F466478

General Info

Members Datasets Scaffolds Average Seq Length
585 197 1170 334

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_004095|Ga0495627_004095_4344_5498
Length 373
Sequence LAEISVEFIKFICIVMRARNDVADSGALAHKFVRIARSGMNNQSAPQSASHPFSRLDPVMVLDAVESVGLRGDGRLLALNSYENRVYRVGREEGQPVVVKFYRPERWSDAAILEEHAFTQELAEQEVPVVPARVLDGRTLHEFGGFRFAVFPSRGGRAPELSDPKVLEWIGRFIGRIHALGSTRTFQERPALNLDTFGREPRAWLIGHGFIPHELLTAYASVIDQALDGVARCFERAGELPLLRLHGDCHAGNVLWTGDGPHFVDFDDSRMGPAVQDLWMLLSGERQEMVRQLGDVLAGYEDFCEFDPRQLHLVEALRTLRLIHYSAWLAMRWDDPAFPAAFPWFNTQRYWQDRILELREQVALMDEPPLWPV

Samples

Sample ID Description Type Environment
1 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
17 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
25 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
26 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
27 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
30 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
44 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
45 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
46 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
47 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
54 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
55 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
56 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
63 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
64 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
65 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
66 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
67 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
83 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
84 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
85 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
101 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
108 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
109 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
137 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
151 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
152 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
153 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
154 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
159 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
178 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
184 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
185 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
186 2643221556 Massilia sp. Root1485 Isolate Unclassified
187 2643221645 Massilia sp. Root351 Isolate Unclassified
188 2643221664 Massilia sp. Root418 Isolate Unclassified
189 2643221684 Massilia sp. Root133 Isolate Unclassified
190 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
191 2842711865 Duganella sp. R-73148 Isolate Unclassified
192 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
193 2857558681 Duganella sp. R-74565 Isolate Unclassified
194 2857564685 Duganella sp. R-74599 Isolate Unclassified
195 2904424332 Duganella sp. 1411 Isolate Rhizosphere
196 2919476304 Duganella sp. 3397 Isolate Unclassified
197 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 0
Isolates 2.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.76
Nodule 0.51
Rhizoplane 4.79
Rhizosphere 87.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495627_004095 3300046453 Bacteria 6201
2 rootL2_10091315 3300003322 Bacteria 2271
3 Ga0055525_1000029 3300003759 Bacteria 320663
4 Ga0055529_1000241 3300003763 Bacteria 68092
5 Ga0055526_1001163 3300003771 Bacteria 19080
6 Ga0055537_1000678 3300003773 Bacteria 17886
7 Ga0055524_1000021 3300003775 Bacteria 227578
8 Ga0055524_1015227 3300003775 Bacteria 2814
9 Ga0055534_1000195 3300003784 Bacteria 44284
10 Ga0055528_1000368 3300003790 Bacteria 36674
11 Ga0065165_1003109 3300005262 Bacteria 12326
12 Ga0070658_10279643 3300005327 Bacteria 1420
13 Ga0070660_100027603 3300005339 Bacteria 4238
14 Ga0070660_100033888 3300005339 Bacteria 3853
15 Ga0070661_100036428 3300005344 Bacteria 3576
16 Ga0070659_100033466 3300005366 Bacteria 3992
17 Ga0070659_100120505 3300005366 Bacteria 2124
18 Ga0070664_100063058 3300005564 Bacteria 3160
19 Ga0070664_100088507 3300005564 Bacteria 2677
20 Ga0079104_1007704 3300006946 Bacteria 3858
21 Ga0099826_10000041 3300006948 Bacteria 96536
22 Ga0105244_10002445 3300009036 Bacteria 14001
23 Ga0105245_10080211 3300009098 Bacteria 2981
24 Ga0105241_10042626 3300009174 Bacteria 3435
25 Ga0105242_10279443 3300009176 Bacteria 1516
26 Ga0157371_10000013 3300013102 Bacteria 352631
27 Ga0157372_10151971 3300013307 Bacteria 2672
28 Ga0182006_1000092 3300015261 Bacteria 106896
29 Ga0182005_1000041 3300015265 Bacteria 150123
30 Ga0213872_10000242 3300021361 Bacteria 48194
31 Ga0213872_10000443 3300021361 Bacteria 33899
32 Ga0213872_10000548 3300021361 Bacteria 29224
33 Ga0213872_10002124 3300021361 Bacteria 11925
34 Ga0213872_10011044 3300021361 Bacteria 4282
35 Ga0213872_10033643 3300021361 Bacteria 2349
36 Ga0209563_100003 3300025230 Bacteria 1932942
37 Ga0209677_107503 3300025253 Bacteria 2301
38 Ga0209565_1000015 3300025263 Bacteria 494091
39 Ga0209455_1000169 3300025272 Bacteria 111454
40 Ga0209673_1000394 3300025273 Bacteria 78048
41 Ga0209675_1000012 3300025291 Bacteria 494061
42 Ga0209564_1000016 3300025295 Bacteria 613131
43 Ga0209256_1000044 3300025299 Bacteria 337264
44 Ga0209256_1000076 3300025299 Bacteria 234735
45 Ga0207655_1009887 3300025728 Bacteria 5868
46 Ga0207654_10029179 3300025911 Bacteria 3016
47 Ga0207657_10003410 3300025919 Bacteria 16962
48 Ga0207657_10068200 3300025919 Bacteria 3022
49 Ga0207657_10079536 3300025919 Bacteria 2758
50 Ga0207690_10037418 3300025932 Bacteria 3150
51 Ga0207690_10037764 3300025932 Bacteria 3138
52 Ga0207686_10056504 3300025934 Bacteria 2467
53 Ga0207679_10031437 3300025945 Bacteria 3716
54 Ga0207667_10190594 3300025949 Bacteria 2104
55 Ga0207674_10141098 3300026116 Bacteria 2369
56 Ga0209282_1000001 3300027666 Bacteria 2450367
57 Ga0307515_10109177 3300028794 Bacteria 3252
58 Ga0265324_10011602 3300029957 Bacteria 3355
59 Ga0316182_1220977 3300030745 Bacteria 4114
60 Ga0265325_10032631 3300031241 Bacteria 2779
61 Ga0265327_10006962 3300031251 Bacteria 8880
62 Ga0307408_100000423 3300031548 Bacteria 37953
63 Ga0265314_10011446 3300031711 Bacteria 7323
64 Ga0307518_10189718 3300031838 Bacteria 1379
65 Ga0307412_10086114 3300031911 Bacteria 2186
66 Ga0316583_10001166 3300032133 Bacteria 8606
67 Ga0316574_0204126 3300035398 Bacteria 1269
68 Ga0316582_0000750 3300036647 Bacteria 13003
69 Ga0316582_0233968 3300036647 Bacteria 1258
70 Ga0316584_0031987 3300036712 Bacteria 3892
71 Ga0395899_0000128 3300037312 Bacteria 119014
72 Ga0395899_0009960 3300037312 Bacteria 7289
73 Ga0395899_0038303 3300037312 Bacteria 3591
74 Ga0395899_0067963 3300037312 Bacteria 2614
75 Ga0395899_0124413 3300037312 Bacteria 1844
76 Ga0395899_0286220 3300037312 Bacteria 1119
77 Ga0395900_0000123 3300037418 Bacteria 133326
78 Ga0395900_0013281 3300037418 Bacteria 8419
79 Ga0395900_0018262 3300037418 Bacteria 7153
80 Ga0395900_0228517 3300037418 Bacteria 1872
81 Ga0395900_0249539 3300037418 Bacteria 1776
82 Ga0395898_0083628 3300037466 Bacteria 3076
83 Ga0395898_0102917 3300037466 Bacteria 2740
84 Ga0395898_0177233 3300037466 Bacteria 2037
85 Ga0395905_0340224 3300037471 Bacteria 1391
86 Ga0395901_0000411 3300038443 Bacteria 50643
87 Ga0395901_0001908 3300038443 Bacteria 21493
88 Ga0395901_0115112 3300038443 Bacteria 2824
89 Ga0395901_0360359 3300038443 Bacteria 1499
90 Ga0395901_0477227 3300038443 Bacteria 1272
91 Ga0436361_0215773 3300039447 Bacteria 1887
92 Ga0436361_0344800 3300039447 Bacteria 62567
93 Ga0436361_0568335 3300039447 Bacteria 14489
94 Ga0436361_0568983 3300039447 Bacteria 33450
95 Ga0436361_0726469 3300039447 Bacteria 8063
96 Ga0436361_0755334 3300039447 Bacteria 3261
97 Ga0436361_0830100 3300039447 Bacteria 16365
98 Ga0436361_0896671 3300039447 Bacteria 6189
99 Ga0439448_0000310 3300042005 Bacteria 10761
100 Ga0439449_0016013 3300042007 Bacteria 2819
101 Ga0439450_002028 3300042008 Bacteria 3106
102 Ga0439450_020164 3300042008 Bacteria 1420
103 Ga0439455_0000807 3300042012 Bacteria 4757
104 Ga0439455_0036765 3300042012 Bacteria 1240
105 Ga0450904_000276 3300042139 Bacteria 11138
106 Ga0451577_0000002 3300042876 Bacteria 1731375
107 Ga0451577_0005466 3300042876 Bacteria 13015
108 Ga0451577_0006084 3300042876 Bacteria 12133
109 Ga0451577_0025215 3300042876 Bacteria 5397
110 Ga0451577_0035337 3300042876 Bacteria 4502
111 Ga0466969_0039933 3300044656 Bacteria 2354
112 Ga0466972_0001100 3300044658 Bacteria 12928
113 Ga0453683_0000011 3300044673 Bacteria 412765
114 Ga0466966_0022882 3300044684 Bacteria 4094
115 Ga0466966_0023814 3300044684 Bacteria 4006
116 Ga0466966_0028009 3300044684 Bacteria 3671
117 Ga0466963_0068195 3300044694 Bacteria 2388
118 Ga0466964_0000019 3300044706 Bacteria 35345
119 Ga0466964_0021405 3300044706 Bacteria 2500
120 Ga0453684_0000002 3300044712 Bacteria 1731375
121 Ga0453684_0000040 3300044712 Bacteria 690210
122 Ga0453684_0022026 3300044712 Bacteria 9480
123 Ga0466968_0003740 3300044735 Bacteria 5640
124 Ga0466957_0000079 3300044842 Bacteria 38733
125 Ga0466957_0021135 3300044842 Bacteria 3833
126 Ga0466959_0023505 3300045049 Bacteria 4560
127 Ga0466959_0051925 3300045049 Bacteria 3004
128 Ga0451576_0000004 3300045051 Bacteria 1312238
129 Ga0451576_0010263 3300045051 Bacteria 10762
130 Ga0451576_0103830 3300045051 Bacteria 2956
131 Ga0466958_0127484 3300045836 Bacteria 1596
132 Ga0466967_0009357 3300045976 Bacteria 7265
133 Ga0466967_0054618 3300045976 Bacteria 3516
134 Ga0495617_000034 3300046452 Bacteria 147232
135 Ga0495617_004142 3300046452 Bacteria 5316
136 Ga0495627_000088 3300046453 Bacteria 110479
137 Ga0495627_000876 3300046453 Bacteria 21280
138 Ga0495603_0035257 3300046455 Bacteria 3005
139 Ga0495590_0000301 3300046457 Bacteria 26015
140 Ga0495590_0010638 3300046457 Bacteria 3450
141 Ga0495590_0041609 3300046457 Bacteria 1602
142 Ga0495591_000272 3300046458 Bacteria 48725
143 Ga0495591_025006 3300046458 Bacteria 1880
144 Ga0495629_0032946 3300046459 Bacteria 3666
145 Ga0495629_0188143 3300046459 Bacteria 1429
146 Ga0495638_0025297 3300046460 Bacteria 3861
147 Ga0495653_0038249 3300046463 Bacteria 3766
148 Ga0495653_0162464 3300046463 Bacteria 1549
149 Ga0495650_0000011 3300046471 Bacteria 615329
150 Ga0495650_0000715 3300046471 Bacteria 42328
151 Ga0495650_0000833 3300046471 Bacteria 37204
152 Ga0495650_0008949 3300046471 Bacteria 5761
153 Ga0495650_0018004 3300046471 Bacteria 3524
154 Ga0495582_0006238 3300046473 Bacteria 6641
155 Ga0495582_0076221 3300046473 Bacteria 1858
156 Ga0495582_0119670 3300046473 Bacteria 1483
157 Ga0495605_0000029 3300046474 Bacteria 215329
158 Ga0495605_0000042 3300046474 Bacteria 185225
159 Ga0495605_0000151 3300046474 Bacteria 89442
160 Ga0495605_0015901 3300046474 Bacteria 4083
161 Ga0495605_0016427 3300046474 Bacteria 4007
162 Ga0495605_0028035 3300046474 Bacteria 2910
163 Ga0495605_0053256 3300046474 Bacteria 1963
164 Ga0495605_0098002 3300046474 Bacteria 1351
165 Ga0495664_0184168 3300046477 Bacteria 1266
166 Ga0495584_0000007 3300046491 Bacteria 294820
167 Ga0495584_0000122 3300046491 Bacteria 53611
168 Ga0495584_0001731 3300046491 Bacteria 12757
169 Ga0495584_0001760 3300046491 Bacteria 12632
170 Ga0495584_0003043 3300046491 Bacteria 9305
171 Ga0495584_0003797 3300046491 Bacteria 8222
172 Ga0495584_0005904 3300046491 Bacteria 6452
173 Ga0495584_0010194 3300046491 Bacteria 4825
174 Ga0495584_0030895 3300046491 Bacteria 2711
175 Ga0495584_0046126 3300046491 Bacteria 2198
176 Ga0495584_0047064 3300046491 Bacteria 2175
177 Ga0495584_0089861 3300046491 Bacteria 1548
178 Ga0495584_0096039 3300046491 Bacteria 1496
179 Ga0495585_0000115 3300046492 Bacteria 86460
180 Ga0495585_0000421 3300046492 Bacteria 40862
181 Ga0495585_0000685 3300046492 Bacteria 30770
182 Ga0495585_0003326 3300046492 Bacteria 10911
183 Ga0495585_0007344 3300046492 Bacteria 6754
184 Ga0495585_0008609 3300046492 Bacteria 6177
185 Ga0495585_0026350 3300046492 Bacteria 3320
186 Ga0495585_0033061 3300046492 Bacteria 2929
187 Ga0495585_0057280 3300046492 Bacteria 2151
188 Ga0495585_0062557 3300046492 Bacteria 2044
189 Ga0495585_0079196 3300046492 Bacteria 1782
190 Ga0495594_0004505 3300046499 Bacteria 7166
191 Ga0495594_0026592 3300046499 Bacteria 3114
192 Ga0495594_0146173 3300046499 Bacteria 1341
193 Ga0495596_0000100 3300046500 Bacteria 60871
194 Ga0495596_0000788 3300046500 Bacteria 19249
195 Ga0495596_0001426 3300046500 Bacteria 13714
196 Ga0495596_0003602 3300046500 Bacteria 7785
197 Ga0495596_0005103 3300046500 Bacteria 6258
198 Ga0495596_0007052 3300046500 Bacteria 5096
199 Ga0495596_0008662 3300046500 Bacteria 4511
200 Ga0495596_0011070 3300046500 Bacteria 3904
201 Ga0495596_0020070 3300046500 Bacteria 2737
202 Ga0495596_0027262 3300046500 Bacteria 2298
203 Ga0495607_0001671 3300046501 Bacteria 19192
204 Ga0495607_0001966 3300046501 Bacteria 17334
205 Ga0495607_0002609 3300046501 Bacteria 14481
206 Ga0495607_0002735 3300046501 Bacteria 14072
207 Ga0495607_0007976 3300046501 Bacteria 7277
208 Ga0495607_0008406 3300046501 Bacteria 7057
209 Ga0495607_0021129 3300046501 Bacteria 4098
210 Ga0495607_0046732 3300046501 Bacteria 2539
211 Ga0495607_0052595 3300046501 Bacteria 2358
212 Ga0495607_0052871 3300046501 Bacteria 2350
213 Ga0495607_0081532 3300046501 Bacteria 1777
214 Ga0495583_0000337 3300046506 Bacteria 73928
215 Ga0495583_0000440 3300046506 Bacteria 62422
216 Ga0495583_0000569 3300046506 Bacteria 50860
217 Ga0495583_0001444 3300046506 Bacteria 24128
218 Ga0495583_0001752 3300046506 Bacteria 20707
219 Ga0495583_0003097 3300046506 Bacteria 13150
220 Ga0495583_0006264 3300046506 Bacteria 7824
221 Ga0495583_0006625 3300046506 Bacteria 7522
222 Ga0495583_0017488 3300046506 Bacteria 3803
223 Ga0495583_0035796 3300046506 Bacteria 2366
224 Ga0495583_0038035 3300046506 Bacteria 2276
225 Ga0495606_0000680 3300046507 Bacteria 53232
226 Ga0495606_0000787 3300046507 Bacteria 48504
227 Ga0495606_0001513 3300046507 Bacteria 30823
228 Ga0495606_0001634 3300046507 Bacteria 29214
229 Ga0495606_0008010 3300046507 Bacteria 9284
230 Ga0495606_0015409 3300046507 Bacteria 5890
231 Ga0495606_0034452 3300046507 Bacteria 3476
232 Ga0495606_0054716 3300046507 Bacteria 2584
233 Ga0495606_0059833 3300046507 Bacteria 2442
234 Ga0495610_0000473 3300046512 Bacteria 41477
235 Ga0495610_0001681 3300046512 Bacteria 19429
236 Ga0495610_0020061 3300046512 Bacteria 3721
237 Ga0495610_0023295 3300046512 Bacteria 3370
238 Ga0495610_0029498 3300046512 Bacteria 2887
239 Ga0495616_0000073 3300046513 Bacteria 85397
240 Ga0495616_0001479 3300046513 Bacteria 16296
241 Ga0495616_0004367 3300046513 Bacteria 8921
242 Ga0495616_0004509 3300046513 Bacteria 8764
243 Ga0495616_0006098 3300046513 Bacteria 7345
244 Ga0495616_0006280 3300046513 Bacteria 7212
245 Ga0495616_0006386 3300046513 Bacteria 7137
246 Ga0495616_0026013 3300046513 Bacteria 3119
247 Ga0495616_0031092 3300046513 Bacteria 2799
248 Ga0495616_0046823 3300046513 Bacteria 2181
249 Ga0495616_0064173 3300046513 Bacteria 1792
250 Ga0495616_0071753 3300046513 Bacteria 1673
251 Ga0495620_0030810 3300046515 Bacteria 2465
252 Ga0495631_0000550 3300046518 Bacteria 25263
253 Ga0495631_0001566 3300046518 Bacteria 13727
254 Ga0495631_0001683 3300046518 Bacteria 13154
255 Ga0495631_0008347 3300046518 Bacteria 5219
256 Ga0495631_0015665 3300046518 Bacteria 3627
257 Ga0495631_0016187 3300046518 Bacteria 3560
258 Ga0495631_0034252 3300046518 Bacteria 2277
259 Ga0495632_0000027 3300046519 Bacteria 173785
260 Ga0495632_0000193 3300046519 Bacteria 61596
261 Ga0495632_0000852 3300046519 Bacteria 26846
262 Ga0495632_0000903 3300046519 Bacteria 26010
263 Ga0495632_0001985 3300046519 Bacteria 16245
264 Ga0495632_0031524 3300046519 Bacteria 2739
265 Ga0495632_0035891 3300046519 Bacteria 2525
266 Ga0495632_0039912 3300046519 Bacteria 2366
267 Ga0495637_0000013 3300046520 Bacteria 244837
268 Ga0495637_0000114 3300046520 Bacteria 58485
269 Ga0495637_0005012 3300046520 Bacteria 6809
270 Ga0495643_0000157 3300046522 Bacteria 110922
271 Ga0495643_0000633 3300046522 Bacteria 41677
272 Ga0495643_0002412 3300046522 Bacteria 14864
273 Ga0495643_0013091 3300046522 Bacteria 4982
274 Ga0495643_0035151 3300046522 Bacteria 2760
275 Ga0495643_0041065 3300046522 Bacteria 2523
276 Ga0495643_0057173 3300046522 Bacteria 2079
277 Ga0495644_0001376 3300046523 Bacteria 9934
278 Ga0495644_0006526 3300046523 Bacteria 4516
279 Ga0495644_0007100 3300046523 Bacteria 4333
280 Ga0495644_0019040 3300046523 Bacteria 2620
281 Ga0495644_0029399 3300046523 Bacteria 2077
282 Ga0495644_0039029 3300046523 Bacteria 1790
283 Ga0495648_0000112 3300046524 Bacteria 99859
284 Ga0495648_0001096 3300046524 Bacteria 27557
285 Ga0495648_0008087 3300046524 Bacteria 8314
286 Ga0495648_0010284 3300046524 Bacteria 7141
287 Ga0495648_0010642 3300046524 Bacteria 6990
288 Ga0495648_0011941 3300046524 Bacteria 6514
289 Ga0495648_0034452 3300046524 Bacteria 3294
290 Ga0495648_0046350 3300046524 Bacteria 2695
291 Ga0495648_0047532 3300046524 Bacteria 2651
292 Ga0495663_0005974 3300046525 Bacteria 3370
293 Ga0495663_0012459 3300046525 Bacteria 2370
294 Ga0495666_0004874 3300046526 Bacteria 6786
295 Ga0495642_0000050 3300046528 Bacteria 71246
296 Ga0495642_0000704 3300046528 Bacteria 16621
297 Ga0495642_0002450 3300046528 Bacteria 7549
298 Ga0495642_0002778 3300046528 Bacteria 7014
299 Ga0495642_0004028 3300046528 Bacteria 5737
300 Ga0495642_0004888 3300046528 Bacteria 5174
301 Ga0495642_0014008 3300046528 Bacteria 3107
302 Ga0495642_0025278 3300046528 Bacteria 2353
303 Ga0495642_0026584 3300046528 Bacteria 2299
304 Ga0495642_0033281 3300046528 Bacteria 2072
305 Ga0495642_0033824 3300046528 Bacteria 2056
306 Ga0495642_0044324 3300046528 Bacteria 1815
307 Ga0495642_0055187 3300046528 Bacteria 1639
308 Ga0495642_0058939 3300046528 Bacteria 1590
309 Ga0495642_0070910 3300046528 Bacteria 1457
310 Ga0495642_0110035 3300046528 Bacteria 1177
311 Ga0495642_0159878 3300046528 Bacteria 976
312 Ga0495652_0127423 3300046529 Bacteria 2020
313 Ga0495654_0000002 3300046530 Bacteria 1021205
314 Ga0495654_0001321 3300046530 Bacteria 17308
315 Ga0495654_0004227 3300046530 Bacteria 8583
316 Ga0495665_0022003 3300046531 Bacteria 3429
317 Ga0495640_0054997 3300046533 Bacteria 2724
318 Ga0495586_0000429 3300046535 Bacteria 25339
319 Ga0495586_0164930 3300046535 Bacteria 1250
320 Ga0495609_0000022 3300046538 Bacteria 279488
321 Ga0495609_0000163 3300046538 Bacteria 69578
322 Ga0495609_0000386 3300046538 Bacteria 37359
323 Ga0495609_0000874 3300046538 Bacteria 22084
324 Ga0495609_0005423 3300046538 Bacteria 6707
325 Ga0495609_0009505 3300046538 Bacteria 4704
326 Ga0495609_0025414 3300046538 Bacteria 2715
327 Ga0495609_0036234 3300046538 Bacteria 2228
328 Ga0495609_0039897 3300046538 Bacteria 2113
329 Ga0495597_0000064 3300046542 Bacteria 91446
330 Ga0495597_0000566 3300046542 Bacteria 30712
331 Ga0495597_0001407 3300046542 Bacteria 17367
332 Ga0495597_0001418 3300046542 Bacteria 17298
333 Ga0495597_0036315 3300046542 Bacteria 2219
334 Ga0495597_0045661 3300046542 Bacteria 1943
335 Ga0495645_0153075 3300046543 Bacteria 1600
336 Ga0495622_0005185 3300046557 Bacteria 6039
337 Ga0495622_0012863 3300046557 Bacteria 3880
338 Ga0495633_0001021 3300046558 Bacteria 22931
339 Ga0495633_0001831 3300046558 Bacteria 15622
340 Ga0495633_0002552 3300046558 Bacteria 12763
341 Ga0495633_0008906 3300046558 Bacteria 5596
342 Ga0495633_0015292 3300046558 Bacteria 3984
343 Ga0495633_0016214 3300046558 Bacteria 3849
344 Ga0495633_0018266 3300046558 Bacteria 3565
345 Ga0495633_0021710 3300046558 Bacteria 3207
346 Ga0495633_0047591 3300046558 Bacteria 2026
347 Ga0495633_0051065 3300046558 Bacteria 1948
348 Ga0495656_0003243 3300046615 Bacteria 5488
349 Ga0495656_0005928 3300046615 Bacteria 4252
350 Ga0495668_0000120 3300046616 Bacteria 117076
351 Ga0495668_0000597 3300046616 Bacteria 43942
352 Ga0495668_0000777 3300046616 Bacteria 37232
353 Ga0495668_0001322 3300046616 Bacteria 24393
354 Ga0495668_0001788 3300046616 Bacteria 19636
355 Ga0495668_0001809 3300046616 Bacteria 19467
356 Ga0495668_0003009 3300046616 Bacteria 13148
357 Ga0495668_0017563 3300046616 Bacteria 4146
358 Ga0495668_0017665 3300046616 Bacteria 4132
359 Ga0495668_0065773 3300046616 Bacteria 1995
360 Ga0495634_0003063 3300046642 Bacteria 13606
361 Ga0495611_0000515 3300046648 Bacteria 22974
362 Ga0495611_0010072 3300046648 Bacteria 4001
363 Ga0495611_0026345 3300046648 Bacteria 2536
364 Ga0495611_0037647 3300046648 Bacteria 2150
365 Ga0495611_0048652 3300046648 Bacteria 1906
366 Ga0495611_0124416 3300046648 Bacteria 1202
367 Ga0495625_0003923 3300046660 Bacteria 14300
368 Ga0495625_0019488 3300046660 Bacteria 5261
369 Ga0495625_0052319 3300046660 Bacteria 2925
370 Ga0495625_0052977 3300046660 Bacteria 2904
371 Ga0495625_0064512 3300046660 Bacteria 2583
372 Ga0495625_0118275 3300046660 Bacteria 1805
373 Ga0495625_0202491 3300046660 Bacteria 1309
374 Ga0495635_0014174 3300046663 Bacteria 5578
375 Ga0495635_0191063 3300046663 Bacteria 1390
376 Ga0495659_0000167 3300046664 Bacteria 29514
377 Ga0495661_0000151 3300046665 Bacteria 81275
378 Ga0495661_0000590 3300046665 Bacteria 37515
379 Ga0495661_0000864 3300046665 Bacteria 28244
380 Ga0495661_0002955 3300046665 Bacteria 12841
381 Ga0495661_0003504 3300046665 Bacteria 11562
382 Ga0495661_0006460 3300046665 Bacteria 8246
383 Ga0495661_0007238 3300046665 Bacteria 7740
384 Ga0495661_0019402 3300046665 Bacteria 4454
385 Ga0495661_0022392 3300046665 Bacteria 4110
386 Ga0495661_0022631 3300046665 Bacteria 4087
387 Ga0495661_0037625 3300046665 Bacteria 3019
388 Ga0495661_0067072 3300046665 Bacteria 2109
389 Ga0495661_0111797 3300046665 Bacteria 1521
390 Ga0495588_0000086 3300046674 Bacteria 193241
391 Ga0495588_0008975 3300046674 Bacteria 4604
392 Ga0495588_0010952 3300046674 Bacteria 4241
393 Ga0495588_0020217 3300046674 Bacteria 3269
394 Ga0495588_0070141 3300046674 Bacteria 1821
395 Ga0495588_0074101 3300046674 Bacteria 1773
396 Ga0495588_0084559 3300046674 Bacteria 1658
397 Ga0495599_0196188 3300046678 Bacteria 1241
398 Ga0495646_0028455 3300046680 Bacteria 3499
399 Ga0495669_0000018 3300046684 Bacteria 127866
400 Ga0495669_0013223 3300046684 Bacteria 3515
401 Ga0495669_0013310 3300046684 Bacteria 3504
402 Ga0495669_0015675 3300046684 Bacteria 3246
403 Ga0495669_0026734 3300046684 Bacteria 2522
404 Ga0495669_0027686 3300046684 Bacteria 2480
405 Ga0495669_0039928 3300046684 Bacteria 2079
406 Ga0495613_0014958 3300046689 Bacteria 5759
407 Ga0495613_0136104 3300046689 Bacteria 1757
408 Ga0495670_0000110 3300046691 Bacteria 36444
409 Ga0495670_0001120 3300046691 Bacteria 12994
410 Ga0495670_0003809 3300046691 Bacteria 7410
411 Ga0495670_0036762 3300046691 Bacteria 2440
412 Ga0495670_0046833 3300046691 Bacteria 2161
413 Ga0495670_0048582 3300046691 Bacteria 2123
414 Ga0495670_0053931 3300046691 Bacteria 2013
415 Ga0495670_0126841 3300046691 Bacteria 1329
416 Ga0495670_0150484 3300046691 Bacteria 1220
417 Ga0495671_0001049 3300046692 Bacteria 19213
418 Ga0495671_0003913 3300046692 Bacteria 9036
419 Ga0495671_0068360 3300046692 Bacteria 1747
420 Ga0495671_0077810 3300046692 Bacteria 1626
421 Ga0495649_0000738 3300046694 Bacteria 26452
422 Ga0495649_0016454 3300046694 Bacteria 4190
423 Ga0495649_0028557 3300046694 Bacteria 3091
424 Ga0495649_0038301 3300046694 Bacteria 2631
425 Ga0495649_0111324 3300046694 Bacteria 1452
426 Ga0495589_0000017 3300046794 Bacteria 206113
427 Ga0495589_0000513 3300046794 Bacteria 27274
428 Ga0495589_0001650 3300046794 Bacteria 12778
429 Ga0495589_0001742 3300046794 Bacteria 12371
430 Ga0495589_0002351 3300046794 Bacteria 10616
431 Ga0495589_0009031 3300046794 Bacteria 5183
432 Ga0495589_0010276 3300046794 Bacteria 4864
433 Ga0495589_0033219 3300046794 Bacteria 2592
434 Ga0495589_0057577 3300046794 Bacteria 1911
435 Ga0495660_0000067 3300046810 Bacteria 119390
436 Ga0495660_0000448 3300046810 Bacteria 34404
437 Ga0495660_0000493 3300046810 Bacteria 32595
438 Ga0495660_0001275 3300046810 Bacteria 17529
439 Ga0495660_0003413 3300046810 Bacteria 9834
440 Ga0495660_0006449 3300046810 Bacteria 6939
441 Ga0495660_0028699 3300046810 Bacteria 3140
442 Ga0495660_0040500 3300046810 Bacteria 2581
443 Ga0495660_0075057 3300046810 Bacteria 1785
444 Ga0495660_0108498 3300046810 Bacteria 1419
445 Ga0495660_0126707 3300046810 Bacteria 1285
446 Ga0495660_0129354 3300046810 Bacteria 1268
447 Ga0495581_0091871 3300047315 Bacteria 1761
448 Ga0495604_0008518 3300047317 Bacteria 8098
449 Ga0495604_0071811 3300047317 Bacteria 2617
450 Ga0495636_0000388 3300047318 Bacteria 16592
451 Ga0495636_0001415 3300047318 Bacteria 9071
452 Ga0495636_0010898 3300047318 Bacteria 3596
453 Ga0495674_0067628 3300047319 Bacteria 3094
454 Ga0495672_0000067 3300047320 Bacteria 190335
455 Ga0495672_0000162 3300047320 Bacteria 96750
456 Ga0495672_0001013 3300047320 Bacteria 28974
457 Ga0495672_0001478 3300047320 Bacteria 23059
458 Ga0495672_0003293 3300047320 Bacteria 13969
459 Ga0495672_0005852 3300047320 Bacteria 9645
460 Ga0495676_0000067 3300047321 Bacteria 80084
461 Ga0495676_0078536 3300047321 Bacteria 2513
462 Ga0495680_0012605 3300047322 Bacteria 7428
463 Ga0495680_0144838 3300047322 Bacteria 1736
464 Ga0495683_0000083 3300047323 Bacteria 93743
465 Ga0495683_0000348 3300047323 Bacteria 38313
466 Ga0495683_0019458 3300047323 Bacteria 3503
467 Ga0495683_0028158 3300047323 Bacteria 2873
468 Ga0495683_0098389 3300047323 Bacteria 1409
469 Ga0495687_000033 3300047443 Bacteria 263788
470 Ga0495687_000126 3300047443 Bacteria 117879
471 Ga0495687_000252 3300047443 Bacteria 72401
472 Ga0495687_003326 3300047443 Bacteria 11778
473 Ga0495675_0014404 3300047444 Bacteria 4996
474 Ga0495675_0016693 3300047444 Bacteria 4642
475 Ga0495677_0000002 3300047445 Bacteria 346767
476 Ga0495677_0000278 3300047445 Bacteria 22358
477 Ga0495677_0001040 3300047445 Bacteria 11140
478 Ga0495677_0001075 3300047445 Bacteria 10969
479 Ga0495677_0001328 3300047445 Bacteria 9902
480 Ga0495677_0006100 3300047445 Bacteria 4557
481 Ga0495677_0007960 3300047445 Bacteria 3939
482 Ga0495677_0008356 3300047445 Bacteria 3848
483 Ga0495677_0023447 3300047445 Bacteria 2240
484 Ga0495679_019567 3300047446 Bacteria 2375
485 Ga0495679_033973 3300047446 Bacteria 1626
486 Ga0495679_034613 3300047446 Bacteria 1606
487 Ga0495685_001456 3300047447 Bacteria 7251
488 Ga0495685_011889 3300047447 Bacteria 2944
489 Ga0495685_023977 3300047447 Bacteria 2100
490 Ga0495673_0000265 3300047469 Bacteria 72840
491 Ga0495673_0000559 3300047469 Bacteria 38050
492 Ga0495681_0000321 3300047470 Bacteria 38154
493 Ga0495681_0000763 3300047470 Bacteria 24806
494 Ga0495681_0001527 3300047470 Bacteria 17268
495 Ga0495681_0001824 3300047470 Bacteria 15660
496 Ga0495681_0015003 3300047470 Bacteria 4406
497 Ga0495681_0026615 3300047470 Bacteria 3006
498 Ga0495681_0079812 3300047470 Bacteria 1462
499 Ga0495681_0083198 3300047470 Bacteria 1425
500 Ga0495681_0087062 3300047470 Bacteria 1385
501 Ga0495686_0000228 3300047472 Bacteria 103664
502 Ga0495686_0000628 3300047472 Bacteria 48588
503 Ga0495686_0142688 3300047472 Bacteria 1412
504 Ga0495593_0000337 3300047673 Bacteria 26031
505 Ga0495602_0011489 3300048088 Bacteria 9150
506 Ga0495615_0000627 3300048090 Bacteria 4943
507 Ga0495626_0000097 3300048091 Bacteria 113925
508 Ga0495626_0000209 3300048091 Bacteria 70145
509 Ga0495626_0000258 3300048091 Bacteria 60668
510 Ga0495626_0003284 3300048091 Bacteria 10440
511 Ga0495626_0006060 3300048091 Bacteria 6947
512 Ga0495626_0010379 3300048091 Bacteria 4972
513 Ga0495626_0021373 3300048091 Bacteria 3210
514 Ga0495626_0032074 3300048091 Bacteria 2525
515 Ga0495626_0041707 3300048091 Bacteria 2159
516 Ga0496100_0038186 3300048903 Bacteria 3041
517 Ga0496100_0115741 3300048903 Bacteria 1870
518 Ga0496100_0326516 3300048903 Bacteria 1154
519 Ga0496101_0013732 3300048904 Bacteria 5432
520 Ga0496101_0095100 3300048904 Bacteria 2222
521 Ga0496102_0000341 3300048905 Bacteria 57211
522 Ga0496102_0000487 3300048905 Bacteria 43875
523 Ga0496102_0040608 3300048905 Bacteria 4209
524 Ga0496102_0048381 3300048905 Bacteria 3866
525 Ga0496102_0141128 3300048905 Bacteria 2259
526 Ga0496102_0153405 3300048905 Bacteria 2165
527 Ga0496103_0013533 3300048906 Bacteria 4838
528 Ga0496103_0141137 3300048906 Bacteria 1540
529 Ga0496105_0073062 3300048908 Bacteria 2834
530 Ga0496106_0058767 3300048909 Bacteria 2912
531 Ga0496106_0089445 3300048909 Bacteria 2374
532 Ga0496107_0190801 3300048910 Bacteria 1522
533 Ga0496109_0039426 3300048912 Bacteria 4275
534 Ga0496109_0114055 3300048912 Bacteria 2514
535 Ga0496110_0000024 3300048913 Bacteria 74685
536 Ga0496110_0199787 3300048913 Bacteria 1816
537 Ga0496112_0136888 3300048915 Bacteria 2419
538 Ga0496113_0036201 3300048916 Bacteria 3615
539 Ga0496113_0116151 3300048916 Bacteria 2088
540 Ga0496113_0274936 3300048916 Bacteria 1347
541 Ga0496114_0123767 3300048917 Bacteria 2227
542 Ga0496115_0005164 3300048918 Bacteria 9498
543 Ga0496115_0174054 3300048918 Bacteria 1780
544 Ga0496122_0000439 3300048925 Bacteria 87380
545 Ga0496122_0015762 3300048925 Bacteria 7202
546 Ga0496123_0000487 3300048926 Bacteria 69019
547 Ga0496123_0002487 3300048926 Bacteria 22747
548 Ga0496124_0010951 3300048927 Bacteria 9119
549 Ga0496124_0013487 3300048927 Bacteria 7975
550 Ga0496124_0037590 3300048927 Bacteria 4209
551 Ga0496124_0040590 3300048927 Bacteria 4024
552 Ga0496124_0091715 3300048927 Bacteria 2475
553 Ga0496124_0108448 3300048927 Bacteria 2239
554 Ga0496125_0007499 3300048928 Bacteria 11596
555 Ga0495678_000131 3300049459 Bacteria 88620
556 Ga0495678_000197 3300049459 Bacteria 70712
557 Ga0495678_000355 3300049459 Bacteria 47179
558 Ga0495678_000863 3300049459 Bacteria 26987
559 Ga0495678_001089 3300049459 Bacteria 22909
560 Ga0495678_001525 3300049459 Bacteria 17933
561 Ga0495678_011962 3300049459 Bacteria 4132
562 Ga0495682_0001014 3300049460 Bacteria 16657
563 Ga0495682_0015435 3300049460 Bacteria 2894
564 Ga0495682_0019658 3300049460 Bacteria 2538
565 Ga0495682_0049872 3300049460 Bacteria 1525
566 Ga0501038_0001511 3300049574 Bacteria 21399
567 Ga0501046_0107768 3300049580 Bacteria 2131
568 Ga0501269_000193 3300049766 Bacteria 18289
569 Ga0501035_0001714 3300049822 Bacteria 22155
570 Ga0500594_0004892 3300053118 Bacteria 2963
571 Ga0500618_000301 3300053125 Bacteria 37462
572 Ga0500618_005135 3300053125 Bacteria 4029
573 Ga0500586_000052 3300053145 Bacteria 20422
574 2643800205 2643221556 Bacteria 7251154
575 2644251583 2643221645 Bacteria 7207331
576 2644358238 2643221664 Bacteria 7272945
577 2644472013 2643221684 Bacteria 7145183
578 2809142470 2808606418 Bacteria 6724496
579 2842716358 2842711865 Bacteria 7155354
580 2846034980 2846033681 Bacteria 4377894
581 2857563181 2857558681 Bacteria 6617694
582 2857570224 2857564685 Bacteria 6290584
583 2904427749 2904424332 Bacteria 7633521
584 2919478844 2919476304 Bacteria 5888696
585 8047674773 8047673197 Bacteria 7395230
586 Ga0495627_004095
587 rootL2_10091315
588 Ga0055525_1000029
589 Ga0055529_1000241
590 Ga0055526_1001163
591 Ga0055537_1000678
592 Ga0055524_1000021
593 Ga0055524_1015227
594 Ga0055534_1000195
595 Ga0055528_1000368
596 Ga0065165_1003109
597 Ga0070658_10279643
598 Ga0070660_100027603
599 Ga0070660_100033888
600 Ga0070661_100036428
601 Ga0070659_100033466
602 Ga0070659_100120505
603 Ga0070664_100063058
604 Ga0070664_100088507
605 Ga0079104_1007704
606 Ga0099826_10000041
607 Ga0105244_10002445
608 Ga0105245_10080211
609 Ga0105241_10042626
610 Ga0105242_10279443
611 Ga0157371_10000013
612 Ga0157372_10151971
613 Ga0182006_1000092
614 Ga0182005_1000041
615 Ga0213872_10000242
616 Ga0213872_10000443
617 Ga0213872_10000548
618 Ga0213872_10002124
619 Ga0213872_10011044
620 Ga0213872_10033643
621 Ga0209563_100003
622 Ga0209677_107503
623 Ga0209565_1000015
624 Ga0209455_1000169
625 Ga0209673_1000394
626 Ga0209675_1000012
627 Ga0209564_1000016
628 Ga0209256_1000044
629 Ga0209256_1000076
630 Ga0207655_1009887
631 Ga0207654_10029179
632 Ga0207657_10003410
633 Ga0207657_10068200
634 Ga0207657_10079536
635 Ga0207690_10037418
636 Ga0207690_10037764
637 Ga0207686_10056504
638 Ga0207679_10031437
639 Ga0207667_10190594
640 Ga0207674_10141098
641 Ga0209282_1000001
642 Ga0307515_10109177
643 Ga0265324_10011602
644 Ga0316182_1220977
645 Ga0265325_10032631
646 Ga0265327_10006962
647 Ga0307408_100000423
648 Ga0265314_10011446
649 Ga0307518_10189718
650 Ga0307412_10086114
651 Ga0316583_10001166
652 Ga0316574_0204126
653 Ga0316582_0000750
654 Ga0316582_0233968
655 Ga0316584_0031987
656 Ga0395899_0000128
657 Ga0395899_0009960
658 Ga0395899_0038303
659 Ga0395899_0067963
660 Ga0395899_0124413
661 Ga0395899_0286220
662 Ga0395900_0000123
663 Ga0395900_0013281
664 Ga0395900_0018262
665 Ga0395900_0228517
666 Ga0395900_0249539
667 Ga0395898_0083628
668 Ga0395898_0102917
669 Ga0395898_0177233
670 Ga0395905_0340224
671 Ga0395901_0000411
672 Ga0395901_0001908
673 Ga0395901_0115112
674 Ga0395901_0360359
675 Ga0395901_0477227
676 Ga0436361_0215773
677 Ga0436361_0344800
678 Ga0436361_0568335
679 Ga0436361_0568983
680 Ga0436361_0726469
681 Ga0436361_0755334
682 Ga0436361_0830100
683 Ga0436361_0896671
684 Ga0439448_0000310
685 Ga0439449_0016013
686 Ga0439450_002028
687 Ga0439450_020164
688 Ga0439455_0000807
689 Ga0439455_0036765
690 Ga0450904_000276
691 Ga0451577_0000002
692 Ga0451577_0005466
693 Ga0451577_0006084
694 Ga0451577_0025215
695 Ga0451577_0035337
696 Ga0466969_0039933
697 Ga0466972_0001100
698 Ga0453683_0000011
699 Ga0466966_0022882
700 Ga0466966_0023814
701 Ga0466966_0028009
702 Ga0466963_0068195
703 Ga0466964_0000019
704 Ga0466964_0021405
705 Ga0453684_0000002
706 Ga0453684_0000040
707 Ga0453684_0022026
708 Ga0466968_0003740
709 Ga0466957_0000079
710 Ga0466957_0021135
711 Ga0466959_0023505
712 Ga0466959_0051925
713 Ga0451576_0000004
714 Ga0451576_0010263
715 Ga0451576_0103830
716 Ga0466958_0127484
717 Ga0466967_0009357
718 Ga0466967_0054618
719 Ga0495617_000034
720 Ga0495617_004142
721 Ga0495627_000088
722 Ga0495627_000876
723 Ga0495603_0035257
724 Ga0495590_0000301
725 Ga0495590_0010638
726 Ga0495590_0041609
727 Ga0495591_000272
728 Ga0495591_025006
729 Ga0495629_0032946
730 Ga0495629_0188143
731 Ga0495638_0025297
732 Ga0495653_0038249
733 Ga0495653_0162464
734 Ga0495650_0000011
735 Ga0495650_0000715
736 Ga0495650_0000833
737 Ga0495650_0008949
738 Ga0495650_0018004
739 Ga0495582_0006238
740 Ga0495582_0076221
741 Ga0495582_0119670
742 Ga0495605_0000029
743 Ga0495605_0000042
744 Ga0495605_0000151
745 Ga0495605_0015901
746 Ga0495605_0016427
747 Ga0495605_0028035
748 Ga0495605_0053256
749 Ga0495605_0098002
750 Ga0495664_0184168
751 Ga0495584_0000007
752 Ga0495584_0000122
753 Ga0495584_0001731
754 Ga0495584_0001760
755 Ga0495584_0003043
756 Ga0495584_0003797
757 Ga0495584_0005904
758 Ga0495584_0010194
759 Ga0495584_0030895
760 Ga0495584_0046126
761 Ga0495584_0047064
762 Ga0495584_0089861
763 Ga0495584_0096039
764 Ga0495585_0000115
765 Ga0495585_0000421
766 Ga0495585_0000685
767 Ga0495585_0003326
768 Ga0495585_0007344
769 Ga0495585_0008609
770 Ga0495585_0026350
771 Ga0495585_0033061
772 Ga0495585_0057280
773 Ga0495585_0062557
774 Ga0495585_0079196
775 Ga0495594_0004505
776 Ga0495594_0026592
777 Ga0495594_0146173
778 Ga0495596_0000100
779 Ga0495596_0000788
780 Ga0495596_0001426
781 Ga0495596_0003602
782 Ga0495596_0005103
783 Ga0495596_0007052
784 Ga0495596_0008662
785 Ga0495596_0011070
786 Ga0495596_0020070
787 Ga0495596_0027262
788 Ga0495607_0001671
789 Ga0495607_0001966
790 Ga0495607_0002609
791 Ga0495607_0002735
792 Ga0495607_0007976
793 Ga0495607_0008406
794 Ga0495607_0021129
795 Ga0495607_0046732
796 Ga0495607_0052595
797 Ga0495607_0052871
798 Ga0495607_0081532
799 Ga0495583_0000337
800 Ga0495583_0000440
801 Ga0495583_0000569
802 Ga0495583_0001444
803 Ga0495583_0001752
804 Ga0495583_0003097
805 Ga0495583_0006264
806 Ga0495583_0006625
807 Ga0495583_0017488
808 Ga0495583_0035796
809 Ga0495583_0038035
810 Ga0495606_0000680
811 Ga0495606_0000787
812 Ga0495606_0001513
813 Ga0495606_0001634
814 Ga0495606_0008010
815 Ga0495606_0015409
816 Ga0495606_0034452
817 Ga0495606_0054716
818 Ga0495606_0059833
819 Ga0495610_0000473
820 Ga0495610_0001681
821 Ga0495610_0020061
822 Ga0495610_0023295
823 Ga0495610_0029498
824 Ga0495616_0000073
825 Ga0495616_0001479
826 Ga0495616_0004367
827 Ga0495616_0004509
828 Ga0495616_0006098
829 Ga0495616_0006280
830 Ga0495616_0006386
831 Ga0495616_0026013
832 Ga0495616_0031092
833 Ga0495616_0046823
834 Ga0495616_0064173
835 Ga0495616_0071753
836 Ga0495620_0030810
837 Ga0495631_0000550
838 Ga0495631_0001566
839 Ga0495631_0001683
840 Ga0495631_0008347
841 Ga0495631_0015665
842 Ga0495631_0016187
843 Ga0495631_0034252
844 Ga0495632_0000027
845 Ga0495632_0000193
846 Ga0495632_0000852
847 Ga0495632_0000903
848 Ga0495632_0001985
849 Ga0495632_0031524
850 Ga0495632_0035891
851 Ga0495632_0039912
852 Ga0495637_0000013
853 Ga0495637_0000114
854 Ga0495637_0005012
855 Ga0495643_0000157
856 Ga0495643_0000633
857 Ga0495643_0002412
858 Ga0495643_0013091
859 Ga0495643_0035151
860 Ga0495643_0041065
861 Ga0495643_0057173
862 Ga0495644_0001376
863 Ga0495644_0006526
864 Ga0495644_0007100
865 Ga0495644_0019040
866 Ga0495644_0029399
867 Ga0495644_0039029
868 Ga0495648_0000112
869 Ga0495648_0001096
870 Ga0495648_0008087
871 Ga0495648_0010284
872 Ga0495648_0010642
873 Ga0495648_0011941
874 Ga0495648_0034452
875 Ga0495648_0046350
876 Ga0495648_0047532
877 Ga0495663_0005974
878 Ga0495663_0012459
879 Ga0495666_0004874
880 Ga0495642_0000050
881 Ga0495642_0000704
882 Ga0495642_0002450
883 Ga0495642_0002778
884 Ga0495642_0004028
885 Ga0495642_0004888
886 Ga0495642_0014008
887 Ga0495642_0025278
888 Ga0495642_0026584
889 Ga0495642_0033281
890 Ga0495642_0033824
891 Ga0495642_0044324
892 Ga0495642_0055187
893 Ga0495642_0058939
894 Ga0495642_0070910
895 Ga0495642_0110035
896 Ga0495642_0159878
897 Ga0495652_0127423
898 Ga0495654_0000002
899 Ga0495654_0001321
900 Ga0495654_0004227
901 Ga0495665_0022003
902 Ga0495640_0054997
903 Ga0495586_0000429
904 Ga0495586_0164930
905 Ga0495609_0000022
906 Ga0495609_0000163
907 Ga0495609_0000386
908 Ga0495609_0000874
909 Ga0495609_0005423
910 Ga0495609_0009505
911 Ga0495609_0025414
912 Ga0495609_0036234
913 Ga0495609_0039897
914 Ga0495597_0000064
915 Ga0495597_0000566
916 Ga0495597_0001407
917 Ga0495597_0001418
918 Ga0495597_0036315
919 Ga0495597_0045661
920 Ga0495645_0153075
921 Ga0495622_0005185
922 Ga0495622_0012863
923 Ga0495633_0001021
924 Ga0495633_0001831
925 Ga0495633_0002552
926 Ga0495633_0008906
927 Ga0495633_0015292
928 Ga0495633_0016214
929 Ga0495633_0018266
930 Ga0495633_0021710
931 Ga0495633_0047591
932 Ga0495633_0051065
933 Ga0495656_0003243
934 Ga0495656_0005928
935 Ga0495668_0000120
936 Ga0495668_0000597
937 Ga0495668_0000777
938 Ga0495668_0001322
939 Ga0495668_0001788
940 Ga0495668_0001809
941 Ga0495668_0003009
942 Ga0495668_0017563
943 Ga0495668_0017665
944 Ga0495668_0065773
945 Ga0495634_0003063
946 Ga0495611_0000515
947 Ga0495611_0010072
948 Ga0495611_0026345
949 Ga0495611_0037647
950 Ga0495611_0048652
951 Ga0495611_0124416
952 Ga0495625_0003923
953 Ga0495625_0019488
954 Ga0495625_0052319
955 Ga0495625_0052977
956 Ga0495625_0064512
957 Ga0495625_0118275
958 Ga0495625_0202491
959 Ga0495635_0014174
960 Ga0495635_0191063
961 Ga0495659_0000167
962 Ga0495661_0000151
963 Ga0495661_0000590
964 Ga0495661_0000864
965 Ga0495661_0002955
966 Ga0495661_0003504
967 Ga0495661_0006460
968 Ga0495661_0007238
969 Ga0495661_0019402
970 Ga0495661_0022392
971 Ga0495661_0022631
972 Ga0495661_0037625
973 Ga0495661_0067072
974 Ga0495661_0111797
975 Ga0495588_0000086
976 Ga0495588_0008975
977 Ga0495588_0010952
978 Ga0495588_0020217
979 Ga0495588_0070141
980 Ga0495588_0074101
981 Ga0495588_0084559
982 Ga0495599_0196188
983 Ga0495646_0028455
984 Ga0495669_0000018
985 Ga0495669_0013223
986 Ga0495669_0013310
987 Ga0495669_0015675
988 Ga0495669_0026734
989 Ga0495669_0027686
990 Ga0495669_0039928
991 Ga0495613_0014958
992 Ga0495613_0136104
993 Ga0495670_0000110
994 Ga0495670_0001120
995 Ga0495670_0003809
996 Ga0495670_0036762
997 Ga0495670_0046833
998 Ga0495670_0048582
999 Ga0495670_0053931
1000 Ga0495670_0126841
1001 Ga0495670_0150484
1002 Ga0495671_0001049
1003 Ga0495671_0003913
1004 Ga0495671_0068360
1005 Ga0495671_0077810
1006 Ga0495649_0000738
1007 Ga0495649_0016454
1008 Ga0495649_0028557
1009 Ga0495649_0038301
1010 Ga0495649_0111324
1011 Ga0495589_0000017
1012 Ga0495589_0000513
1013 Ga0495589_0001650
1014 Ga0495589_0001742
1015 Ga0495589_0002351
1016 Ga0495589_0009031
1017 Ga0495589_0010276
1018 Ga0495589_0033219
1019 Ga0495589_0057577
1020 Ga0495660_0000067
1021 Ga0495660_0000448
1022 Ga0495660_0000493
1023 Ga0495660_0001275
1024 Ga0495660_0003413
1025 Ga0495660_0006449
1026 Ga0495660_0028699
1027 Ga0495660_0040500
1028 Ga0495660_0075057
1029 Ga0495660_0108498
1030 Ga0495660_0126707
1031 Ga0495660_0129354
1032 Ga0495581_0091871
1033 Ga0495604_0008518
1034 Ga0495604_0071811
1035 Ga0495636_0000388
1036 Ga0495636_0001415
1037 Ga0495636_0010898
1038 Ga0495674_0067628
1039 Ga0495672_0000067
1040 Ga0495672_0000162
1041 Ga0495672_0001013
1042 Ga0495672_0001478
1043 Ga0495672_0003293
1044 Ga0495672_0005852
1045 Ga0495676_0000067
1046 Ga0495676_0078536
1047 Ga0495680_0012605
1048 Ga0495680_0144838
1049 Ga0495683_0000083
1050 Ga0495683_0000348
1051 Ga0495683_0019458
1052 Ga0495683_0028158
1053 Ga0495683_0098389
1054 Ga0495687_000033
1055 Ga0495687_000126
1056 Ga0495687_000252
1057 Ga0495687_003326
1058 Ga0495675_0014404
1059 Ga0495675_0016693
1060 Ga0495677_0000002
1061 Ga0495677_0000278
1062 Ga0495677_0001040
1063 Ga0495677_0001075
1064 Ga0495677_0001328
1065 Ga0495677_0006100
1066 Ga0495677_0007960
1067 Ga0495677_0008356
1068 Ga0495677_0023447
1069 Ga0495679_019567
1070 Ga0495679_033973
1071 Ga0495679_034613
1072 Ga0495685_001456
1073 Ga0495685_011889
1074 Ga0495685_023977
1075 Ga0495673_0000265
1076 Ga0495673_0000559
1077 Ga0495681_0000321
1078 Ga0495681_0000763
1079 Ga0495681_0001527
1080 Ga0495681_0001824
1081 Ga0495681_0015003
1082 Ga0495681_0026615
1083 Ga0495681_0079812
1084 Ga0495681_0083198
1085 Ga0495681_0087062
1086 Ga0495686_0000228
1087 Ga0495686_0000628
1088 Ga0495686_0142688
1089 Ga0495593_0000337
1090 Ga0495602_0011489
1091 Ga0495615_0000627
1092 Ga0495626_0000097
1093 Ga0495626_0000209
1094 Ga0495626_0000258
1095 Ga0495626_0003284
1096 Ga0495626_0006060
1097 Ga0495626_0010379
1098 Ga0495626_0021373
1099 Ga0495626_0032074
1100 Ga0495626_0041707
1101 Ga0496100_0038186
1102 Ga0496100_0115741
1103 Ga0496100_0326516
1104 Ga0496101_0013732
1105 Ga0496101_0095100
1106 Ga0496102_0000341
1107 Ga0496102_0000487
1108 Ga0496102_0040608
1109 Ga0496102_0048381
1110 Ga0496102_0141128
1111 Ga0496102_0153405
1112 Ga0496103_0013533
1113 Ga0496103_0141137
1114 Ga0496105_0073062
1115 Ga0496106_0058767
1116 Ga0496106_0089445
1117 Ga0496107_0190801
1118 Ga0496109_0039426
1119 Ga0496109_0114055
1120 Ga0496110_0000024
1121 Ga0496110_0199787
1122 Ga0496112_0136888
1123 Ga0496113_0036201
1124 Ga0496113_0116151
1125 Ga0496113_0274936
1126 Ga0496114_0123767
1127 Ga0496115_0005164
1128 Ga0496115_0174054
1129 Ga0496122_0000439
1130 Ga0496122_0015762
1131 Ga0496123_0000487
1132 Ga0496123_0002487
1133 Ga0496124_0010951
1134 Ga0496124_0013487
1135 Ga0496124_0037590
1136 Ga0496124_0040590
1137 Ga0496124_0091715
1138 Ga0496124_0108448
1139 Ga0496125_0007499
1140 Ga0495678_000131
1141 Ga0495678_000197
1142 Ga0495678_000355
1143 Ga0495678_000863
1144 Ga0495678_001089
1145 Ga0495678_001525
1146 Ga0495678_011962
1147 Ga0495682_0001014
1148 Ga0495682_0015435
1149 Ga0495682_0019658
1150 Ga0495682_0049872
1151 Ga0501038_0001511
1152 Ga0501046_0107768
1153 Ga0501269_000193
1154 Ga0501035_0001714
1155 Ga0500594_0004892
1156 Ga0500618_000301
1157 Ga0500618_005135
1158 Ga0500586_000052
1159 2643800205
1160 2644251583
1161 2644358238
1162 2644472013
1163 2809142470
1164 2842716358
1165 2846034980
1166 2857563181
1167 2857570224
1168 2904427749
1169 2919478844
1170 8047674773

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

75

314

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zyl-assembly1.cif.gz_A crystal structure of hypothetical protein yihe from escherichia coli 0.9553 31 346
1zyl-assembly1.cif.gz_A crystal structure of hypothetical protein yihe from escherichia coli 0.9265 31 346
6sun-assembly1.cif.gz_A amicoumacin kinase hamin in complex with amp-pnp, ca2+ and ami 0.7659 24 344
6ef6-assembly1.cif.gz_A structure of the microcompartment-associated aminopropanol kinase 0.7492 31 340
6sul-assembly2.cif.gz_D amicoumacin kinase amin in complex with amp-pnp, mg2+ and ami 0.7408 31 346
ID Description Score Start End Superfamily
af_P0C0K3_17_108_3.30.200.70 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.9805 37 127 3.30.200.70
af_P0C0K3_149_318_1.20.1270.170 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.9688 171 340 1.20.1270.170
af_P0C0K3_17_108_3.30.200.70 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.9598 37 127 3.30.200.70
1zylA02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9556 80 280 1.10.510.10
af_P0C0K3_149_318_1.20.1270.170 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.9467 171 340 1.20.1270.170
ID Description Score Start End GO Terms
AF-A0A536ZAL2-F1-model_v4 Serine/threonine protein kinase (EC 2.7.11.1) 0.9911 182 346 GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005737
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-A0A2P7NU24-F1-model_v4 Stress response kinase A (EC 2.7.11.1) (Serine/threonine-protein kinase SrkA) 0.9908 37 344 GO:0000287
GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005524
GO:0005737
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0106310
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-A0A259PCD9-F1-model_v4 deleted 0.9905 26 345
AF-A0A522FDY1-F1-model_v4 Stress response kinase A (EC 2.7.11.1) (Serine/threonine-protein kinase SrkA) 0.9903 26 340 GO:0000287
GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0005524
GO:0005737
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0106310
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-A0A661H663-F1-model_v4 Stress response kinase A 0.9901 25 123 GO:0004674
GO:0005737

Map