F466476

General Info

Members Datasets Scaffolds Average Seq Length
585 282 1170 114

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0961218|Ga0453684_0961218_182_481
Length 99
Sequence MKLRIQSINFDATTTLESYINKKLLKLEKNFDEIQNVDVYLKVVKPESATNKEAEIKVSIPNVDFFASKTCDSFEEATDLTIEAIDKQIRKHKEKSTKK

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
149 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
150 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
151 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
152 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
153 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
168 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
178 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
181 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
198 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
202 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
203 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
209 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
223 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
224 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
225 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
241 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
242 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
243 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
244 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
245 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
246 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
247 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
248 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
249 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
250 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
251 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
253 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
254 2738541283 Pedobacter sp. OK701 Isolate Unclassified
255 2738541284 Pedobacter sp. YR016 Isolate Unclassified
256 2738541302 Pedobacter sp. CF074 Isolate Unclassified
257 2738543023 Pedobacter sp. OK628 Isolate Unclassified
258 2739367651 Pedobacter sp. OK291 Isolate Unclassified
259 2739367656 Pedobacter sp. CF523 Isolate Unclassified
260 2739367663 Pedobacter sp. YR510 Isolate Unclassified
261 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
262 2818991437 Pedobacter terrae 518 Isolate Unclassified
263 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
264 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
265 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
266 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
267 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
268 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
269 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
270 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
271 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
272 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
273 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
274 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
275 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
276 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
277 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
278 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
279 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
280 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
281 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
282 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.43
Metatranscriptomes 4.27
Isolates 5.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.4
Nodule 0
Rhizoplane 1.03
Rhizosphere 82.56
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0961218 3300044712 Bacteria 911
2 SwRhRL2b_contig_2336375 2162886007 Bacteria 1432
3 JGI24736J21556_1015162 3300001904 Bacteria 1236
4 JGI24737J22298_10000765 3300001990 Bacteria 11362
5 JGI24743J22301_10006041 3300001991 Bacteria 2046
6 JGI24735J21928_10000009 3300002067 Bacteria 247425
7 JGI24738J21930_10124490 3300002075 Bacteria 561
8 JGI24744J21845_10005025 3300002077 Bacteria 2738
9 JGI25162J39368_1000120 3300002737 Bacteria 86031
10 JGI25162J39368_1001524 3300002737 Bacteria 11972
11 JGI25157J39369_1006802 3300002741 Bacteria 1705
12 JGI25164J39214_1000824 3300002772 Bacteria 10827
13 JGI25152J39213_1000022 3300002773 Bacteria 105664
14 JGI25152J39213_1025565 3300002773 Bacteria 976
15 JGI25150J39212_1000001 3300002774 Bacteria 1318726
16 JGI25151J46595_10000001 3300003187 Bacteria 887211
17 JGI25165J46597_1000923 3300003214 Bacteria 20349
18 JGI25153J46596_10000001 3300003215 Bacteria 748985
19 rootH2_10073704 3300003320 Bacteria 1729
20 rootL2_10027602 3300003322 Bacteria 7785
21 rootH1_10055270 3300003323 Bacteria 10429
22 rootH1_10178994 3300003323 Bacteria 1752
23 Ga0055525_1021696 3300003759 Bacteria 546
24 Ga0055536_1000001 3300003781 Bacteria 630663
25 Ga0055530_10005254 3300003791 Bacteria 6242
26 Ga0065714_10009247 3300005288 Bacteria 2606
27 Ga0065714_10009591 3300005288 Bacteria 4012
28 Ga0065714_10048636 3300005288 Bacteria 764
29 Ga0065714_10068784 3300005288 Bacteria 4539
30 Ga0065714_10079950 3300005288 Bacteria 2476
31 Ga0065714_10081513 3300005288 Bacteria 2368
32 Ga0065714_10105688 3300005288 Bacteria 1562
33 Ga0065714_10163574 3300005288 Bacteria 997
34 Ga0065714_10194457 3300005288 Bacteria 916
35 Ga0065714_10403218 3300005288 Bacteria 588
36 Ga0065704_10191174 3300005289 Bacteria 1182
37 Ga0070658_10000014 3300005327 Bacteria 244978
38 Ga0070658_10125069 3300005327 Bacteria 2140
39 Ga0070658_10392973 3300005327 Bacteria 1191
40 Ga0070658_10865239 3300005327 Bacteria 786
41 Ga0070676_10004106 3300005328 Bacteria 7650
42 Ga0070683_100076604 3300005329 Bacteria 3127
43 Ga0068869_100201652 3300005334 Bacteria 1569
44 Ga0068869_101476697 3300005334 Bacteria 603
45 Ga0070680_100354051 3300005336 Bacteria 1249
46 Ga0068868_100069307 3300005338 Bacteria 2810
47 Ga0068868_100526543 3300005338 Bacteria 1038
48 Ga0070660_100281189 3300005339 Bacteria 1362
49 Ga0070660_100399152 3300005339 Bacteria 1137
50 Ga0070660_100559721 3300005339 Bacteria 954
51 Ga0070661_100477045 3300005344 Bacteria 996
52 Ga0070671_100045108 3300005355 Bacteria 3664
53 Ga0070674_101827563 3300005356 Bacteria 551
54 Ga0070673_100275689 3300005364 Bacteria 1473
55 Ga0070659_100000402 3300005366 Bacteria 32771
56 Ga0070659_100051269 3300005366 Bacteria 3245
57 Ga0070659_100053857 3300005366 Bacteria 3168
58 Ga0070659_100212416 3300005366 Bacteria 1595
59 Ga0070663_100714032 3300005455 Bacteria 853
60 Ga0070678_100001822 3300005456 Bacteria 11482
61 Ga0070662_100028795 3300005457 Bacteria 3869
62 Ga0070681_10008372 3300005458 Bacteria 10130
63 Ga0068867_100001197 3300005459 Bacteria 17799
64 Ga0070679_100075612 3300005530 Bacteria 3357
65 Ga0070679_100190446 3300005530 Bacteria 2020
66 Ga0070679_101388163 3300005530 Bacteria 649
67 Ga0070684_100615661 3300005535 Bacteria 1010
68 Ga0068853_100136213 3300005539 Bacteria 2201
69 Ga0068853_100258391 3300005539 Bacteria 1600
70 Ga0068853_100495081 3300005539 Bacteria 1153
71 Ga0070665_100000032 3300005548 Bacteria 333352
72 Ga0068855_100000026 3300005563 Bacteria 175140
73 Ga0068855_100000248 3300005563 Bacteria 67971
74 Ga0068855_100091999 3300005563 Bacteria 3498
75 Ga0068855_100158892 3300005563 Bacteria 2567
76 Ga0068855_100323950 3300005563 Bacteria 1703
77 Ga0068855_100479837 3300005563 Bacteria 1354
78 Ga0068855_100536715 3300005563 Bacteria 1268
79 Ga0068855_100581028 3300005563 Bacteria 1210
80 Ga0068855_100859037 3300005563 Bacteria 961
81 Ga0068857_100361490 3300005577 Bacteria 1346
82 Ga0068857_100432210 3300005577 Bacteria 1229
83 Ga0068854_100201019 3300005578 Bacteria 1567
84 Ga0068854_100443461 3300005578 Bacteria 1083
85 Ga0068854_100590861 3300005578 Bacteria 947
86 Ga0068856_100000014 3300005614 Bacteria 163480
87 Ga0068856_100003360 3300005614 Bacteria 16215
88 Ga0068856_100166735 3300005614 Bacteria 2213
89 Ga0068856_100401913 3300005614 Bacteria 1390
90 Ga0068856_100439140 3300005614 Bacteria 1325
91 Ga0068856_101104002 3300005614 Bacteria 810
92 Ga0068856_101264970 3300005614 Bacteria 754
93 Ga0068856_101274110 3300005614 Bacteria 751
94 Ga0068856_102401301 3300005614 Bacteria 535
95 Ga0068852_100004662 3300005616 Bacteria 9721
96 Ga0068866_10188181 3300005718 Bacteria 1225
97 Ga0068851_10498792 3300005834 Bacteria 730
98 Ga0068863_100323149 3300005841 Bacteria 1499
99 Ga0068858_100191651 3300005842 Bacteria 1932
100 Ga0075366_10000812 3300006195 Bacteria 14982
101 Ga0075366_10020556 3300006195 Bacteria 3832
102 Ga0075366_10132436 3300006195 Bacteria 1505
103 Ga0075366_10134629 3300006195 Bacteria 1492
104 Ga0097621_100000057 3300006237 Bacteria 58430
105 Ga0068871_100000094 3300006358 Bacteria 52461
106 Ga0068871_100675472 3300006358 Bacteria 945
107 Ga0068865_100000200 3300006881 Bacteria 33423
108 Ga0105251_10222038 3300009011 Bacteria 851
109 Ga0105240_10026059 3300009093 Bacteria 7676
110 Ga0105240_10054975 3300009093 Bacteria 4986
111 Ga0105240_10094952 3300009093 Bacteria 3637
112 Ga0105240_10184187 3300009093 Bacteria 2461
113 Ga0105240_10290440 3300009093 Bacteria 1875
114 Ga0105240_10368662 3300009093 Bacteria 1624
115 Ga0105240_10411293 3300009093 Bacteria 1521
116 Ga0105240_11099934 3300009093 Bacteria 846
117 Ga0105240_11127679 3300009093 Bacteria 833
118 Ga0105240_11504042 3300009093 Bacteria 706
119 Ga0105240_12648945 3300009093 Bacteria 518
120 Ga0105245_10053242 3300009098 Bacteria 3632
121 Ga0105243_10234425 3300009148 Bacteria 1630
122 Ga0105241_10095212 3300009174 Bacteria 2357
123 Ga0105241_10471573 3300009174 Bacteria 1114
124 Ga0105241_10983314 3300009174 Bacteria 788
125 Ga0105241_11060459 3300009174 Bacteria 761
126 Ga0105242_10050379 3300009176 Bacteria 3390
127 Ga0105237_10001287 3300009545 Bacteria 33378
128 Ga0105237_10001321 3300009545 Bacteria 32889
129 Ga0105237_10005754 3300009545 Bacteria 13929
130 Ga0105237_10009919 3300009545 Bacteria 10162
131 Ga0105237_10012788 3300009545 Bacteria 8828
132 Ga0105237_10085054 3300009545 Bacteria 3152
133 Ga0105237_10417275 3300009545 Bacteria 1347
134 Ga0105237_10559743 3300009545 Bacteria 1150
135 Ga0105237_12300600 3300009545 Bacteria 549
136 Ga0105238_10003742 3300009551 Bacteria 15125
137 Ga0105238_10318704 3300009551 Bacteria 1540
138 Ga0105238_10523618 3300009551 Bacteria 1188
139 Ga0105238_11302770 3300009551 Bacteria 752
140 Ga0105239_10000001 3300010375 Bacteria 617353
141 Ga0105239_10001363 3300010375 Bacteria 32814
142 Ga0105239_10005053 3300010375 Bacteria 15586
143 Ga0105239_10128692 3300010375 Bacteria 2815
144 Ga0105239_10254445 3300010375 Bacteria 1973
145 Ga0105239_10259255 3300010375 Bacteria 1954
146 Ga0105239_10848564 3300010375 Bacteria 1047
147 Ga0105239_11336734 3300010375 Bacteria 827
148 Ga0105239_11631516 3300010375 Bacteria 746
149 Ga0157373_10000175 3300013100 Bacteria 52539
150 Ga0157373_10001983 3300013100 Bacteria 15522
151 Ga0157373_10002244 3300013100 Bacteria 14631
152 Ga0157373_10024499 3300013100 Bacteria 4370
153 Ga0157373_10095040 3300013100 Bacteria 2098
154 Ga0157373_10162221 3300013100 Bacteria 1573
155 Ga0157371_10000276 3300013102 Bacteria 69547
156 Ga0157371_10074928 3300013102 Bacteria 2397
157 Ga0157371_10939929 3300013102 Bacteria 657
158 Ga0157370_10000304 3300013104 Bacteria 61764
159 Ga0157370_10066375 3300013104 Bacteria 3412
160 Ga0157370_10105905 3300013104 Bacteria 2632
161 Ga0157370_10135449 3300013104 Bacteria 2296
162 Ga0157370_10238451 3300013104 Bacteria 1683
163 Ga0157370_10529511 3300013104 Bacteria 1081
164 Ga0157370_10532559 3300013104 Bacteria 1077
165 Ga0157370_11297375 3300013104 Bacteria 656
166 Ga0157369_10000040 3300013105 Bacteria 183469
167 Ga0157369_10063032 3300013105 Bacteria 3994
168 Ga0157369_10459556 3300013105 Bacteria 1318
169 Ga0157374_10142191 3300013296 Bacteria 2330
170 Ga0157374_10297971 3300013296 Bacteria 1595
171 Ga0157374_10625250 3300013296 Bacteria 1088
172 Ga0157378_10072796 3300013297 Bacteria 3088
173 Ga0157378_10117838 3300013297 Bacteria 2443
174 Ga0157378_10529425 3300013297 Bacteria 1181
175 Ga0157378_10604465 3300013297 Bacteria 1108
176 Ga0163162_10000052 3300013306 Bacteria 112651
177 Ga0163162_10004554 3300013306 Bacteria 13359
178 Ga0163162_10021730 3300013306 Bacteria 6319
179 Ga0163162_10157628 3300013306 Bacteria 2391
180 Ga0163162_10213814 3300013306 Bacteria 2058
181 Ga0163162_10880030 3300013306 Bacteria 1010
182 Ga0157372_10004038 3300013307 Bacteria 15739
183 Ga0157372_10015618 3300013307 Bacteria 8142
184 Ga0157372_10042429 3300013307 Bacteria 5032
185 Ga0157372_10087965 3300013307 Bacteria 3526
186 Ga0157372_10540873 3300013307 Bacteria 1358
187 Ga0157372_10691273 3300013307 Bacteria 1187
188 Ga0157372_10743257 3300013307 Bacteria 1141
189 Ga0157372_10917045 3300013307 Bacteria 1016
190 Ga0157372_11712258 3300013307 Bacteria 723
191 Ga0157375_10052289 3300013308 Bacteria 4015
192 Ga0157375_10130777 3300013308 Bacteria 2629
193 Ga0157375_10516808 3300013308 Bacteria 1358
194 Ga0157375_11060989 3300013308 Bacteria 947
195 Ga0157375_11978684 3300013308 Bacteria 692
196 Ga0163163_10781318 3300014325 Bacteria 1018
197 Ga0163163_10837569 3300014325 Bacteria 983
198 Ga0182008_10000030 3300014497 Bacteria 169168
199 Ga0182008_10006118 3300014497 Bacteria 6763
200 Ga0182008_10100478 3300014497 Bacteria 1429
201 Ga0182008_10250036 3300014497 Bacteria 914
202 Ga0182008_10332023 3300014497 Bacteria 802
203 Ga0182008_10447756 3300014497 Bacteria 701
204 Ga0157377_10142532 3300014745 Bacteria 1474
205 Ga0157376_10095846 3300014969 Bacteria 2581
206 Ga0157376_11382274 3300014969 Bacteria 735
207 Ga0182006_1000872 3300015261 Bacteria 20250
208 Ga0182006_1002415 3300015261 Bacteria 10209
209 Ga0182006_1012527 3300015261 Bacteria 3707
210 Ga0182006_1020484 3300015261 Bacteria 2771
211 Ga0182006_1033008 3300015261 Bacteria 2077
212 Ga0182006_1111881 3300015261 Bacteria 958
213 Ga0182007_10000003 3300015262 Bacteria 548244
214 Ga0182007_10058721 3300015262 Bacteria 1262
215 Ga0182007_10122369 3300015262 Bacteria 871
216 Ga0183373_1001 3300015682 Bacteria 1410374
217 Ga0163161_10006390 3300017792 Bacteria 8159
218 Ga0163161_10031402 3300017792 Bacteria 3784
219 Ga0163161_10060117 3300017792 Bacteria 2765
220 Ga0163161_10341896 3300017792 Bacteria 1187
221 Ga0163161_10461595 3300017792 Bacteria 1028
222 Ga0163161_10488963 3300017792 Bacteria 1000
223 Ga0163161_10512550 3300017792 Bacteria 978
224 Ga0163161_10564503 3300017792 Bacteria 934
225 Ga0163161_11045943 3300017792 Bacteria 699
226 Ga0163161_11235625 3300017792 Bacteria 647
227 Ga0197907_10460860 3300020069 Bacteria 551
228 Ga0206356_11665215 3300020070 Bacteria 671
229 Ga0206349_1885028 3300020075 Bacteria 717
230 Ga0206351_10089304 3300020077 Bacteria 542
231 Ga0206351_10092710 3300020077 Bacteria 1312
232 Ga0206351_10266683 3300020077 Bacteria 1028
233 Ga0206352_10142629 3300020078 Bacteria 638
234 Ga0206352_10302237 3300020078 Bacteria 515
235 Ga0206352_10549549 3300020078 Bacteria 618
236 Ga0206352_10821137 3300020078 Bacteria 799
237 Ga0206352_10983977 3300020078 Bacteria 623
238 Ga0206352_11278938 3300020078 Bacteria 635
239 Ga0206350_10940241 3300020080 Bacteria 612
240 Ga0206350_11373609 3300020080 Bacteria 1281
241 Ga0206354_10096798 3300020081 Bacteria 748
242 Ga0206354_10195354 3300020081 Bacteria 617
243 Ga0206353_11414568 3300020082 Bacteria 560
244 Ga0206353_11487520 3300020082 Bacteria 502
245 Ga0154015_1145674 3300020610 Bacteria 1261
246 Ga0154015_1323334 3300020610 Bacteria 941
247 Ga0224712_10434447 3300022467 Bacteria 629
248 Ga0224712_10456144 3300022467 Bacteria 614
249 Ga0224712_10473535 3300022467 Bacteria 603
250 Ga0209563_116042 3300025230 Bacteria 929
251 Ga0207427_100236 3300025231 Bacteria 45297
252 Ga0209437_100034 3300025233 Bacteria 494007
253 Ga0209437_100143 3300025233 Bacteria 164970
254 Ga0207425_1000002 3300025245 Bacteria 1362590
255 Ga0209026_1000663 3300025250 Bacteria 21055
256 Ga0209026_1009640 3300025250 Bacteria 1875
257 Ga0209026_1024642 3300025250 Bacteria 911
258 Ga0209026_1033005 3300025250 Bacteria 764
259 Ga0209148_1034014 3300025254 Bacteria 741
260 Ga0209129_1000002 3300025258 Bacteria 1359086
261 Ga0209129_1005110 3300025258 Bacteria 4805
262 Ga0209233_1000038 3300025261 Bacteria 548972
263 Ga0209233_1011941 3300025261 Bacteria 2539
264 Ga0209233_1053621 3300025261 Bacteria 808
265 Ga0209676_1000008 3300025292 Bacteria 991778
266 Ga0209025_1000004 3300025294 Bacteria 1361782
267 Ga0209758_1000006 3300025297 Bacteria 1359562
268 Ga0209050_1000045 3300025298 Bacteria 388022
269 Ga0207655_1111463 3300025728 Bacteria 923
270 Ga0207642_10130757 3300025899 Bacteria 1310
271 Ga0207647_10008662 3300025904 Bacteria 7268
272 Ga0207647_10043409 3300025904 Bacteria 2814
273 Ga0207647_10063624 3300025904 Bacteria 2244
274 Ga0207645_10002281 3300025907 Bacteria 15210
275 Ga0207705_10000043 3300025909 Bacteria 181491
276 Ga0207705_10182796 3300025909 Bacteria 1583
277 Ga0207705_10333291 3300025909 Bacteria 1167
278 Ga0207705_10526257 3300025909 Bacteria 919
279 Ga0207654_10137114 3300025911 Bacteria 1556
280 Ga0207654_10440269 3300025911 Bacteria 912
281 Ga0207707_10051151 3300025912 Bacteria 3598
282 Ga0207695_10000053 3300025913 Bacteria 396740
283 Ga0207695_10020448 3300025913 Bacteria 7580
284 Ga0207695_10029659 3300025913 Bacteria 6038
285 Ga0207695_10237410 3300025913 Bacteria 1725
286 Ga0207695_10414277 3300025913 Bacteria 1232
287 Ga0207695_10883081 3300025913 Bacteria 774
288 Ga0207695_11085969 3300025913 Bacteria 680
289 Ga0207695_11508429 3300025913 Bacteria 553
290 Ga0207671_10002398 3300025914 Bacteria 20096
291 Ga0207671_10002869 3300025914 Bacteria 17871
292 Ga0207671_10003823 3300025914 Bacteria 14729
293 Ga0207671_10005821 3300025914 Bacteria 11203
294 Ga0207671_10022025 3300025914 Bacteria 4825
295 Ga0207671_10228993 3300025914 Bacteria 1458
296 Ga0207671_10375027 3300025914 Bacteria 1130
297 Ga0207671_10764258 3300025914 Bacteria 767
298 Ga0207671_11534813 3300025914 Bacteria 513
299 Ga0207660_10025593 3300025917 Bacteria 4008
300 Ga0207660_11071074 3300025917 Bacteria 657
301 Ga0207657_10242923 3300025919 Bacteria 1437
302 Ga0207657_10344371 3300025919 Bacteria 1176
303 Ga0207657_10353850 3300025919 Bacteria 1158
304 Ga0207657_10512752 3300025919 Bacteria 939
305 Ga0207652_10026145 3300025921 Bacteria 4858
306 Ga0207652_10158506 3300025921 Bacteria 2028
307 Ga0207652_11140492 3300025921 Bacteria 681
308 Ga0207694_10348023 3300025924 Bacteria 1226
309 Ga0207694_10430858 3300025924 Bacteria 1099
310 Ga0207694_10725714 3300025924 Bacteria 838
311 Ga0207644_10010204 3300025931 Bacteria 6189
312 Ga0207690_10000365 3300025932 Bacteria 30004
313 Ga0207690_10003759 3300025932 Bacteria 9000
314 Ga0207690_10526296 3300025932 Bacteria 959
315 Ga0207706_10000057 3300025933 Bacteria 112805
316 Ga0207686_10192197 3300025934 Bacteria 1456
317 Ga0207709_10502264 3300025935 Bacteria 946
318 Ga0207669_11592111 3300025937 Bacteria 557
319 Ga0207704_10000052 3300025938 Bacteria 80866
320 Ga0207691_10964729 3300025940 Bacteria 712
321 Ga0207689_10171808 3300025942 Bacteria 1787
322 Ga0207661_10057095 3300025944 Bacteria 3137
323 Ga0207667_10000022 3300025949 Bacteria 369570
324 Ga0207667_10001325 3300025949 Bacteria 31070
325 Ga0207667_10037152 3300025949 Bacteria 5209
326 Ga0207667_10087032 3300025949 Bacteria 3232
327 Ga0207667_10113392 3300025949 Bacteria 2795
328 Ga0207667_10492506 3300025949 Bacteria 1244
329 Ga0207651_10033272 3300025960 Bacteria 3323
330 Ga0207640_10176046 3300025981 Bacteria 1599
331 Ga0207640_10264718 3300025981 Bacteria 1342
332 Ga0207677_10091875 3300026023 Bacteria 2209
333 Ga0207677_10908778 3300026023 Bacteria 794
334 Ga0207703_10477102 3300026035 Bacteria 1168
335 Ga0207703_11232452 3300026035 Bacteria 719
336 Ga0207639_10050764 3300026041 Bacteria 3151
337 Ga0207639_10123676 3300026041 Bacteria 2130
338 Ga0207639_10159488 3300026041 Bacteria 1899
339 Ga0207639_11057669 3300026041 Bacteria 761
340 Ga0207678_10224897 3300026067 Bacteria 1606
341 Ga0207702_10000036 3300026078 Bacteria 154106
342 Ga0207702_10251539 3300026078 Bacteria 1660
343 Ga0207702_10292030 3300026078 Bacteria 1545
344 Ga0207702_10919390 3300026078 Bacteria 867
345 Ga0207702_11075908 3300026078 Bacteria 798
346 Ga0207702_12456107 3300026078 Bacteria 508
347 Ga0207641_11714374 3300026088 Bacteria 630
348 Ga0207648_10002788 3300026089 Bacteria 18537
349 Ga0207674_10154666 3300026116 Bacteria 2249
350 Ga0207674_11408945 3300026116 Bacteria 666
351 Ga0207674_12076698 3300026116 Bacteria 532
352 Ga0207683_10010796 3300026121 Bacteria 7788
353 Ga0207698_10016030 3300026142 Bacteria 5040
354 Ga0207698_11275593 3300026142 Bacteria 749
355 Ga0268266_10000030 3300028379 Bacteria 417120
356 Ga0268264_10514910 3300028381 Bacteria 1169
357 Ga0307517_10006168 3300028786 Bacteria 17856
358 Ga0307515_10008566 3300028794 Bacteria 19914
359 Ga0307515_10082620 3300028794 Bacteria 4151
360 Ga0307515_10225522 3300028794 Bacteria 1680
361 Ga0265338_10020274 3300028800 Bacteria 7005
362 Ga0265338_10447517 3300028800 Bacteria 915
363 Ga0316177_1003967 3300030731 Bacteria 16835
364 Ga0316177_1067224 3300030731 Bacteria 504
365 Ga0316176_1180404 3300030732 Bacteria 8687
366 Ga0314311_1167977 3300030733 Bacteria 1087
367 Ga0316183_1095896 3300030742 Bacteria 133299
368 Ga0316181_1084669 3300030744 Bacteria 1364
369 Ga0316181_1158926 3300030744 Bacteria 6116
370 Ga0316182_1114895 3300030745 Bacteria 2540
371 Ga0265331_10391384 3300031250 Bacteria 623
372 Ga0265327_10093580 3300031251 Bacteria 1462
373 Ga0265327_10283837 3300031251 Bacteria 731
374 Ga0265327_10346580 3300031251 Bacteria 649
375 Ga0307513_10601182 3300031456 Bacteria 809
376 Ga0307408_100011421 3300031548 Bacteria 5868
377 Ga0307408_100091936 3300031548 Bacteria 2292
378 Ga0307408_100092560 3300031548 Bacteria 2285
379 Ga0307408_100699407 3300031548 Bacteria 911
380 Ga0307516_10594031 3300031730 Bacteria 761
381 Ga0307405_10000003 3300031731 Bacteria 569064
382 Ga0307405_11577215 3300031731 Bacteria 579
383 Ga0307413_11140610 3300031824 Bacteria 675
384 Ga0307407_10000030 3300031903 Bacteria 97416
385 Ga0307407_10952751 3300031903 Bacteria 661
386 Ga0307412_10000065 3300031911 Bacteria 122279
387 Ga0307412_10000925 3300031911 Bacteria 16779
388 Ga0307412_10007236 3300031911 Bacteria 6294
389 Ga0307412_10294865 3300031911 Bacteria 1279
390 Ga0307412_10301438 3300031911 Bacteria 1267
391 Ga0307412_10444528 3300031911 Bacteria 1066
392 Ga0307412_10650225 3300031911 Bacteria 899
393 Ga0307412_11079457 3300031911 Bacteria 713
394 Ga0307412_11148350 3300031911 Bacteria 693
395 Ga0307409_100120979 3300031995 Bacteria 2217
396 Ga0307409_102809568 3300031995 Bacteria 514
397 Ga0307416_100000014 3300032002 Bacteria 249053
398 Ga0307416_100244859 3300032002 Bacteria 1740
399 Ga0307414_10005403 3300032004 Bacteria 7034
400 Ga0307414_10026048 3300032004 Bacteria 3758
401 Ga0307414_10299547 3300032004 Bacteria 1359
402 Ga0307414_10305330 3300032004 Bacteria 1348
403 Ga0307414_10321906 3300032004 Bacteria 1316
404 Ga0307414_10406717 3300032004 Bacteria 1183
405 Ga0307414_10722447 3300032004 Bacteria 903
406 Ga0307414_10884995 3300032004 Bacteria 818
407 Ga0307414_11204325 3300032004 Bacteria 701
408 Ga0307411_10520625 3300032005 Bacteria 1009
409 Ga0307411_11046861 3300032005 Bacteria 733
410 Ga0307507_10000032 3300033179 Bacteria 194155
411 Ga0307510_10005905 3300033180 Bacteria 14606
412 Ga0373941_0107642 3300035115 Bacteria 978
413 Ga0373925_1636913 3300037068 Bacteria 526
414 Ga0395899_0000002 3300037312 Bacteria 1324310
415 Ga0395899_0012421 3300037312 Bacteria 6524
416 Ga0395899_0047989 3300037312 Bacteria 3178
417 Ga0395900_0000143 3300037418 Bacteria 120234
418 Ga0395900_0000285 3300037418 Bacteria 75772
419 Ga0395900_0513616 3300037418 Bacteria 1147
420 Ga0395898_0008044 3300037466 Bacteria 11177
421 Ga0395898_0245430 3300037466 Bacteria 1708
422 Ga0395905_0000045 3300037471 Bacteria 241370
423 Ga0395905_0000765 3300037471 Bacteria 42351
424 Ga0395901_0002501 3300038443 Bacteria 18608
425 Ga0395901_0035978 3300038443 Bacteria 5116
426 Ga0436361_0542797 3300039447 Bacteria 4744
427 Ga0439439_0186357 3300041406 Bacteria 599
428 Ga0451797_0777216 3300041453 Bacteria 725
429 Ga0451807_1592925 3300041486 Bacteria 607
430 Ga0451807_1852552 3300041486 Bacteria 830
431 Ga0451807_1966145 3300041486 Bacteria 540
432 Ga0451841_0449127 3300041498 Bacteria 780
433 Ga0451843_0191440 3300041509 Bacteria 618
434 Ga0451843_1497749 3300041509 Bacteria 792
435 Ga0439448_0000810 3300042005 Bacteria 7615
436 Ga0439455_0043498 3300042012 Bacteria 1156
437 Ga0466968_0074554 3300044735 Bacteria 1482
438 Ga0495627_045542 3300046453 Bacteria 1336
439 Ga0495627_122578 3300046453 Bacteria 733
440 Ga0495629_0085265 3300046459 Bacteria 2204
441 Ga0495638_0110069 3300046460 Bacteria 1637
442 Ga0495651_0078117 3300046462 Bacteria 2504
443 Ga0495650_0000594 3300046471 Bacteria 49931
444 Ga0495650_0057227 3300046471 Bacteria 1579
445 Ga0495650_0214981 3300046471 Bacteria 664
446 Ga0495605_0122970 3300046474 Bacteria 1175
447 Ga0495585_0000014 3300046492 Bacteria 187513
448 Ga0495585_0000212 3300046492 Bacteria 60869
449 Ga0495596_0093232 3300046500 Bacteria 1169
450 Ga0495607_0479038 3300046501 Bacteria 555
451 Ga0495583_0028031 3300046506 Bacteria 2774
452 Ga0495583_0045313 3300046506 Bacteria 2035
453 Ga0495606_0000192 3300046507 Bacteria 107123
454 Ga0495606_0009373 3300046507 Bacteria 8289
455 Ga0495606_0025513 3300046507 Bacteria 4231
456 Ga0495606_0067255 3300046507 Bacteria 2269
457 Ga0495606_0130392 3300046507 Bacteria 1495
458 Ga0495608_0536423 3300046511 Bacteria 706
459 Ga0495610_0001861 3300046512 Bacteria 18285
460 Ga0495610_0002826 3300046512 Bacteria 14145
461 Ga0495616_0003380 3300046513 Bacteria 10230
462 Ga0495616_0004140 3300046513 Bacteria 9192
463 Ga0495616_0293989 3300046513 Bacteria 687
464 Ga0495618_0835435 3300046514 Bacteria 535
465 Ga0495631_0179052 3300046518 Bacteria 908
466 Ga0495632_0170117 3300046519 Bacteria 1001
467 Ga0495637_0062797 3300046520 Bacteria 1519
468 Ga0495644_0015940 3300046523 Bacteria 2879
469 Ga0495648_0004657 3300046524 Bacteria 11632
470 Ga0495663_0102969 3300046525 Bacteria 942
471 Ga0495663_0231890 3300046525 Bacteria 651
472 Ga0495642_0454157 3300046528 Bacteria 566
473 Ga0495652_0242121 3300046529 Bacteria 1341
474 Ga0495654_0011017 3300046530 Bacteria 4910
475 Ga0495609_0004058 3300046538 Bacteria 8162
476 Ga0495609_0203117 3300046538 Bacteria 827
477 Ga0495609_0221602 3300046538 Bacteria 785
478 Ga0495609_0460239 3300046538 Bacteria 505
479 Ga0495622_0042890 3300046557 Bacteria 2103
480 Ga0495622_0152113 3300046557 Bacteria 1047
481 Ga0495633_0000021 3300046558 Bacteria 227171
482 Ga0495633_0024943 3300046558 Bacteria 2949
483 Ga0495633_0040843 3300046558 Bacteria 2208
484 Ga0495633_0103128 3300046558 Bacteria 1324
485 Ga0495668_0000673 3300046616 Bacteria 41193
486 Ga0495668_0059027 3300046616 Bacteria 2117
487 Ga0495668_0105953 3300046616 Bacteria 1538
488 Ga0495634_0112380 3300046642 Bacteria 1751
489 Ga0495625_0000021 3300046660 Bacteria 282133
490 Ga0495625_0032464 3300046660 Bacteria 3869
491 Ga0495625_0062112 3300046660 Bacteria 2641
492 Ga0495625_0074156 3300046660 Bacteria 2384
493 Ga0495625_0118929 3300046660 Bacteria 1800
494 Ga0495661_0000739 3300046665 Bacteria 31861
495 Ga0495661_0008232 3300046665 Bacteria 7223
496 Ga0495661_0214345 3300046665 Bacteria 1001
497 Ga0495661_0223843 3300046665 Bacteria 973
498 Ga0495588_0426941 3300046674 Bacteria 696
499 Ga0495658_0168178 3300046683 Bacteria 1355
500 Ga0495670_0149544 3300046691 Bacteria 1224
501 Ga0495671_0019020 3300046692 Bacteria 3637
502 Ga0495671_0203926 3300046692 Bacteria 959
503 Ga0495649_0000009 3300046694 Bacteria 451725
504 Ga0495649_0057462 3300046694 Bacteria 2098
505 Ga0495600_0235957 3300046809 Bacteria 1166
506 Ga0495660_0022461 3300046810 Bacteria 3603
507 Ga0495660_0110671 3300046810 Bacteria 1402
508 Ga0495660_0256527 3300046810 Bacteria 809
509 Ga0495687_001340 3300047443 Bacteria 22938
510 Ga0495687_012772 3300047443 Bacteria 4421
511 Ga0495673_0102668 3300047469 Bacteria 1153
512 Ga0495681_0152370 3300047470 Bacteria 969
513 Ga0495681_0369971 3300047470 Bacteria 541
514 Ga0495686_0020738 3300047472 Bacteria 4380
515 Ga0495686_0021467 3300047472 Bacteria 4287
516 Ga0495686_0107785 3300047472 Bacteria 1674
517 Ga0495686_0191203 3300047472 Bacteria 1180
518 Ga0495686_0213790 3300047472 Bacteria 1100
519 Ga0495614_0008785 3300048089 Bacteria 4487
520 Ga0496115_0273242 3300048918 Bacteria 1388
521 Ga0496122_0000625 3300048925 Bacteria 72309
522 Ga0496123_0014082 3300048926 Bacteria 6655
523 Ga0496125_0066235 3300048928 Bacteria 2856
524 Ga0496125_0757648 3300048928 Bacteria 508
525 Ga0496126_0140316 3300048929 Bacteria 2081
526 Ga0495682_0004927 3300049460 Bacteria 5621
527 Ga0501312_023765 3300049528 Bacteria 925
528 Ga0501033_0596205 3300049570 Bacteria 758
529 Ga0501223_016850 3300049663 Bacteria 1443
530 nmdc:mga0k408_350_c1 3300050493 Bacteria 25267
531 nmdc:mga0k408_4120_c1 3300050493 Bacteria 7721
532 nmdc:mga0k408_783_c1 3300050493 Bacteria 17509
533 nmdc:mga0k408_803925_c1 3300050493 Bacteria 548
534 nmdc:mga0k408_84967_c1 3300050493 Bacteria 1857
535 nmdc:mga07m45_425651_c1 3300050496 Bacteria 770
536 Ga0500651_0000124 3300053093 Bacteria 47212
537 Ga0500608_057147 3300053122 Bacteria 1869
538 Ga0500608_091902 3300053122 Bacteria 1417
539 Ga0500614_008259 3300053123 Bacteria 2207
540 Ga0500618_000080 3300053125 Bacteria 78455
541 Ga0500618_016552 3300053125 Bacteria 1845
542 Ga0500642_0138252 3300053130 Bacteria 1142
543 Ga0500564_022907 3300053138 Bacteria 2860
544 Ga0500568_0016771 3300053139 Bacteria 3246
545 Ga0500568_0178361 3300053139 Bacteria 781
546 Ga0500573_0238212 3300053140 Bacteria 945
547 Ga0500573_0451304 3300053140 Unclassified 594
548 Ga0500622_0001219 3300053156 Bacteria 21136
549 Ga0500622_0083582 3300053156 Bacteria 1594
550 Ga0500624_000925 3300053157 Bacteria 6183
551 Ga0500634_0149325 3300053161 Bacteria 1095
552 Ga0500634_0182485 3300053161 Bacteria 943
553 Ga0500645_081042 3300053730 Bacteria 926
554 Ga0587073_0184661 3300059492 Bacteria 614
555 2586209101 2585427687 Bacteria 5544917
556 2599479172 2599185184 Bacteria 6430550
557 2738755473 2738541283 Bacteria 7222293
558 2738763465 2738541284 Bacteria 5199923
559 2738851944 2738541302 Bacteria 5944758
560 2739303590 2738543023 Bacteria 6767879
561 2739590832 2739367651 Bacteria 6359826
562 2739617007 2739367656 Bacteria 5152243
563 2739647314 2739367663 Bacteria 5040914
564 2776615097 2775506987 Bacteria 5373360
565 2819546486 2818991437 Bacteria 5805520
566 2842725188 2842722452 Bacteria 6263924
567 2842905886 2842903701 Bacteria 6986368
568 2842912462 2842909656 Bacteria 6185908
569 2849286028 2849281842 Bacteria 6065644
570 2852625302 2852623160 Bacteria 4376875
571 2852629329 2852627209 Bacteria 5896285
572 2857629745 2857627736 Bacteria 5625397
573 2884934315 2884933994 Bacteria 4535041
574 2902052518 2902048731 Bacteria 4976191
575 2904446646 2904445276 Bacteria 5310396
576 2919190332 2919186247 Bacteria 6244071
577 2919438203 2919437846 Bacteria 6199444
578 2928082513 2928078545 Bacteria 6534839
579 2928148899 2928147474 Bacteria 6512076
580 2932086303 2932082852 Bacteria 6563563
581 2939668613 2939664404 Bacteria 6364494
582 2946002109 2945997725 Bacteria 6404843
583 2954019009 2954016120 Bacteria 6446024
584 2977233785 2977232053 Bacteria 5485925
585 8055589530 8055588893 Bacteria 3619545
586 Ga0453684_0961218
587 SwRhRL2b_contig_2336375
588 JGI24736J21556_1015162
589 JGI24737J22298_10000765
590 JGI24743J22301_10006041
591 JGI24735J21928_10000009
592 JGI24738J21930_10124490
593 JGI24744J21845_10005025
594 JGI25162J39368_1000120
595 JGI25162J39368_1001524
596 JGI25157J39369_1006802
597 JGI25164J39214_1000824
598 JGI25152J39213_1000022
599 JGI25152J39213_1025565
600 JGI25150J39212_1000001
601 JGI25151J46595_10000001
602 JGI25165J46597_1000923
603 JGI25153J46596_10000001
604 rootH2_10073704
605 rootL2_10027602
606 rootH1_10055270
607 rootH1_10178994
608 Ga0055525_1021696
609 Ga0055536_1000001
610 Ga0055530_10005254
611 Ga0065714_10009247
612 Ga0065714_10009591
613 Ga0065714_10048636
614 Ga0065714_10068784
615 Ga0065714_10079950
616 Ga0065714_10081513
617 Ga0065714_10105688
618 Ga0065714_10163574
619 Ga0065714_10194457
620 Ga0065714_10403218
621 Ga0065704_10191174
622 Ga0070658_10000014
623 Ga0070658_10125069
624 Ga0070658_10392973
625 Ga0070658_10865239
626 Ga0070676_10004106
627 Ga0070683_100076604
628 Ga0068869_100201652
629 Ga0068869_101476697
630 Ga0070680_100354051
631 Ga0068868_100069307
632 Ga0068868_100526543
633 Ga0070660_100281189
634 Ga0070660_100399152
635 Ga0070660_100559721
636 Ga0070661_100477045
637 Ga0070671_100045108
638 Ga0070674_101827563
639 Ga0070673_100275689
640 Ga0070659_100000402
641 Ga0070659_100051269
642 Ga0070659_100053857
643 Ga0070659_100212416
644 Ga0070663_100714032
645 Ga0070678_100001822
646 Ga0070662_100028795
647 Ga0070681_10008372
648 Ga0068867_100001197
649 Ga0070679_100075612
650 Ga0070679_100190446
651 Ga0070679_101388163
652 Ga0070684_100615661
653 Ga0068853_100136213
654 Ga0068853_100258391
655 Ga0068853_100495081
656 Ga0070665_100000032
657 Ga0068855_100000026
658 Ga0068855_100000248
659 Ga0068855_100091999
660 Ga0068855_100158892
661 Ga0068855_100323950
662 Ga0068855_100479837
663 Ga0068855_100536715
664 Ga0068855_100581028
665 Ga0068855_100859037
666 Ga0068857_100361490
667 Ga0068857_100432210
668 Ga0068854_100201019
669 Ga0068854_100443461
670 Ga0068854_100590861
671 Ga0068856_100000014
672 Ga0068856_100003360
673 Ga0068856_100166735
674 Ga0068856_100401913
675 Ga0068856_100439140
676 Ga0068856_101104002
677 Ga0068856_101264970
678 Ga0068856_101274110
679 Ga0068856_102401301
680 Ga0068852_100004662
681 Ga0068866_10188181
682 Ga0068851_10498792
683 Ga0068863_100323149
684 Ga0068858_100191651
685 Ga0075366_10000812
686 Ga0075366_10020556
687 Ga0075366_10132436
688 Ga0075366_10134629
689 Ga0097621_100000057
690 Ga0068871_100000094
691 Ga0068871_100675472
692 Ga0068865_100000200
693 Ga0105251_10222038
694 Ga0105240_10026059
695 Ga0105240_10054975
696 Ga0105240_10094952
697 Ga0105240_10184187
698 Ga0105240_10290440
699 Ga0105240_10368662
700 Ga0105240_10411293
701 Ga0105240_11099934
702 Ga0105240_11127679
703 Ga0105240_11504042
704 Ga0105240_12648945
705 Ga0105245_10053242
706 Ga0105243_10234425
707 Ga0105241_10095212
708 Ga0105241_10471573
709 Ga0105241_10983314
710 Ga0105241_11060459
711 Ga0105242_10050379
712 Ga0105237_10001287
713 Ga0105237_10001321
714 Ga0105237_10005754
715 Ga0105237_10009919
716 Ga0105237_10012788
717 Ga0105237_10085054
718 Ga0105237_10417275
719 Ga0105237_10559743
720 Ga0105237_12300600
721 Ga0105238_10003742
722 Ga0105238_10318704
723 Ga0105238_10523618
724 Ga0105238_11302770
725 Ga0105239_10000001
726 Ga0105239_10001363
727 Ga0105239_10005053
728 Ga0105239_10128692
729 Ga0105239_10254445
730 Ga0105239_10259255
731 Ga0105239_10848564
732 Ga0105239_11336734
733 Ga0105239_11631516
734 Ga0157373_10000175
735 Ga0157373_10001983
736 Ga0157373_10002244
737 Ga0157373_10024499
738 Ga0157373_10095040
739 Ga0157373_10162221
740 Ga0157371_10000276
741 Ga0157371_10074928
742 Ga0157371_10939929
743 Ga0157370_10000304
744 Ga0157370_10066375
745 Ga0157370_10105905
746 Ga0157370_10135449
747 Ga0157370_10238451
748 Ga0157370_10529511
749 Ga0157370_10532559
750 Ga0157370_11297375
751 Ga0157369_10000040
752 Ga0157369_10063032
753 Ga0157369_10459556
754 Ga0157374_10142191
755 Ga0157374_10297971
756 Ga0157374_10625250
757 Ga0157378_10072796
758 Ga0157378_10117838
759 Ga0157378_10529425
760 Ga0157378_10604465
761 Ga0163162_10000052
762 Ga0163162_10004554
763 Ga0163162_10021730
764 Ga0163162_10157628
765 Ga0163162_10213814
766 Ga0163162_10880030
767 Ga0157372_10004038
768 Ga0157372_10015618
769 Ga0157372_10042429
770 Ga0157372_10087965
771 Ga0157372_10540873
772 Ga0157372_10691273
773 Ga0157372_10743257
774 Ga0157372_10917045
775 Ga0157372_11712258
776 Ga0157375_10052289
777 Ga0157375_10130777
778 Ga0157375_10516808
779 Ga0157375_11060989
780 Ga0157375_11978684
781 Ga0163163_10781318
782 Ga0163163_10837569
783 Ga0182008_10000030
784 Ga0182008_10006118
785 Ga0182008_10100478
786 Ga0182008_10250036
787 Ga0182008_10332023
788 Ga0182008_10447756
789 Ga0157377_10142532
790 Ga0157376_10095846
791 Ga0157376_11382274
792 Ga0182006_1000872
793 Ga0182006_1002415
794 Ga0182006_1012527
795 Ga0182006_1020484
796 Ga0182006_1033008
797 Ga0182006_1111881
798 Ga0182007_10000003
799 Ga0182007_10058721
800 Ga0182007_10122369
801 Ga0183373_1001
802 Ga0163161_10006390
803 Ga0163161_10031402
804 Ga0163161_10060117
805 Ga0163161_10341896
806 Ga0163161_10461595
807 Ga0163161_10488963
808 Ga0163161_10512550
809 Ga0163161_10564503
810 Ga0163161_11045943
811 Ga0163161_11235625
812 Ga0197907_10460860
813 Ga0206356_11665215
814 Ga0206349_1885028
815 Ga0206351_10089304
816 Ga0206351_10092710
817 Ga0206351_10266683
818 Ga0206352_10142629
819 Ga0206352_10302237
820 Ga0206352_10549549
821 Ga0206352_10821137
822 Ga0206352_10983977
823 Ga0206352_11278938
824 Ga0206350_10940241
825 Ga0206350_11373609
826 Ga0206354_10096798
827 Ga0206354_10195354
828 Ga0206353_11414568
829 Ga0206353_11487520
830 Ga0154015_1145674
831 Ga0154015_1323334
832 Ga0224712_10434447
833 Ga0224712_10456144
834 Ga0224712_10473535
835 Ga0209563_116042
836 Ga0207427_100236
837 Ga0209437_100034
838 Ga0209437_100143
839 Ga0207425_1000002
840 Ga0209026_1000663
841 Ga0209026_1009640
842 Ga0209026_1024642
843 Ga0209026_1033005
844 Ga0209148_1034014
845 Ga0209129_1000002
846 Ga0209129_1005110
847 Ga0209233_1000038
848 Ga0209233_1011941
849 Ga0209233_1053621
850 Ga0209676_1000008
851 Ga0209025_1000004
852 Ga0209758_1000006
853 Ga0209050_1000045
854 Ga0207655_1111463
855 Ga0207642_10130757
856 Ga0207647_10008662
857 Ga0207647_10043409
858 Ga0207647_10063624
859 Ga0207645_10002281
860 Ga0207705_10000043
861 Ga0207705_10182796
862 Ga0207705_10333291
863 Ga0207705_10526257
864 Ga0207654_10137114
865 Ga0207654_10440269
866 Ga0207707_10051151
867 Ga0207695_10000053
868 Ga0207695_10020448
869 Ga0207695_10029659
870 Ga0207695_10237410
871 Ga0207695_10414277
872 Ga0207695_10883081
873 Ga0207695_11085969
874 Ga0207695_11508429
875 Ga0207671_10002398
876 Ga0207671_10002869
877 Ga0207671_10003823
878 Ga0207671_10005821
879 Ga0207671_10022025
880 Ga0207671_10228993
881 Ga0207671_10375027
882 Ga0207671_10764258
883 Ga0207671_11534813
884 Ga0207660_10025593
885 Ga0207660_11071074
886 Ga0207657_10242923
887 Ga0207657_10344371
888 Ga0207657_10353850
889 Ga0207657_10512752
890 Ga0207652_10026145
891 Ga0207652_10158506
892 Ga0207652_11140492
893 Ga0207694_10348023
894 Ga0207694_10430858
895 Ga0207694_10725714
896 Ga0207644_10010204
897 Ga0207690_10000365
898 Ga0207690_10003759
899 Ga0207690_10526296
900 Ga0207706_10000057
901 Ga0207686_10192197
902 Ga0207709_10502264
903 Ga0207669_11592111
904 Ga0207704_10000052
905 Ga0207691_10964729
906 Ga0207689_10171808
907 Ga0207661_10057095
908 Ga0207667_10000022
909 Ga0207667_10001325
910 Ga0207667_10037152
911 Ga0207667_10087032
912 Ga0207667_10113392
913 Ga0207667_10492506
914 Ga0207651_10033272
915 Ga0207640_10176046
916 Ga0207640_10264718
917 Ga0207677_10091875
918 Ga0207677_10908778
919 Ga0207703_10477102
920 Ga0207703_11232452
921 Ga0207639_10050764
922 Ga0207639_10123676
923 Ga0207639_10159488
924 Ga0207639_11057669
925 Ga0207678_10224897
926 Ga0207702_10000036
927 Ga0207702_10251539
928 Ga0207702_10292030
929 Ga0207702_10919390
930 Ga0207702_11075908
931 Ga0207702_12456107
932 Ga0207641_11714374
933 Ga0207648_10002788
934 Ga0207674_10154666
935 Ga0207674_11408945
936 Ga0207674_12076698
937 Ga0207683_10010796
938 Ga0207698_10016030
939 Ga0207698_11275593
940 Ga0268266_10000030
941 Ga0268264_10514910
942 Ga0307517_10006168
943 Ga0307515_10008566
944 Ga0307515_10082620
945 Ga0307515_10225522
946 Ga0265338_10020274
947 Ga0265338_10447517
948 Ga0316177_1003967
949 Ga0316177_1067224
950 Ga0316176_1180404
951 Ga0314311_1167977
952 Ga0316183_1095896
953 Ga0316181_1084669
954 Ga0316181_1158926
955 Ga0316182_1114895
956 Ga0265331_10391384
957 Ga0265327_10093580
958 Ga0265327_10283837
959 Ga0265327_10346580
960 Ga0307513_10601182
961 Ga0307408_100011421
962 Ga0307408_100091936
963 Ga0307408_100092560
964 Ga0307408_100699407
965 Ga0307516_10594031
966 Ga0307405_10000003
967 Ga0307405_11577215
968 Ga0307413_11140610
969 Ga0307407_10000030
970 Ga0307407_10952751
971 Ga0307412_10000065
972 Ga0307412_10000925
973 Ga0307412_10007236
974 Ga0307412_10294865
975 Ga0307412_10301438
976 Ga0307412_10444528
977 Ga0307412_10650225
978 Ga0307412_11079457
979 Ga0307412_11148350
980 Ga0307409_100120979
981 Ga0307409_102809568
982 Ga0307416_100000014
983 Ga0307416_100244859
984 Ga0307414_10005403
985 Ga0307414_10026048
986 Ga0307414_10299547
987 Ga0307414_10305330
988 Ga0307414_10321906
989 Ga0307414_10406717
990 Ga0307414_10722447
991 Ga0307414_10884995
992 Ga0307414_11204325
993 Ga0307411_10520625
994 Ga0307411_11046861
995 Ga0307507_10000032
996 Ga0307510_10005905
997 Ga0373941_0107642
998 Ga0373925_1636913
999 Ga0395899_0000002
1000 Ga0395899_0012421
1001 Ga0395899_0047989
1002 Ga0395900_0000143
1003 Ga0395900_0000285
1004 Ga0395900_0513616
1005 Ga0395898_0008044
1006 Ga0395898_0245430
1007 Ga0395905_0000045
1008 Ga0395905_0000765
1009 Ga0395901_0002501
1010 Ga0395901_0035978
1011 Ga0436361_0542797
1012 Ga0439439_0186357
1013 Ga0451797_0777216
1014 Ga0451807_1592925
1015 Ga0451807_1852552
1016 Ga0451807_1966145
1017 Ga0451841_0449127
1018 Ga0451843_0191440
1019 Ga0451843_1497749
1020 Ga0439448_0000810
1021 Ga0439455_0043498
1022 Ga0466968_0074554
1023 Ga0495627_045542
1024 Ga0495627_122578
1025 Ga0495629_0085265
1026 Ga0495638_0110069
1027 Ga0495651_0078117
1028 Ga0495650_0000594
1029 Ga0495650_0057227
1030 Ga0495650_0214981
1031 Ga0495605_0122970
1032 Ga0495585_0000014
1033 Ga0495585_0000212
1034 Ga0495596_0093232
1035 Ga0495607_0479038
1036 Ga0495583_0028031
1037 Ga0495583_0045313
1038 Ga0495606_0000192
1039 Ga0495606_0009373
1040 Ga0495606_0025513
1041 Ga0495606_0067255
1042 Ga0495606_0130392
1043 Ga0495608_0536423
1044 Ga0495610_0001861
1045 Ga0495610_0002826
1046 Ga0495616_0003380
1047 Ga0495616_0004140
1048 Ga0495616_0293989
1049 Ga0495618_0835435
1050 Ga0495631_0179052
1051 Ga0495632_0170117
1052 Ga0495637_0062797
1053 Ga0495644_0015940
1054 Ga0495648_0004657
1055 Ga0495663_0102969
1056 Ga0495663_0231890
1057 Ga0495642_0454157
1058 Ga0495652_0242121
1059 Ga0495654_0011017
1060 Ga0495609_0004058
1061 Ga0495609_0203117
1062 Ga0495609_0221602
1063 Ga0495609_0460239
1064 Ga0495622_0042890
1065 Ga0495622_0152113
1066 Ga0495633_0000021
1067 Ga0495633_0024943
1068 Ga0495633_0040843
1069 Ga0495633_0103128
1070 Ga0495668_0000673
1071 Ga0495668_0059027
1072 Ga0495668_0105953
1073 Ga0495634_0112380
1074 Ga0495625_0000021
1075 Ga0495625_0032464
1076 Ga0495625_0062112
1077 Ga0495625_0074156
1078 Ga0495625_0118929
1079 Ga0495661_0000739
1080 Ga0495661_0008232
1081 Ga0495661_0214345
1082 Ga0495661_0223843
1083 Ga0495588_0426941
1084 Ga0495658_0168178
1085 Ga0495670_0149544
1086 Ga0495671_0019020
1087 Ga0495671_0203926
1088 Ga0495649_0000009
1089 Ga0495649_0057462
1090 Ga0495600_0235957
1091 Ga0495660_0022461
1092 Ga0495660_0110671
1093 Ga0495660_0256527
1094 Ga0495687_001340
1095 Ga0495687_012772
1096 Ga0495673_0102668
1097 Ga0495681_0152370
1098 Ga0495681_0369971
1099 Ga0495686_0020738
1100 Ga0495686_0021467
1101 Ga0495686_0107785
1102 Ga0495686_0191203
1103 Ga0495686_0213790
1104 Ga0495614_0008785
1105 Ga0496115_0273242
1106 Ga0496122_0000625
1107 Ga0496123_0014082
1108 Ga0496125_0066235
1109 Ga0496125_0757648
1110 Ga0496126_0140316
1111 Ga0495682_0004927
1112 Ga0501312_023765
1113 Ga0501033_0596205
1114 Ga0501223_016850
1115 nmdc:mga0k408_350_c1
1116 nmdc:mga0k408_4120_c1
1117 nmdc:mga0k408_783_c1
1118 nmdc:mga0k408_803925_c1
1119 nmdc:mga0k408_84967_c1
1120 nmdc:mga07m45_425651_c1
1121 Ga0500651_0000124
1122 Ga0500608_057147
1123 Ga0500608_091902
1124 Ga0500614_008259
1125 Ga0500618_000080
1126 Ga0500618_016552
1127 Ga0500642_0138252
1128 Ga0500564_022907
1129 Ga0500568_0016771
1130 Ga0500568_0178361
1131 Ga0500573_0238212
1132 Ga0500573_0451304
1133 Ga0500622_0001219
1134 Ga0500622_0083582
1135 Ga0500624_000925
1136 Ga0500634_0149325
1137 Ga0500634_0182485
1138 Ga0500645_081042
1139 Ga0587073_0184661
1140 2586209101
1141 2599479172
1142 2738755473
1143 2738763465
1144 2738851944
1145 2739303590
1146 2739590832
1147 2739617007
1148 2739647314
1149 2776615097
1150 2819546486
1151 2842725188
1152 2842905886
1153 2842912462
1154 2849286028
1155 2852625302
1156 2852629329
1157 2857629745
1158 2884934315
1159 2902052518
1160 2904446646
1161 2919190332
1162 2919438203
1163 2928082513
1164 2928148899
1165 2932086303
1166 2939668613
1167 2946002109
1168 2954019009
1169 2977233785
1170 8055589530

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02482

Ribosomal_S30AE

Sigma 54 modulation protein / S30EA ribosomal protein

3

97

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hei-assembly1.cif.gz_A 2a x-ray structure of hpf from vibrio cholerae 0.9159 1 95
6h4n-assembly1.cif.gz_x structure of a hibernating 100s ribosome reveals an inactive conformation of the ribosomal protein s1 - 70s hibernating e. coli ribosome 0.9156 1 97
4v8h-assembly2.cif.gz_CX crystal structure of hpf bound to the 70s ribosome. 0.9001 1 97
3tqm-assembly1.cif.gz_A structure of an ribosomal subunit interface protein from coxiella burnetii 0.899 1 94
4hei-assembly1.cif.gz_A 2a x-ray structure of hpf from vibrio cholerae 0.8976 1 95
ID Description Score Start End Superfamily
3v26X00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.8961 1 97 3.30.160.100
1n3gA01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.8867 1 91 3.30.160.100
af_O05886_21_120_3.30.160.100 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.872 3 98 3.30.160.100
3v26X00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.8704 1 97 3.30.160.100
3tqmD00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.8584 4 95 3.30.160.100
ID Description Score Start End GO Terms
AF-R7J4M2-F1-model_v4 Ribosomal subunit interface protein 0.9481 1 96
AF-A0A522F1E0-F1-model_v4 Ribosome-associated translation inhibitor RaiA 0.9463 1 101
AF-X1LU55-F1-model_v4 Ribosomal subunit interface protein 0.9439 32 97
AF-A0A2U2PCI5-F1-model_v4 Ribosome-associated translation inhibitor RaiA 0.9434 1 97
AF-A0A1J1ECT7-F1-model_v4 Ribosome hibernation protein YhbH 0.9415 21 97

Map