_100546227
745 Ga0307514_10182934
746 Ga0307406_10480992
747 Ga0307412_11627558
748 Ga0315914_1000082
749 Ga0307510_10004792
750 Ga0315913_1000028
751 Ga0315915_1000004
752 Ga0373926_0063757
753 Ga0373927_0001245
754 Ga0373925_0000579
755 Ga0395899_0684984
756 Ga0395900_0464342
757 Ga0395898_0000840
758 Ga0395905_0004538
759 Ga0395901_0000132
760 Ga0439436_0004799
761 Ga0439438_048465
762 Ga0439447_106120
763 Ga0439466_0156386
764 Ga0439465_0000118
765 Ga0439465_0001766
766 Ga0439465_0046970
767 Ga0439465_0162128
768 Ga0451793_0879669
769 Ga0451798_0684008
770 Ga0451833_0186191
771 Ga0451833_0377058
772 Ga0451833_0858088
773 Ga0451835_0100703
774 Ga0451835_0104935
775 Ga0451835_1242391
776 Ga0451837_0165450
777 Ga0451837_0249402
778 Ga0451837_0629808
779 Ga0451837_1458164
780 Ga0451839_0352628
781 Ga0451839_1460354
782 Ga0451839_1571223
783 Ga0451841_0110022
784 Ga0451841_0176674
785 Ga0451845_0361663
786 Ga0451845_0715021
787 Ga0451847_0075758
788 Ga0451847_0206364
789 Ga0451849_0181325
790 Ga0451849_0692168
791 Ga0451849_1136831
792 Ga0451849_1311520
793 Ga0451849_1313199
794 Ga0451849_1476207
795 Ga0451851_0003572
796 Ga0451851_0545725
797 Ga0451843_0163406
798 Ga0451843_0286922
799 Ga0451843_1204107
800 Ga0451855_0138740
801 Ga0451855_0302858
802 Ga0451855_1291389
803 Ga0451853_0334798
804 Ga0451853_1298236
805 Ga0451853_2245295
806 Ga0439449_0054969
807 Ga0439449_0059762
808 Ga0439449_0254279
809 Ga0439452_088965
810 Ga0439462_0071524
811 Ga0439462_0145536
812 Ga0495627_010666
813 Ga0495638_0007091
814 Ga0495650_0159915
815 Ga0495605_0054976
816 Ga0495585_0002471
817 Ga0495585_0037727
818 Ga0495596_0020036
819 Ga0495607_0059013
820 Ga0495607_0203550
821 Ga0495607_0350850
822 Ga0495583_0012955
823 Ga0495583_0141675
824 Ga0495606_0017129
825 Ga0495610_0022958
826 Ga0495610_0140817
827 Ga0495610_0155411
828 Ga0495616_0070499
829 Ga0495620_0000107
830 Ga0495620_0001213
831 Ga0495620_0344642
832 Ga0495631_0001797
833 Ga0495631_0196051
834 Ga0495632_0011639
835 Ga0495637_0006745
836 Ga0495637_0117152
837 Ga0495643_0003041
838 Ga0495648_0030894
839 Ga0495663_0159475
840 Ga0495654_0004327
841 Ga0495609_0007882
842 Ga0495622_0329725
843 Ga0495633_0012813
844 Ga0495633_0031063
845 Ga0495633_0504524
846 Ga0495656_0020493
847 Ga0495668_0042877
848 Ga0495611_0144159
849 Ga0495625_0004571
850 Ga0495625_0011236
851 Ga0495625_0018841
852 Ga0495625_0057994
853 Ga0495625_0143335
854 Ga0495661_0400498
855 Ga0495588_0016014
856 Ga0495588_0036095
857 Ga0495588_0086832
858 Ga0495588_0364812
859 Ga0495670_0050275
860 Ga0495671_0002228
861 Ga0495671_0166133
862 Ga0495671_0243608
863 Ga0495649_0040391
864 Ga0495649_0059852
865 Ga0495600_0957550
866 Ga0495660_0111281
867 Ga0495687_027851
868 Ga0495687_032729
869 Ga0495679_109075
870 Ga0495681_0008822
871 Ga0495681_0055527
872 Ga0495681_0080431
873 Ga0495686_0054389
874 Ga0495686_0344089
875 Ga0495615_0087130
876 Ga0495615_0292930
877 Ga0496100_0152488
878 Ga0496102_0098274
879 Ga0496103_0297945
880 Ga0496104_0016015
881 Ga0496105_0000087
882 Ga0496106_0235010
883 Ga0496107_0292682
884 Ga0496109_0026714
885 Ga0496116_0000601
886 Ga0496116_0001726
887 Ga0496116_0038702
888 Ga0496117_0002417
889 Ga0496117_0093904
890 Ga0496118_0079213
891 Ga0496118_0177968
892 Ga0496119_0000569
893 Ga0496119_0011170
894 Ga0496119_0020439
895 Ga0496119_0498274
896 Ga0496120_0012525
897 Ga0496120_0020913
898 Ga0496121_0011301
899 Ga0496121_0191439
900 Ga0496121_0487923
901 Ga0496121_0725498
902 Ga0496121_0725780
903 Ga0496122_0005173
904 Ga0496122_0010254
905 Ga0496122_0010574
906 Ga0496122_0061402
907 Ga0496123_0002390
908 Ga0496123_0114871
909 Ga0496124_0010911
910 Ga0496124_0018666
911 Ga0496124_0020377
912 Ga0496124_0027146
913 Ga0496125_0000182
914 Ga0496126_0001273
915 Ga0496126_0055713
916 Ga0496126_0158904
917 Ga0495678_096969
918 Ga0495682_0163967
919 Ga0501032_0388342
920 Ga0501033_0000054
921 Ga0501033_0077354
922 Ga0501034_0054016
923 Ga0501034_0170044
924 Ga0501036_1235131
925 Ga0501280_000892
926 Ga0501035_0001626
927 Ga0501035_0668635
928 Ga0501044_0438234
929 nmdc:mga03683_69828_c1
930 nmdc:mga00v17_85_c1
931 nmdc:mga0yw44_446206_c1
932 nmdc:mga0k408_78177_c1
933 nmdc:mga06z11_278895_c1
934 nmdc:mga07m45_23918_c2
935 nmdc:mga0sz30_155921_c1
936 nmdc:mga0sz30_196157_c1
937 Ga0500610_0131126
938 Ga0500643_058119
939 Ga0500556_0314621
940 Ga0500557_001176
941 Ga0500593_159323
942 Ga0500594_0001801
943 Ga0500594_0022369
944 Ga0500618_000097
945 Ga0500618_008258
946 Ga0500658_0287227
947 Ga0500559_0408854
948 Ga0500561_0060087
949 Ga0500573_0003603
950 Ga0500606_044720
951 Ga0500616_0000438
952 Ga0500622_0000278
953 Ga0500636_0000231
954 Ga0500636_0017031
955 Ga0500636_0088661
956 Ga0500636_0132696
957 Ga0500636_0136935
958 Ga0500611_253049
959 2509111906
960 2509378648
961 2511173545
962 2512531268
963 2512975102
964 2513573046
965 2513580875
966 2513598456
967 2513600616
968 2513605138
969 2513869942
970 2513881840
971 2513885917
972 2513914244
973 2513930110
974 2513989293
975 2513998923
976 2514007831
977 2514024727
978 2515108389
979 2515109929
980 2515611282
981 2515611855
982 2515635675
983 2515661298
984 2516210367
985 2517042912
986 2517099937
987 2517567746
988 2524451572
989 2524460891
990 2524462820
991 2524462873
992 2535521024
993 2558864273
994 2558867018
995 2558867705
996 2585205204
997 2585258066
998 2585268306
999 2585281746
1000 2585334820
1001 2585534394
1002 2585841008
1003 2585846022
1004 2585897382
1005 2585908927
1006 2585994095
1007 2587984250
1008 2599413970
1009 2599606329
1010 2599723326
1011 2616310040
1012 2616311764
1013 2616551460
1014 2643806757
1015 2643810874
1016 2643815077
1017 2643858400
1018 2643918125
1019 2644066810
1020 2644147390
1021 2644192466
1022 2644200551
1023 2644208164
1024 2644300762
1025 2644381255
1026 2644417756
1027 2644451032
1028 2644651922
1029 2644658984
1030 2644674462
1031 2644691749
1032 2657686528
1033 2692320945
1034 2720617069
1035 2725949141
1036 2739037591
1037 2753462847
1038 2766064446
1039 2778176770
1040 2778179989
1041 2778180295
1042 2792623754
1043 2792624678
1044 2792630013
1045 2792630798
1046 2792641091
1047 2792642043
1048 2793283264
1049 2793298073
1050 2793343378
1051 2793343569
1052 2793363140
1053 2793363448
1054 2793364263
1055 2793370592
1056 2802721039
1057 2802728128
1058 2802733593
1059 2802736662
1060 2802746730
1061 2802749773
1062 2804750492
1063 2805931152
1064 2805936954
1065 2805937708
1066 2806048255
1067 2806055723
1068 2806062562
1069 2806070900
1070 2806076288
1071 2819612131
1072 2838033490
1073 2838034522
1074 2838042539
1075 2838080829
1076 2838668383
1077 2838691058
1078 2841856374
1079 2841870173
1080 2842083225
1081 2842114004
1082 2842117296
1083 2842202710
1084 2842275533
1085 2842290219
1086 2842302333
1087 2842303814
1088 2842324049
1089 2842363295
1090 2842402005
1091 2842407953
1092 2842408273
1093 2842414540
1094 2842414635
1095 2842421024
1096 2842421610
1097 2842480239
1098 2842481269
1099 2842488243
1100 2842494731
1101 2842507651
1102 2842508146
1103 2842513973
1104 2842514811
1105 2842524148
1106 2844164519
1107 2844461923
1108 2844462249
1109 2847421867
1110 2848996640
1111 2850083353
1112 2852392943
1113 2855876218
1114 2857522883
1115 2857524565
1116 2858804488
1117 2896389603
1118 2899804829
1119 2913298779
1120 2915986716
1121 2916064161
1122 2919107359
1123 2920762318
1124 2920767020
1125 2921254079
1126 2933023045
1127 2933589719
1128 2933590022
1129 2936386387
1130 2937035490
1131 2937039921
1132 2937078945
1133 2937087480
1134 2941503550
1135 2957376331
1136 2957440504
1137 2960597373
1138 2960636566
1139 2960686077
1140 2960695816
1141 2967690984
1142 2967733695
1143 2970029037
1144 2970125131
1145 2970148074
1146 2977533379
1147 2977548864
1148 643692046
1149 8003574980
1150 8003575141
1151 8004005292
1152 8005301750
1153 8005402181
1154 8005465963
1155 8005488250
1156 8005549964
1157 8005571516
1158 8005648492
1159 8005687156
1160 8005689679
1161 8005693074
1162 8018169614
1163 8018179069
1164 8046767826
1165 8046770037
1166 8056377376
1167 8056877930
1168 8057581439
1169 8057880203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05101

VirB3

Type IV secretory pathway, VirB3-like protein

18

106

0.88

Map