F466482
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 585 | 377 | 493 | 286 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0016028|Ga0495638_0016028_2214_3191 |
| Length | 325 |
| Sequence | MTGRFGPRSGRVLGEDGGPGKARGQEIRVGLGSKKEPKMEHLTVQANGAALHVAHMGAGRPLLLLHGWPEFWLTWEPVMTRLADRFTLYAPDLRGFGDSDKPEGLFGPDQQAADMLALMDALGLAQAGIVGHDVGGALMQPLARLAPERIAGLFFFDFVYPGIGRRMAEPERLNNIWYQSFHQMEMAPALVGASRESCRRYIGHFLKAWSHRKHVFDDQLDAFTDNFLKSGNLAGGFAHYRAVHAGRVRMMKGEAPAPAPIGVPTCVRWAEHDPLFPYEWTDRLGETFTNLDLAMFPDVGHFPHREDPDRAASDIAAFFTRIGWH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 2 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 3 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 4 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 5 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 6 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 7 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 8 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 9 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 10 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 11 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 12 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 13 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 14 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 15 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 16 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 17 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 18 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 19 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 20 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 21 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 22 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 23 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 24 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 25 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 26 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 27 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 28 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 29 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 30 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 31 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 32 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 33 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 34 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 35 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 36 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 37 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 38 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 39 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 40 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 41 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 42 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 43 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 44 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 45 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 46 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 47 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 48 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 49 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 50 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 51 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 52 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 53 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 54 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 55 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 56 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 57 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 58 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 59 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 60 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 61 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 62 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 63 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 64 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 65 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 66 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 67 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 68 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 69 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 70 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 71 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 72 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 73 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 74 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 75 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 76 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 77 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 78 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 79 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 80 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 81 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 83 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 87 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 89 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 105 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 110 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 112 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 113 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 115 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 116 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 117 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 118 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 119 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 120 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 121 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 122 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 123 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 124 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 125 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 127 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 128 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 129 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 130 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 131 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 132 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 133 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 134 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 135 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 136 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 137 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 138 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 139 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 140 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 141 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 142 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 143 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 144 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 145 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 146 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 147 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 159 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 161 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 174 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 175 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 176 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 177 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 227 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 233 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 234 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 235 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 236 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 237 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 238 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 239 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 240 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 246 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 248 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 251 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 252 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 253 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 256 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 259 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 260 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 263 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 312 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 313 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 314 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 315 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 316 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 319 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 320 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 321 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 322 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 323 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 324 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 325 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 326 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 327 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 328 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 329 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 330 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 331 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 338 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 341 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 351 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 352 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 353 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 354 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 355 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 356 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 357 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 358 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 359 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 361 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 362 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 363 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 364 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 365 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 366 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 367 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 368 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 369 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 370 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 371 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 372 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 373 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 374 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 375 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 376 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 377 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.56 |
| Metatranscriptomes | 0 |
| Isolates | 15.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.89 |
| Nodule | 11.45 |
| Rhizoplane | 5.98 |
| Rhizosphere | 61.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10026689 | 3300002077 | Bacteria | 1120 |
| 2 | JGI25406J46586_10000256 | 3300003203 | Bacteria | 23743 |
| 3 | JGI25160J50197_1010119 | 3300003354 | Bacteria | 3436 |
| 4 | JGI25404J52841_10030083 | 3300003659 | Bacteria | 1164 |
| 5 | Ga0070676_10051365 | 3300005328 | Bacteria | 2420 |
| 6 | Ga0070683_100004493 | 3300005329 | Bacteria | 11507 |
| 7 | Ga0070683_100225276 | 3300005329 | Bacteria | 1782 |
| 8 | Ga0070683_100267135 | 3300005329 | Bacteria | 1627 |
| 9 | Ga0068869_100231800 | 3300005334 | Bacteria | 1467 |
| 10 | Ga0070680_100084955 | 3300005336 | Bacteria | 2614 |
| 11 | Ga0070680_100172832 | 3300005336 | Bacteria | 1818 |
| 12 | Ga0068868_100063413 | 3300005338 | Bacteria | 2931 |
| 13 | Ga0070661_100215637 | 3300005344 | Bacteria | 1470 |
| 14 | Ga0070668_100064385 | 3300005347 | Bacteria | 2842 |
| 15 | Ga0070668_100391541 | 3300005347 | Bacteria | 1185 |
| 16 | Ga0070668_100531356 | 3300005347 | Bacteria | 1021 |
| 17 | Ga0070671_100211609 | 3300005355 | Bacteria | 1644 |
| 18 | Ga0070674_100437666 | 3300005356 | Bacteria | 1076 |
| 19 | Ga0070659_100229930 | 3300005366 | Bacteria | 1532 |
| 20 | Ga0070667_100329723 | 3300005367 | Bacteria | 1379 |
| 21 | Ga0070709_10205373 | 3300005434 | Bacteria | 1397 |
| 22 | Ga0070709_10248826 | 3300005434 | Bacteria | 1279 |
| 23 | Ga0070713_100017781 | 3300005436 | Bacteria | 5390 |
| 24 | Ga0070713_100035194 | 3300005436 | Bacteria | 4029 |
| 25 | Ga0070713_100664969 | 3300005436 | Bacteria | 993 |
| 26 | Ga0070710_10013404 | 3300005437 | Bacteria | 4106 |
| 27 | Ga0070710_10066561 | 3300005437 | Bacteria | 2066 |
| 28 | Ga0070710_10110412 | 3300005437 | Bacteria | 1651 |
| 29 | Ga0070711_100024466 | 3300005439 | Bacteria | 3938 |
| 30 | Ga0070711_100092851 | 3300005439 | Bacteria | 2179 |
| 31 | Ga0070711_100214900 | 3300005439 | Bacteria | 1491 |
| 32 | Ga0070663_100084709 | 3300005455 | Bacteria | 2337 |
| 33 | Ga0070663_100128118 | 3300005455 | Bacteria | 1924 |
| 34 | Ga0070663_100152397 | 3300005455 | Bacteria | 1773 |
| 35 | Ga0070663_100524167 | 3300005455 | Bacteria | 987 |
| 36 | Ga0070678_100068347 | 3300005456 | Bacteria | 2648 |
| 37 | Ga0070678_100088081 | 3300005456 | Bacteria | 2372 |
| 38 | Ga0070678_100098874 | 3300005456 | Bacteria | 2257 |
| 39 | Ga0070678_100409735 | 3300005456 | Bacteria | 1179 |
| 40 | Ga0070681_10004178 | 3300005458 | Bacteria | 13672 |
| 41 | Ga0070681_10506463 | 3300005458 | Bacteria | 1120 |
| 42 | Ga0070707_100254287 | 3300005468 | Bacteria | 1709 |
| 43 | Ga0070698_100296410 | 3300005471 | Bacteria | 1548 |
| 44 | Ga0070679_100085452 | 3300005530 | Bacteria | 3142 |
| 45 | Ga0070679_100143811 | 3300005530 | Bacteria | 2363 |
| 46 | Ga0070684_100008530 | 3300005535 | Bacteria | 8019 |
| 47 | Ga0070684_100017771 | 3300005535 | Bacteria | 5843 |
| 48 | Ga0070672_100274030 | 3300005543 | Bacteria | 1425 |
| 49 | Ga0070672_100311923 | 3300005543 | Bacteria | 1335 |
| 50 | Ga0070696_100092391 | 3300005546 | Bacteria | 2157 |
| 51 | Ga0070665_100007488 | 3300005548 | Bacteria | 11101 |
| 52 | Ga0070665_100056755 | 3300005548 | Bacteria | 3926 |
| 53 | Ga0070665_100164203 | 3300005548 | Bacteria | 2223 |
| 54 | Ga0070665_100309934 | 3300005548 | Bacteria | 1582 |
| 55 | Ga0070665_100556015 | 3300005548 | Bacteria | 1160 |
| 56 | Ga0070665_100604721 | 3300005548 | Bacteria | 1109 |
| 57 | Ga0068855_100142216 | 3300005563 | Bacteria | 2733 |
| 58 | Ga0068855_100321361 | 3300005563 | Bacteria | 1711 |
| 59 | Ga0070664_100070506 | 3300005564 | Bacteria | 2993 |
| 60 | Ga0070664_100233122 | 3300005564 | Bacteria | 1650 |
| 61 | Ga0068857_100262780 | 3300005577 | Bacteria | 1584 |
| 62 | Ga0068856_100158774 | 3300005614 | Bacteria | 2271 |
| 63 | Ga0068856_100167938 | 3300005614 | Bacteria | 2205 |
| 64 | Ga0068856_100171369 | 3300005614 | Bacteria | 2182 |
| 65 | Ga0070702_100082056 | 3300005615 | Bacteria | 1934 |
| 66 | Ga0068852_100088408 | 3300005616 | Bacteria | 2767 |
| 67 | Ga0068852_100237125 | 3300005616 | Bacteria | 1741 |
| 68 | Ga0068852_100332500 | 3300005616 | Bacteria | 1479 |
| 69 | Ga0068864_100055366 | 3300005618 | Bacteria | 3424 |
| 70 | Ga0068861_100248587 | 3300005719 | Bacteria | 1516 |
| 71 | Ga0068861_100253242 | 3300005719 | Bacteria | 1503 |
| 72 | Ga0068851_10132809 | 3300005834 | Bacteria | 1348 |
| 73 | Ga0068863_100169065 | 3300005841 | Bacteria | 2096 |
| 74 | Ga0068858_100137134 | 3300005842 | Bacteria | 2296 |
| 75 | Ga0068860_100012321 | 3300005843 | Bacteria | 8425 |
| 76 | Ga0068860_100650921 | 3300005843 | Bacteria | 1061 |
| 77 | Ga0068862_100083456 | 3300005844 | Bacteria | 2774 |
| 78 | Ga0068862_100185626 | 3300005844 | Bacteria | 1868 |
| 79 | Ga0068862_100383487 | 3300005844 | Bacteria | 1311 |
| 80 | Ga0081455_10013159 | 3300005937 | Bacteria | 8199 |
| 81 | Ga0081455_10102881 | 3300005937 | Bacteria | 2289 |
| 82 | Ga0081455_10195921 | 3300005937 | Bacteria | 1517 |
| 83 | Ga0081455_10228712 | 3300005937 | Bacteria | 1374 |
| 84 | Ga0081540_1002532 | 3300005983 | Bacteria | 14825 |
| 85 | Ga0081540_1004042 | 3300005983 | Bacteria | 11359 |
| 86 | Ga0081540_1005765 | 3300005983 | Bacteria | 9169 |
| 87 | Ga0081540_1012681 | 3300005983 | Bacteria | 5529 |
| 88 | Ga0081540_1026337 | 3300005983 | Bacteria | 3322 |
| 89 | Ga0081540_1030647 | 3300005983 | Bacteria | 2975 |
| 90 | Ga0081540_1030772 | 3300005983 | Bacteria | 2966 |
| 91 | Ga0081540_1033763 | 3300005983 | Bacteria | 2772 |
| 92 | Ga0081540_1043864 | 3300005983 | Bacteria | 2289 |
| 93 | Ga0081540_1100942 | 3300005983 | Bacteria | 1243 |
| 94 | Ga0081539_10000608 | 3300005985 | Bacteria | 72799 |
| 95 | Ga0081539_10002743 | 3300005985 | Bacteria | 23762 |
| 96 | Ga0081539_10015726 | 3300005985 | Bacteria | 5476 |
| 97 | Ga0070717_10071574 | 3300006028 | Bacteria | 2893 |
| 98 | Ga0075365_10055327 | 3300006038 | Bacteria | 2633 |
| 99 | Ga0075365_10156257 | 3300006038 | Bacteria | 1587 |
| 100 | Ga0075368_10020073 | 3300006042 | Bacteria | 2527 |
| 101 | Ga0075363_100027180 | 3300006048 | Bacteria | 2932 |
| 102 | Ga0075363_100067041 | 3300006048 | Bacteria | 1944 |
| 103 | Ga0075363_100123870 | 3300006048 | Bacteria | 1445 |
| 104 | Ga0075364_10176890 | 3300006051 | Bacteria | 1443 |
| 105 | Ga0070716_100011909 | 3300006173 | Bacteria | 4394 |
| 106 | Ga0070716_100178917 | 3300006173 | Bacteria | 1390 |
| 107 | Ga0070712_100003832 | 3300006175 | Bacteria | 9259 |
| 108 | Ga0070712_100205057 | 3300006175 | Bacteria | 1551 |
| 109 | Ga0075362_10139874 | 3300006177 | Bacteria | 1156 |
| 110 | Ga0075367_10219987 | 3300006178 | Bacteria | 1188 |
| 111 | Ga0075369_10145700 | 3300006186 | Bacteria | 1081 |
| 112 | Ga0075370_10063578 | 3300006353 | Bacteria | 2104 |
| 113 | Ga0075370_10066654 | 3300006353 | Bacteria | 2054 |
| 114 | Ga0075370_10190787 | 3300006353 | Bacteria | 1207 |
| 115 | Ga0068871_100275134 | 3300006358 | Bacteria | 1471 |
| 116 | Ga0068871_100312572 | 3300006358 | Bacteria | 1381 |
| 117 | Ga0075428_100609249 | 3300006844 | Bacteria | 1166 |
| 118 | Ga0075433_10337240 | 3300006852 | Bacteria | 1333 |
| 119 | Ga0075434_100272871 | 3300006871 | Bacteria | 1710 |
| 120 | Ga0075434_100502163 | 3300006871 | Bacteria | 1234 |
| 121 | Ga0068865_100026883 | 3300006881 | Bacteria | 3797 |
| 122 | Ga0068865_100190263 | 3300006881 | Bacteria | 1586 |
| 123 | Ga0099825_1041592 | 3300006941 | Bacteria | 1311 |
| 124 | Ga0099824_1010733 | 3300006942 | Bacteria | 10649 |
| 125 | Ga0099823_1024318 | 3300006944 | Bacteria | 5485 |
| 126 | Ga0075435_100278872 | 3300007076 | Bacteria | 1427 |
| 127 | Ga0099794_10039477 | 3300007265 | Bacteria | 2241 |
| 128 | Ga0099794_10042583 | 3300007265 | Bacteria | 2165 |
| 129 | Ga0099794_10166001 | 3300007265 | Bacteria | 1124 |
| 130 | Ga0099795_10033741 | 3300007788 | Bacteria | 1779 |
| 131 | Ga0099795_10058832 | 3300007788 | Bacteria | 1420 |
| 132 | Ga0105240_10083500 | 3300009093 | Bacteria | 3919 |
| 133 | Ga0105240_10107526 | 3300009093 | Bacteria | 3381 |
| 134 | Ga0105240_10481236 | 3300009093 | Bacteria | 1384 |
| 135 | Ga0111539_10395682 | 3300009094 | Bacteria | 1609 |
| 136 | Ga0111539_11021987 | 3300009094 | Bacteria | 961 |
| 137 | Ga0105245_10358380 | 3300009098 | Bacteria | 1447 |
| 138 | Ga0114129_10065816 | 3300009147 | Bacteria | 5057 |
| 139 | Ga0105243_10204135 | 3300009148 | Bacteria | 1735 |
| 140 | Ga0105241_10131574 | 3300009174 | Bacteria | 2026 |
| 141 | Ga0105242_10063484 | 3300009176 | Bacteria | 3041 |
| 142 | Ga0105242_10074820 | 3300009176 | Bacteria | 2819 |
| 143 | Ga0105248_10363041 | 3300009177 | Bacteria | 1631 |
| 144 | Ga0105248_10403707 | 3300009177 | Bacteria | 1539 |
| 145 | Ga0105248_10665248 | 3300009177 | Bacteria | 1175 |
| 146 | Ga0105248_10813745 | 3300009177 | Bacteria | 1054 |
| 147 | Ga0105237_10328542 | 3300009545 | Bacteria | 1533 |
| 148 | Ga0105238_10449372 | 3300009551 | Bacteria | 1286 |
| 149 | Ga0105249_10155359 | 3300009553 | Bacteria | 2206 |
| 150 | Ga0105249_10306303 | 3300009553 | Bacteria | 1595 |
| 151 | Ga0105249_10777957 | 3300009553 | Bacteria | 1020 |
| 152 | Ga0099796_10064718 | 3300010159 | Bacteria | 1305 |
| 153 | Ga0099796_10070882 | 3300010159 | Bacteria | 1258 |
| 154 | Ga0105239_10120748 | 3300010375 | Bacteria | 2910 |
| 155 | Ga0105239_10254404 | 3300010375 | Bacteria | 1973 |
| 156 | Ga0157328_1001009 | 3300012478 | Bacteria | 1138 |
| 157 | Ga0157370_10188253 | 3300013104 | Bacteria | 1916 |
| 158 | Ga0157369_10076832 | 3300013105 | Bacteria | 3579 |
| 159 | Ga0157369_10100287 | 3300013105 | Bacteria | 3087 |
| 160 | Ga0157369_10106771 | 3300013105 | Bacteria | 2979 |
| 161 | Ga0157374_10155243 | 3300013296 | Bacteria | 2227 |
| 162 | Ga0157374_10318837 | 3300013296 | Bacteria | 1540 |
| 163 | Ga0157378_10042708 | 3300013297 | Bacteria | 4024 |
| 164 | Ga0157378_10216804 | 3300013297 | Bacteria | 1818 |
| 165 | Ga0163162_10110451 | 3300013306 | Bacteria | 2846 |
| 166 | Ga0163162_10365186 | 3300013306 | Bacteria | 1576 |
| 167 | Ga0163162_10415051 | 3300013306 | Bacteria | 1478 |
| 168 | Ga0157372_10172224 | 3300013307 | Bacteria | 2505 |
| 169 | Ga0157372_10598202 | 3300013307 | Bacteria | 1286 |
| 170 | Ga0157375_10225207 | 3300013308 | Bacteria | 2034 |
| 171 | Ga0157375_10275017 | 3300013308 | Bacteria | 1846 |
| 172 | Ga0157375_10423671 | 3300013308 | Bacteria | 1497 |
| 173 | Ga0163163_10075527 | 3300014325 | Bacteria | 3363 |
| 174 | Ga0163163_10095036 | 3300014325 | Bacteria | 3000 |
| 175 | Ga0157380_10069744 | 3300014326 | Bacteria | 2838 |
| 176 | Ga0157379_10159655 | 3300014968 | Bacteria | 2035 |
| 177 | Ga0157379_10194410 | 3300014968 | Bacteria | 1833 |
| 178 | Ga0157376_10058496 | 3300014969 | Bacteria | 3229 |
| 179 | Ga0163161_10171795 | 3300017792 | Bacteria | 1658 |
| 180 | Ga0214544_1000665 | 3300021320 | Bacteria | 65630 |
| 181 | Ga0214542_1000486 | 3300021321 | Bacteria | 71884 |
| 182 | Ga0214545_1000307 | 3300021324 | Bacteria | 71884 |
| 183 | Ga0213875_10001636 | 3300021388 | Bacteria | 14148 |
| 184 | Ga0209564_1003322 | 3300025295 | Bacteria | 11175 |
| 185 | Ga0209758_1007720 | 3300025297 | Bacteria | 7220 |
| 186 | Ga0209758_1008227 | 3300025297 | Bacteria | 6830 |
| 187 | Ga0209758_1026917 | 3300025297 | Bacteria | 2474 |
| 188 | Ga0209758_1049406 | 3300025297 | Bacteria | 1485 |
| 189 | Ga0207426_1000227 | 3300025302 | Bacteria | 129311 |
| 190 | Ga0207426_1015497 | 3300025302 | Bacteria | 2761 |
| 191 | Ga0207656_10017867 | 3300025321 | Bacteria | 2785 |
| 192 | Ga0207653_10042857 | 3300025885 | Bacteria | 1489 |
| 193 | Ga0207692_10057636 | 3300025898 | Bacteria | 1998 |
| 194 | Ga0207688_10085686 | 3300025901 | Bacteria | 1804 |
| 195 | Ga0207688_10136080 | 3300025901 | Bacteria | 1443 |
| 196 | Ga0207680_10274061 | 3300025903 | Bacteria | 1171 |
| 197 | Ga0207685_10008828 | 3300025905 | Bacteria | 2895 |
| 198 | Ga0207699_10016829 | 3300025906 | Bacteria | 3834 |
| 199 | Ga0207645_10169027 | 3300025907 | Bacteria | 1432 |
| 200 | Ga0207643_10028484 | 3300025908 | Bacteria | 3102 |
| 201 | Ga0207643_10204988 | 3300025908 | Bacteria | 1202 |
| 202 | Ga0207654_10035660 | 3300025911 | Bacteria | 2773 |
| 203 | Ga0207707_10001922 | 3300025912 | Bacteria | 18882 |
| 204 | Ga0207707_10004003 | 3300025912 | Bacteria | 13084 |
| 205 | Ga0207707_10146040 | 3300025912 | Bacteria | 2068 |
| 206 | Ga0207695_10195102 | 3300025913 | Bacteria | 1941 |
| 207 | Ga0207693_10004965 | 3300025915 | Bacteria | 11173 |
| 208 | Ga0207693_10031046 | 3300025915 | Bacteria | 4221 |
| 209 | Ga0207663_10099686 | 3300025916 | Bacteria | 1948 |
| 210 | Ga0207663_10163013 | 3300025916 | Bacteria | 1576 |
| 211 | Ga0207663_10302644 | 3300025916 | Bacteria | 1195 |
| 212 | Ga0207660_10277349 | 3300025917 | Bacteria | 1329 |
| 213 | Ga0207660_10390337 | 3300025917 | Bacteria | 1120 |
| 214 | Ga0207649_10208901 | 3300025920 | Bacteria | 1384 |
| 215 | Ga0207649_10238119 | 3300025920 | Bacteria | 1305 |
| 216 | Ga0207650_10127360 | 3300025925 | Bacteria | 1989 |
| 217 | Ga0207687_10029203 | 3300025927 | Bacteria | 3708 |
| 218 | Ga0207700_10019075 | 3300025928 | Bacteria | 4626 |
| 219 | Ga0207700_10066757 | 3300025928 | Bacteria | 2750 |
| 220 | Ga0207700_10380321 | 3300025928 | Bacteria | 1235 |
| 221 | Ga0207664_10022137 | 3300025929 | Bacteria | 4741 |
| 222 | Ga0207664_10086456 | 3300025929 | Bacteria | 2561 |
| 223 | Ga0207644_10036883 | 3300025931 | Bacteria | 3435 |
| 224 | Ga0207644_10094104 | 3300025931 | Bacteria | 2238 |
| 225 | Ga0207644_10182793 | 3300025931 | Bacteria | 1644 |
| 226 | Ga0207644_10334960 | 3300025931 | Bacteria | 1226 |
| 227 | Ga0207644_10357459 | 3300025931 | Bacteria | 1187 |
| 228 | Ga0207686_10103139 | 3300025934 | Bacteria | 1908 |
| 229 | Ga0207709_10160378 | 3300025935 | Bacteria | 1568 |
| 230 | Ga0207709_10309115 | 3300025935 | Bacteria | 1179 |
| 231 | Ga0207670_10200708 | 3300025936 | Bacteria | 1515 |
| 232 | Ga0207669_10351900 | 3300025937 | Bacteria | 1138 |
| 233 | Ga0207669_10392569 | 3300025937 | Bacteria | 1084 |
| 234 | Ga0207704_10076792 | 3300025938 | Bacteria | 2142 |
| 235 | Ga0207704_10175380 | 3300025938 | Bacteria | 1543 |
| 236 | Ga0207665_10002143 | 3300025939 | Bacteria | 13354 |
| 237 | Ga0207665_10029872 | 3300025939 | Bacteria | 3602 |
| 238 | Ga0207665_10082302 | 3300025939 | Bacteria | 2218 |
| 239 | Ga0207665_10379223 | 3300025939 | Bacteria | 1073 |
| 240 | Ga0207691_10206849 | 3300025940 | Bacteria | 1706 |
| 241 | Ga0207691_10536211 | 3300025940 | Bacteria | 993 |
| 242 | Ga0207711_10197843 | 3300025941 | Bacteria | 1833 |
| 243 | Ga0207711_10337525 | 3300025941 | Bacteria | 1394 |
| 244 | Ga0207711_10411125 | 3300025941 | Bacteria | 1258 |
| 245 | Ga0207711_10496534 | 3300025941 | Bacteria | 1137 |
| 246 | Ga0207689_10080784 | 3300025942 | Bacteria | 2672 |
| 247 | Ga0207689_10256320 | 3300025942 | Bacteria | 1447 |
| 248 | Ga0207661_10001440 | 3300025944 | Bacteria | 16041 |
| 249 | Ga0207667_10015124 | 3300025949 | Bacteria | 8775 |
| 250 | Ga0207667_10373276 | 3300025949 | Bacteria | 1453 |
| 251 | Ga0207667_10390788 | 3300025949 | Bacteria | 1417 |
| 252 | Ga0207712_10079702 | 3300025961 | Bacteria | 2379 |
| 253 | Ga0207668_10172071 | 3300025972 | Bacteria | 1699 |
| 254 | Ga0207640_10345526 | 3300025981 | Bacteria | 1193 |
| 255 | Ga0207658_10394923 | 3300025986 | Bacteria | 1214 |
| 256 | Ga0207677_10031839 | 3300026023 | Bacteria | 3382 |
| 257 | Ga0207703_10179288 | 3300026035 | Bacteria | 1869 |
| 258 | Ga0207703_10293039 | 3300026035 | Bacteria | 1481 |
| 259 | Ga0207678_10018024 | 3300026067 | Bacteria | 6203 |
| 260 | Ga0207678_10173868 | 3300026067 | Bacteria | 1839 |
| 261 | Ga0207678_10266536 | 3300026067 | Bacteria | 1468 |
| 262 | Ga0207678_10328124 | 3300026067 | Bacteria | 1317 |
| 263 | Ga0207708_10194866 | 3300026075 | Bacteria | 1614 |
| 264 | Ga0207641_10163747 | 3300026088 | Bacteria | 2024 |
| 265 | Ga0207641_10239518 | 3300026088 | Bacteria | 1690 |
| 266 | Ga0207648_10039454 | 3300026089 | Bacteria | 4152 |
| 267 | Ga0207676_10041483 | 3300026095 | Bacteria | 3533 |
| 268 | Ga0207674_10489534 | 3300026116 | Bacteria | 1189 |
| 269 | Ga0207675_100535515 | 3300026118 | Bacteria | 1169 |
| 270 | Ga0207683_10137722 | 3300026121 | Bacteria | 2198 |
| 271 | Ga0207683_10264107 | 3300026121 | Bacteria | 1572 |
| 272 | Ga0209389_1000102 | 3300027296 | Bacteria | 78475 |
| 273 | Ga0209489_100404 | 3300027361 | Bacteria | 78473 |
| 274 | Ga0209700_100408 | 3300027363 | Bacteria | 78496 |
| 275 | Ga0209588_1020217 | 3300027671 | Bacteria | 2084 |
| 276 | Ga0268266_10001335 | 3300028379 | Bacteria | 29884 |
| 277 | Ga0268266_10007399 | 3300028379 | Bacteria | 9916 |
| 278 | Ga0268266_10041505 | 3300028379 | Bacteria | 3926 |
| 279 | Ga0268266_10131781 | 3300028379 | Bacteria | 2236 |
| 280 | Ga0268266_10268529 | 3300028379 | Bacteria | 1583 |
| 281 | Ga0268266_10403715 | 3300028379 | Bacteria | 1292 |
| 282 | Ga0268265_10351825 | 3300028380 | Bacteria | 1345 |
| 283 | Ga0268265_10393734 | 3300028380 | Bacteria | 1278 |
| 284 | Ga0268265_10663750 | 3300028380 | Bacteria | 1003 |
| 285 | Ga0307517_10000232 | 3300028786 | Bacteria | 94332 |
| 286 | Ga0307517_10235784 | 3300028786 | Bacteria | 1092 |
| 287 | Ga0307515_10014473 | 3300028794 | Bacteria | 14620 |
| 288 | Ga0307515_10227436 | 3300028794 | Bacteria | 1667 |
| 289 | Ga0307513_10228685 | 3300031456 | Bacteria | 1674 |
| 290 | Ga0307508_10337453 | 3300031616 | Bacteria | 1099 |
| 291 | Ga0307508_10362687 | 3300031616 | Bacteria | 1040 |
| 292 | Ga0307516_10003539 | 3300031730 | Bacteria | 19976 |
| 293 | Ga0307516_10189204 | 3300031730 | Bacteria | 1785 |
| 294 | Ga0307407_10119493 | 3300031903 | Bacteria | 1668 |
| 295 | Ga0307415_100059673 | 3300032126 | Bacteria | 2632 |
| 296 | Ga0307510_10006006 | 3300033180 | Bacteria | 14485 |
| 297 | Ga0307510_10031035 | 3300033180 | Bacteria | 6045 |
| 298 | Ga0373923_0002828 | 3300035111 | Bacteria | 5435 |
| 299 | Ga0373936_0114110 | 3300035113 | Bacteria | 1149 |
| 300 | Ga0373945_0116258 | 3300035116 | Bacteria | 1060 |
| 301 | Ga0373924_0059621 | 3300035410 | Bacteria | 1594 |
| 302 | Ga0373931_0011946 | 3300035691 | Bacteria | 4201 |
| 303 | Ga0373931_0116542 | 3300035691 | Bacteria | 1522 |
| 304 | Ga0373931_0181362 | 3300035691 | Bacteria | 1247 |
| 305 | Ga0373927_0056083 | 3300035695 | Bacteria | 2547 |
| 306 | Ga0373927_0131622 | 3300035695 | Bacteria | 1634 |
| 307 | Ga0373933_0109287 | 3300035724 | Bacteria | 1723 |
| 308 | Ga0373947_0073801 | 3300035725 | Bacteria | 2097 |
| 309 | Ga0373937_0299585 | 3300036401 | Bacteria | 1519 |
| 310 | Ga0373925_0007366 | 3300037068 | Bacteria | 8029 |
| 311 | Ga0373925_0432033 | 3300037068 | Bacteria | 1077 |
| 312 | Ga0395900_0013918 | 3300037418 | Bacteria | 8211 |
| 313 | Ga0395898_0216683 | 3300037466 | Bacteria | 1826 |
| 314 | Ga0395898_0233678 | 3300037466 | Bacteria | 1753 |
| 315 | Ga0395905_0005023 | 3300037471 | Bacteria | 13625 |
| 316 | Ga0395905_0092570 | 3300037471 | Bacteria | 2835 |
| 317 | Ga0436364_1210479 | 3300037853 | Bacteria | 6917 |
| 318 | Ga0436364_1557054 | 3300037853 | Bacteria | 23701 |
| 319 | Ga0395901_0061354 | 3300038443 | Bacteria | 3912 |
| 320 | Ga0436365_1053579 | 3300039437 | Bacteria | 3004 |
| 321 | Ga0436365_1552613 | 3300039437 | Bacteria | 2091 |
| 322 | Ga0436360_0314278 | 3300039438 | Bacteria | 1102 |
| 323 | Ga0436361_0065851 | 3300039447 | Bacteria | 5607 |
| 324 | Ga0436361_0203807 | 3300039447 | Bacteria | 2005 |
| 325 | Ga0436363_1615506 | 3300039450 | Bacteria | 3328 |
| 326 | Ga0439465_0090232 | 3300041413 | Bacteria | 1048 |
| 327 | Ga0451853_0630845 | 3300041512 | Bacteria | 1143 |
| 328 | Ga0466963_0074583 | 3300044694 | Bacteria | 2288 |
| 329 | Ga0466964_0125131 | 3300044706 | Bacteria | 1164 |
| 330 | Ga0466960_0083184 | 3300044901 | Bacteria | 1617 |
| 331 | Ga0466960_0084589 | 3300044901 | Bacteria | 1605 |
| 332 | Ga0495592_0086820 | 3300046454 | Bacteria | 2252 |
| 333 | Ga0495603_0026994 | 3300046455 | Bacteria | 3467 |
| 334 | Ga0495603_0038286 | 3300046455 | Bacteria | 2876 |
| 335 | Ga0495603_0152586 | 3300046455 | Bacteria | 1341 |
| 336 | Ga0495629_0069802 | 3300046459 | Bacteria | 2452 |
| 337 | Ga0495638_0000880 | 3300046460 | Bacteria | 30953 |
| 338 | Ga0495638_0016028 | 3300046460 | Bacteria | 5022 |
| 339 | Ga0495650_0120184 | 3300046471 | Bacteria | 968 |
| 340 | Ga0495580_0008306 | 3300046472 | Bacteria | 8262 |
| 341 | Ga0495582_0125826 | 3300046473 | Bacteria | 1446 |
| 342 | Ga0495639_0174414 | 3300046475 | Bacteria | 1045 |
| 343 | Ga0495664_0076788 | 3300046477 | Bacteria | 1999 |
| 344 | Ga0495664_0196285 | 3300046477 | Bacteria | 1223 |
| 345 | Ga0495607_0046038 | 3300046501 | Bacteria | 2564 |
| 346 | Ga0495606_0027491 | 3300046507 | Bacteria | 4033 |
| 347 | Ga0495606_0177447 | 3300046507 | Bacteria | 1231 |
| 348 | Ga0495606_0233003 | 3300046507 | Bacteria | 1031 |
| 349 | Ga0495608_0097163 | 3300046511 | Bacteria | 1901 |
| 350 | Ga0495618_0217781 | 3300046514 | Bacteria | 1205 |
| 351 | Ga0495628_0039866 | 3300046516 | Bacteria | 3756 |
| 352 | Ga0495630_0245660 | 3300046517 | Bacteria | 1367 |
| 353 | Ga0495630_0300701 | 3300046517 | Bacteria | 1226 |
| 354 | Ga0495631_0044402 | 3300046518 | Bacteria | 1958 |
| 355 | Ga0495648_0166067 | 3300046524 | Bacteria | 1136 |
| 356 | Ga0495648_0251686 | 3300046524 | Bacteria | 852 |
| 357 | Ga0495666_0184384 | 3300046526 | Bacteria | 963 |
| 358 | Ga0495665_0059931 | 3300046531 | Bacteria | 2009 |
| 359 | Ga0495640_0094732 | 3300046533 | Bacteria | 1966 |
| 360 | Ga0495586_0066391 | 3300046535 | Bacteria | 1967 |
| 361 | Ga0495645_0235879 | 3300046543 | Bacteria | 1223 |
| 362 | Ga0495622_0134533 | 3300046557 | Bacteria | 1124 |
| 363 | Ga0495633_0163055 | 3300046558 | Bacteria | 1028 |
| 364 | Ga0495667_0254202 | 3300046559 | Bacteria | 1118 |
| 365 | Ga0495668_0041407 | 3300046616 | Bacteria | 2566 |
| 366 | Ga0495668_0072360 | 3300046616 | Bacteria | 1894 |
| 367 | Ga0495668_0095614 | 3300046616 | Bacteria | 1626 |
| 368 | Ga0495668_0112011 | 3300046616 | Bacteria | 1492 |
| 369 | Ga0495634_0007375 | 3300046642 | Bacteria | 8275 |
| 370 | Ga0495635_0038630 | 3300046663 | Bacteria | 3304 |
| 371 | Ga0495588_0048023 | 3300046674 | Bacteria | 2193 |
| 372 | Ga0495599_0103854 | 3300046678 | Bacteria | 1771 |
| 373 | Ga0495623_0135665 | 3300046679 | Bacteria | 1469 |
| 374 | Ga0495647_0047425 | 3300046681 | Bacteria | 1658 |
| 375 | Ga0495658_0082202 | 3300046683 | Bacteria | 1892 |
| 376 | Ga0495658_0228587 | 3300046683 | Bacteria | 1166 |
| 377 | Ga0495669_0124823 | 3300046684 | Bacteria | 1209 |
| 378 | Ga0495669_0152493 | 3300046684 | Bacteria | 1094 |
| 379 | Ga0495670_0158017 | 3300046691 | Bacteria | 1190 |
| 380 | Ga0495600_0105711 | 3300046809 | Bacteria | 1834 |
| 381 | Ga0495660_0135853 | 3300046810 | Bacteria | 1229 |
| 382 | Ga0495604_0152879 | 3300047317 | Bacteria | 1638 |
| 383 | Ga0495604_0170620 | 3300047317 | Bacteria | 1530 |
| 384 | Ga0495674_0030756 | 3300047319 | Bacteria | 4879 |
| 385 | Ga0495674_0355654 | 3300047319 | Bacteria | 1188 |
| 386 | Ga0495676_0114377 | 3300047321 | Bacteria | 1974 |
| 387 | Ga0495680_0033981 | 3300047322 | Bacteria | 4125 |
| 388 | Ga0495683_0084414 | 3300047323 | Bacteria | 1545 |
| 389 | Ga0495673_0059562 | 3300047469 | Bacteria | 1641 |
| 390 | Ga0495684_0046672 | 3300047471 | Bacteria | 3313 |
| 391 | Ga0495686_0035021 | 3300047472 | Bacteria | 3230 |
| 392 | Ga0495686_0065554 | 3300047472 | Bacteria | 2245 |
| 393 | Ga0495686_0206115 | 3300047472 | Bacteria | 1126 |
| 394 | Ga0496101_0052618 | 3300048904 | Bacteria | 2936 |
| 395 | Ga0496101_0064543 | 3300048904 | Bacteria | 2667 |
| 396 | Ga0496101_0142579 | 3300048904 | Bacteria | 1827 |
| 397 | Ga0496101_0483125 | 3300048904 | Bacteria | 978 |
| 398 | Ga0496102_0086858 | 3300048905 | Bacteria | 2889 |
| 399 | Ga0496102_0154865 | 3300048905 | Bacteria | 2154 |
| 400 | Ga0496102_0276551 | 3300048905 | Bacteria | 1582 |
| 401 | Ga0496102_0760026 | 3300048905 | Bacteria | 892 |
| 402 | Ga0496103_0007418 | 3300048906 | Bacteria | 6536 |
| 403 | Ga0496103_0166258 | 3300048906 | Bacteria | 1415 |
| 404 | Ga0496104_0116558 | 3300048907 | Bacteria | 2563 |
| 405 | Ga0496105_0076445 | 3300048908 | Bacteria | 2764 |
| 406 | Ga0496106_0108762 | 3300048909 | Bacteria | 2156 |
| 407 | Ga0496106_0166362 | 3300048909 | Bacteria | 1746 |
| 408 | Ga0496107_0014960 | 3300048910 | Bacteria | 5434 |
| 409 | Ga0496107_0039070 | 3300048910 | Bacteria | 3404 |
| 410 | Ga0496107_0246619 | 3300048910 | Bacteria | 1329 |
| 411 | Ga0496107_0273407 | 3300048910 | Bacteria | 1257 |
| 412 | Ga0496107_0340372 | 3300048910 | Bacteria | 1116 |
| 413 | Ga0496108_0019609 | 3300048911 | Bacteria | 5555 |
| 414 | Ga0496109_0033949 | 3300048912 | Bacteria | 4591 |
| 415 | Ga0496110_0026542 | 3300048913 | Bacteria | 4958 |
| 416 | Ga0496110_0072012 | 3300048913 | Bacteria | 3066 |
| 417 | Ga0496110_0373117 | 3300048913 | Bacteria | 1300 |
| 418 | Ga0496112_0015093 | 3300048915 | Bacteria | 7195 |
| 419 | Ga0496112_0086931 | 3300048915 | Bacteria | 3093 |
| 420 | Ga0496112_0329513 | 3300048915 | Bacteria | 1471 |
| 421 | Ga0496112_0493312 | 3300048915 | Bacteria | 1160 |
| 422 | Ga0496113_0043069 | 3300048916 | Bacteria | 3338 |
| 423 | Ga0496113_0158851 | 3300048916 | Bacteria | 1786 |
| 424 | Ga0496113_0198708 | 3300048916 | Bacteria | 1593 |
| 425 | Ga0496113_0696067 | 3300048916 | Bacteria | 811 |
| 426 | Ga0496114_0156448 | 3300048917 | Bacteria | 1979 |
| 427 | Ga0496114_0334799 | 3300048917 | Bacteria | 1338 |
| 428 | Ga0496115_0035724 | 3300048918 | Bacteria | 3933 |
| 429 | Ga0496117_0217221 | 3300048920 | Bacteria | 1067 |
| 430 | Ga0496118_0130421 | 3300048921 | Bacteria | 1615 |
| 431 | Ga0496119_0044301 | 3300048922 | Bacteria | 2803 |
| 432 | Ga0496121_0000278 | 3300048924 | Bacteria | 106838 |
| 433 | Ga0496121_0122719 | 3300048924 | Bacteria | 1959 |
| 434 | Ga0496121_0284956 | 3300048924 | Bacteria | 1128 |
| 435 | Ga0496122_0151453 | 3300048925 | Bacteria | 1431 |
| 436 | Ga0496124_0305261 | 3300048927 | Bacteria | 1147 |
| 437 | Ga0496125_0037843 | 3300048928 | Bacteria | 4189 |
| 438 | Ga0496125_0120877 | 3300048928 | Bacteria | 1869 |
| 439 | Ga0496126_0009449 | 3300048929 | Bacteria | 10350 |
| 440 | Ga0496126_0012242 | 3300048929 | Bacteria | 8800 |
| 441 | Ga0496126_0050659 | 3300048929 | Bacteria | 3783 |
| 442 | Ga0496126_0057355 | 3300048929 | Bacteria | 3516 |
| 443 | Ga0496126_0074141 | 3300048929 | Bacteria | 3023 |
| 444 | Ga0496126_0127219 | 3300048929 | Bacteria | 2204 |
| 445 | Ga0496126_0170929 | 3300048929 | Bacteria | 1852 |
| 446 | Ga0496126_0223286 | 3300048929 | Bacteria | 1581 |
| 447 | Ga0496126_0229433 | 3300048929 | Bacteria | 1556 |
| 448 | Ga0496126_0313338 | 3300048929 | Bacteria | 1291 |
| 449 | Ga0496126_0446454 | 3300048929 | Bacteria | 1042 |
| 450 | Ga0501040_0254531 | 3300049576 | Bacteria | 1253 |
| 451 | Ga0501047_0023892 | 3300049581 | Bacteria | 5870 |
| 452 | Ga0501070_0380293 | 3300049586 | Bacteria | 1144 |
| 453 | Ga0501076_0058517 | 3300049592 | Bacteria | 3064 |
| 454 | Ga0501076_0331795 | 3300049592 | Bacteria | 1248 |
| 455 | Ga0501080_0016386 | 3300049742 | Bacteria | 6845 |
| 456 | Ga0501044_0017585 | 3300049823 | Bacteria | 7669 |
| 457 | nmdc:mga03n38_12446_c1 | 3300050490 | Bacteria | 3202 |
| 458 | nmdc:mga00v17_91427_c1 | 3300050491 | Bacteria | 1912 |
| 459 | nmdc:mga0yw44_284956_c1 | 3300050492 | Bacteria | 1105 |
| 460 | nmdc:mga0yw44_31098_c1 | 3300050492 | Bacteria | 3101 |
| 461 | nmdc:mga0k408_14290_c1 | 3300050493 | Bacteria | 4371 |
| 462 | nmdc:mga06z11_10188_c1 | 3300050494 | Bacteria | 3993 |
| 463 | nmdc:mga07m45_11611_c1 | 3300050496 | Bacteria | 4631 |
| 464 | nmdc:mga07m45_131205_c1 | 3300050496 | Bacteria | 1450 |
| 465 | nmdc:mga07m45_44347_c1 | 3300050496 | Bacteria | 2496 |
| 466 | nmdc:mga05p37_366330_c1 | 3300050507 | Bacteria | 1692 |
| 467 | nmdc:mga0n895_193078_c1 | 3300050512 | Bacteria | 2067 |
| 468 | nmdc:mga0rr50_206933_c1 | 3300050513 | Bacteria | 1615 |
| 469 | nmdc:mga08x19_70835_c1 | 3300050514 | Bacteria | 2272 |
| 470 | nmdc:mga0a205_274433_c1 | 3300050515 | Bacteria | 1562 |
| 471 | nmdc:mga0sz30_97188_c2 | 3300050516 | Bacteria | 1034 |
| 472 | Ga0495619_0075885 | 3300053085 | Bacteria | 2256 |
| 473 | Ga0500643_000112 | 3300053087 | Bacteria | 84793 |
| 474 | Ga0500566_0000262 | 3300053094 | Bacteria | 28125 |
| 475 | Ga0500566_0001195 | 3300053094 | Bacteria | 15155 |
| 476 | Ga0500566_0043727 | 3300053094 | Bacteria | 2580 |
| 477 | Ga0500641_0053787 | 3300053096 | Bacteria | 1663 |
| 478 | Ga0500555_049746 | 3300053103 | Bacteria | 1149 |
| 479 | Ga0500556_0013991 | 3300053104 | Bacteria | 2441 |
| 480 | Ga0500569_020432 | 3300053109 | Bacteria | 1738 |
| 481 | Ga0500572_004331 | 3300053111 | Bacteria | 3222 |
| 482 | Ga0500595_000510 | 3300053119 | Bacteria | 23431 |
| 483 | Ga0500595_006468 | 3300053119 | Bacteria | 4966 |
| 484 | Ga0500595_007359 | 3300053119 | Bacteria | 4572 |
| 485 | Ga0500621_133385 | 3300053126 | Bacteria | 950 |
| 486 | Ga0500568_0024502 | 3300053139 | Bacteria | 2555 |
| 487 | Ga0500603_034509 | 3300053150 | Bacteria | 1322 |
| 488 | Ga0500604_0051318 | 3300053151 | Bacteria | 1274 |
| 489 | Ga0500616_0051130 | 3300053153 | Bacteria | 2179 |
| 490 | Ga0500622_0018162 | 3300053156 | Bacteria | 3740 |
| 491 | Ga0500637_0033859 | 3300053178 | Bacteria | 2855 |
| 492 | Ga0500596_002288 | 3300053735 | Bacteria | 3790 |
| 493 | Ga0500601_000103 | 3300053737 | Bacteria | 17658 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053085 | Ga0495619_0075885 | Ga0495619_0075885_1184_2056 | 241 |
| 2 | 3300046507 | Ga0495606_0233003 | Ga0495606_0233003_236_1021 | 261 |
| 3 | 3300048916 | Ga0496113_0696067 | Ga0496113_0696067_13_798 | 261 |
| 4 | 3300046524 | Ga0495648_0251686 | Ga0495648_0251686_34_822 | 262 |
| 5 | 3300013105 | Ga0157369_10100287 | Ga0157369_101002872 | 266 |
| 6 | 3300046691 | Ga0495670_0158017 | Ga0495670_0158017_20_832 | 270 |
| 7 | 3300048929 | Ga0496126_0446454 | Ga0496126_0446454_44_907 | 270 |
| 8 | 3300050492 | nmdc:mga0yw44_284956_c1 | nmdc:mga0yw44_284956_c1_277_1089 | 270 |
| 9 | 3300053126 | Ga0500621_133385 | Ga0500621_133385_18_830 | 270 |
| 10 | 3300006852 | Ga0075433_10337240 | Ga0075433_103372402 | 271 |
| 11 | 3300048905 | Ga0496102_0760026 | Ga0496102_0760026_11_832 | 273 |
| 12 | 3300025939 | Ga0207665_10002143 | Ga0207665_100021439 | 275 |
| 13 | 3300048924 | Ga0496121_0284956 | Ga0496121_0284956_49_888 | 276 |
| 14 | 3300037466 | Ga0395898_0216683 | Ga0395898_0216683_791_1627 | 278 |
| 15 | 3300037471 | Ga0395905_0092570 | Ga0395905_0092570_1858_2694 | 278 |
| 16 | 3300046454 | Ga0495592_0086820 | Ga0495592_0086820_92_949 | 278 |
| 17 | 3300048929 | Ga0496126_0229433 | Ga0496126_0229433_432_1334 | 279 |
| 18 | 3300047322 | Ga0495680_0033981 | Ga0495680_0033981_3022_3885 | 280 |
| 19 | iso_pu_bacteria | 2861691609 | 2861695531 | 281 |
| 20 | 3300025928 | Ga0207700_10019075 | Ga0207700_100190751 | 282 |
| 21 | 3300025942 | Ga0207689_10256320 | Ga0207689_102563203 | 283 |
| 22 | 3300050513 | nmdc:mga0rr50_206933_c1 | nmdc:mga0rr50_206933_c1_148_1011 | 283 |
| 23 | 3300050514 | nmdc:mga08x19_70835_c1 | nmdc:mga08x19_70835_c1_571_1434 | 283 |
| 24 | 3300050515 | nmdc:mga0a205_274433_c1 | nmdc:mga0a205_274433_c1_442_1305 | 283 |
| 25 | 3300053151 | Ga0500604_0051318 | Ga0500604_0051318_238_1089 | 283 |
| 26 | iso_pu_bacteria | 2513237092 | 2513623888 | 283 |
| 27 | iso_pu_bacteria | 2517572143 | 2517889085 | 283 |
| 28 | iso_pu_bacteria | 2524023205 | 2524441478 | 283 |
| 29 | iso_pu_bacteria | 2528768022 | 2528852695 | 283 |
| 30 | iso_pu_bacteria | 2617270741 | 2617373494 | 283 |
| 31 | iso_pu_bacteria | 2728368998 | 2728755251 | 283 |
| 32 | iso_pu_bacteria | 2744054633 | 2745077612 | 283 |
| 33 | iso_pu_bacteria | 2791355197 | 2793072674 | 283 |
| 34 | iso_pu_bacteria | 2791355199 | 2793078265 | 283 |
| 35 | iso_pu_bacteria | 2824653114 | 2824656333 | 283 |
| 36 | iso_pu_bacteria | 2824679649 | 2824684703 | 283 |
| 37 | iso_pu_bacteria | 2824704595 | 2824710353 | 283 |
| 38 | iso_pu_bacteria | 2824732956 | 2824737653 | 283 |
| 39 | iso_pu_bacteria | 2824746037 | 2824751175 | 283 |
| 40 | iso_pu_bacteria | 2824753945 | 2824760689 | 283 |
| 41 | iso_pu_bacteria | 2824763712 | 2824768493 | 283 |
| 42 | iso_pu_bacteria | 2841957949 | 2841965310 | 283 |
| 43 | iso_pu_bacteria | 2847930680 | 2847931284 | 283 |
| 44 | iso_pu_bacteria | 2857509624 | 2857516316 | 283 |
| 45 | iso_pu_bacteria | 2874612657 | 2874618680 | 283 |
| 46 | iso_pu_bacteria | 2874628541 | 2874628566 | 283 |
| 47 | iso_pu_bacteria | 2879083081 | 2879083807 | 283 |
| 48 | iso_pu_bacteria | 2879110137 | 2879113269 | 283 |
| 49 | iso_pu_bacteria | 2881364244 | 2881368963 | 283 |
| 50 | iso_pu_bacteria | 2881665667 | 2881666522 | 283 |
| 51 | iso_pu_bacteria | 2885374607 | 2885377593 | 283 |
| 52 | iso_pu_bacteria | 2885383462 | 2885385892 | 283 |
| 53 | iso_pu_bacteria | 2885409591 | 2885417958 | 283 |
| 54 | iso_pu_bacteria | 2888388044 | 2888390464 | 283 |
| 55 | iso_pu_bacteria | 2888419890 | 2888420084 | 283 |
| 56 | iso_pu_bacteria | 2889033259 | 2889035267 | 283 |
| 57 | iso_pu_bacteria | 2904711408 | 2904716291 | 283 |
| 58 | iso_pu_bacteria | 2906643746 | 2906648373 | 283 |
| 59 | iso_pu_bacteria | 2908739725 | 2908747690 | 283 |
| 60 | iso_pu_bacteria | 2908756301 | 2908757027 | 283 |
| 61 | iso_pu_bacteria | 2908775508 | 2908775965 | 283 |
| 62 | iso_pu_bacteria | 2922368715 | 2922369345 | 283 |
| 63 | iso_pu_bacteria | 2922393267 | 2922396544 | 283 |
| 64 | iso_pu_bacteria | 2929199973 | 2929203046 | 283 |
| 65 | iso_pu_bacteria | 2929615660 | 2929618827 | 283 |
| 66 | iso_pu_bacteria | 2929624759 | 2929628488 | 283 |
| 67 | iso_pu_bacteria | 2932784394 | 2932791004 | 283 |
| 68 | iso_pu_bacteria | 2932794094 | 2932794107 | 283 |
| 69 | iso_pu_bacteria | 2932801729 | 2932809182 | 283 |
| 70 | iso_pu_bacteria | 2932828146 | 2932833720 | 283 |
| 71 | iso_pu_bacteria | 2933577622 | 2933580463 | 283 |
| 72 | iso_pu_bacteria | 2935616580 | 2935623247 | 283 |
| 73 | iso_pu_bacteria | 2935630451 | 2935636004 | 283 |
| 74 | iso_pu_bacteria | 2935638405 | 2935644321 | 283 |
| 75 | iso_pu_bacteria | 2935665750 | 2935674962 | 283 |
| 76 | iso_pu_bacteria | 2935675223 | 2935679380 | 283 |
| 77 | iso_pu_bacteria | 2935684952 | 2935686622 | 283 |
| 78 | iso_pu_bacteria | 2935694250 | 2935700405 | 283 |
| 79 | iso_pu_bacteria | 2935703347 | 2935710354 | 283 |
| 80 | iso_pu_bacteria | 2935713505 | 2935716310 | 283 |
| 81 | iso_pu_bacteria | 2935722832 | 2935723566 | 283 |
| 82 | iso_pu_bacteria | 2935732158 | 2935735121 | 283 |
| 83 | iso_pu_bacteria | 2935741537 | 2935744088 | 283 |
| 84 | iso_pu_bacteria | 2935750917 | 2935752588 | 283 |
| 85 | iso_pu_bacteria | 2935801545 | 2935808345 | 283 |
| 86 | iso_pu_bacteria | 2935827899 | 2935833435 | 283 |
| 87 | iso_pu_bacteria | 2935837841 | 2935846007 | 283 |
| 88 | iso_pu_bacteria | 2935855204 | 2935861495 | 283 |
| 89 | iso_pu_bacteria | 2935864058 | 2935869614 | 283 |
| 90 | iso_pu_bacteria | 2935873716 | 2935879943 | 283 |
| 91 | iso_pu_bacteria | 2935883170 | 2935889134 | 283 |
| 92 | iso_pu_bacteria | 2935959822 | 2935966680 | 283 |
| 93 | iso_pu_bacteria | 2935992306 | 2935997835 | 283 |
| 94 | iso_pu_bacteria | 2936002035 | 2936008900 | 283 |
| 95 | iso_pu_bacteria | 2940556831 | 2940558501 | 283 |
| 96 | iso_pu_bacteria | 2941507105 | 2941512692 | 283 |
| 97 | iso_pu_bacteria | 2941515067 | 2941520470 | 283 |
| 98 | iso_pu_bacteria | 2941523033 | 2941528484 | 283 |
| 99 | iso_pu_bacteria | 2941538514 | 2941547112 | 283 |
| 100 | iso_pu_bacteria | 3005483717 | 3005486636 | 283 |
| 101 | iso_pu_bacteria | 3005587118 | 3005593255 | 283 |
| 102 | iso_pu_bacteria | 3005594810 | 3005595273 | 283 |
| 103 | iso_pu_bacteria | 3005718088 | 3005718520 | 283 |
| 104 | iso_pu_bacteria | 8006926726 | 8006927287 | 283 |
| 105 | iso_pu_bacteria | 8006984368 | 8006991143 | 283 |
| 106 | iso_pu_bacteria | 8016511872 | 8016517950 | 283 |
| 107 | iso_pu_bacteria | 8017057580 | 8017058688 | 283 |
| 108 | iso_pu_bacteria | 8019576017 | 8019576966 | 283 |
| 109 | iso_pu_bacteria | 8019586578 | 8019595032 | 283 |
| 110 | iso_pu_bacteria | 8019597564 | 8019606712 | 283 |
| 111 | iso_pu_bacteria | 8019608314 | 8019611798 | 283 |
| 112 | iso_pu_bacteria | 8019648815 | 8019652241 | 283 |
| 113 | iso_pu_bacteria | 8055742211 | 8055742676 | 283 |
| 114 | iso_pu_bacteria | 8055909800 | 8055912808 | 283 |
| 115 | 3300005329 | Ga0070683_100004493 | Ga0070683_10000449312 | 285 |
| 116 | 3300005336 | Ga0070680_100084955 | Ga0070680_1000849551 | 285 |
| 117 | 3300005434 | Ga0070709_10205373 | Ga0070709_102053732 | 285 |
| 118 | 3300005455 | Ga0070663_100524167 | Ga0070663_1005241671 | 285 |
| 119 | 3300005458 | Ga0070681_10004178 | Ga0070681_1000417818 | 285 |
| 120 | 3300005530 | Ga0070679_100143811 | Ga0070679_1001438112 | 285 |
| 121 | 3300005535 | Ga0070684_100017771 | Ga0070684_1000177717 | 285 |
| 122 | 3300005563 | Ga0068855_100321361 | Ga0068855_1003213611 | 285 |
| 123 | 3300005577 | Ga0068857_100262780 | Ga0068857_1002627802 | 285 |
| 124 | 3300006175 | Ga0070712_100205057 | Ga0070712_1002050572 | 285 |
| 125 | 3300009093 | Ga0105240_10083500 | Ga0105240_100835002 | 285 |
| 126 | 3300009174 | Ga0105241_10131574 | Ga0105241_101315742 | 285 |
| 127 | 3300009545 | Ga0105237_10328542 | Ga0105237_103285422 | 285 |
| 128 | 3300013105 | Ga0157369_10106771 | Ga0157369_101067712 | 285 |
| 129 | 3300013307 | Ga0157372_10598202 | Ga0157372_105982021 | 285 |
| 130 | 3300025911 | Ga0207654_10035660 | Ga0207654_100356601 | 285 |
| 131 | 3300025912 | Ga0207707_10001922 | Ga0207707_1000192217 | 285 |
| 132 | 3300025912 | Ga0207707_10004003 | Ga0207707_100040035 | 285 |
| 133 | 3300025916 | Ga0207663_10302644 | Ga0207663_103026441 | 285 |
| 134 | 3300025939 | Ga0207665_10029872 | Ga0207665_100298724 | 285 |
| 135 | 3300025949 | Ga0207667_10390788 | Ga0207667_103907882 | 285 |
| 136 | 3300026116 | Ga0207674_10489534 | Ga0207674_104895341 | 285 |
| 137 | 3300031730 | Ga0307516_10189204 | Ga0307516_101892042 | 285 |
| 138 | 3300035111 | Ga0373923_0002828 | Ga0373923_0002828_2285_3145 | 285 |
| 139 | 3300035410 | Ga0373924_0059621 | Ga0373924_0059621_466_1356 | 285 |
| 140 | 3300035695 | Ga0373927_0131622 | Ga0373927_0131622_669_1529 | 285 |
| 141 | 3300035724 | Ga0373933_0109287 | Ga0373933_0109287_218_1078 | 285 |
| 142 | 3300035725 | Ga0373947_0073801 | Ga0373947_0073801_589_1449 | 285 |
| 143 | 3300036401 | Ga0373937_0299585 | Ga0373937_0299585_390_1250 | 285 |
| 144 | 3300037068 | Ga0373925_0007366 | Ga0373925_0007366_585_1445 | 285 |
| 145 | 3300039447 | Ga0436361_0065851 | Ga0436361_0065851_1721_2578 | 285 |
| 146 | 3300044694 | Ga0466963_0074583 | Ga0466963_0074583_1076_1936 | 285 |
| 147 | 3300044706 | Ga0466964_0125131 | Ga0466964_0125131_261_1121 | 285 |
| 148 | 3300046472 | Ga0495580_0008306 | Ga0495580_0008306_823_1683 | 285 |
| 149 | 3300046473 | Ga0495582_0125826 | Ga0495582_0125826_106_966 | 285 |
| 150 | 3300046477 | Ga0495664_0076788 | Ga0495664_0076788_700_1560 | 285 |
| 151 | 3300046511 | Ga0495608_0097163 | Ga0495608_0097163_629_1489 | 285 |
| 152 | 3300046514 | Ga0495618_0217781 | Ga0495618_0217781_236_1096 | 285 |
| 153 | 3300046516 | Ga0495628_0039866 | Ga0495628_0039866_2003_2863 | 285 |
| 154 | 3300046517 | Ga0495630_0245660 | Ga0495630_0245660_200_1060 | 285 |
| 155 | 3300046531 | Ga0495665_0059931 | Ga0495665_0059931_443_1303 | 285 |
| 156 | 3300046533 | Ga0495640_0094732 | Ga0495640_0094732_559_1419 | 285 |
| 157 | 3300046535 | Ga0495586_0066391 | Ga0495586_0066391_1062_1949 | 285 |
| 158 | 3300046543 | Ga0495645_0235879 | Ga0495645_0235879_138_1028 | 285 |
| 159 | 3300046642 | Ga0495634_0007375 | Ga0495634_0007375_403_1263 | 285 |
| 160 | 3300046663 | Ga0495635_0038630 | Ga0495635_0038630_126_1016 | 285 |
| 161 | 3300046678 | Ga0495599_0103854 | Ga0495599_0103854_623_1483 | 285 |
| 162 | 3300046679 | Ga0495623_0135665 | Ga0495623_0135665_453_1313 | 285 |
| 163 | 3300046681 | Ga0495647_0047425 | Ga0495647_0047425_755_1615 | 285 |
| 164 | 3300046683 | Ga0495658_0082202 | Ga0495658_0082202_763_1623 | 285 |
| 165 | 3300047317 | Ga0495604_0170620 | Ga0495604_0170620_151_1041 | 285 |
| 166 | 3300047319 | Ga0495674_0030756 | Ga0495674_0030756_1909_2769 | 285 |
| 167 | 3300047471 | Ga0495684_0046672 | Ga0495684_0046672_1862_2722 | 285 |
| 168 | 3300048917 | Ga0496114_0334799 | Ga0496114_0334799_125_1024 | 285 |
| 169 | 3300048924 | Ga0496121_0122719 | Ga0496121_0122719_887_1747 | 285 |
| 170 | 3300031456 | Ga0307513_10228685 | Ga0307513_102286852 | 286 |
| 171 | 3300048929 | Ga0496126_0127219 | Ga0496126_0127219_146_1009 | 286 |
| 172 | iso_pu_bacteria | 2595698237 | 2596375655 | 286 |
| 173 | iso_pu_bacteria | 2928125067 | 2928130153 | 286 |
| 174 | 3300002077 | JGI24744J21845_10026689 | JGI24744J21845_100266891 | 287 |
| 175 | 3300003203 | JGI25406J46586_10000256 | JGI25406J46586_100002568 | 287 |
| 176 | 3300003354 | JGI25160J50197_1010119 | JGI25160J50197_10101194 | 287 |
| 177 | 3300003659 | JGI25404J52841_10030083 | JGI25404J52841_100300832 | 287 |
| 178 | 3300005328 | Ga0070676_10051365 | Ga0070676_100513652 | 287 |
| 179 | 3300005329 | Ga0070683_100225276 | Ga0070683_1002252763 | 287 |
| 180 | 3300005329 | Ga0070683_100267135 | Ga0070683_1002671352 | 287 |
| 181 | 3300005334 | Ga0068869_100231800 | Ga0068869_1002318003 | 287 |
| 182 | 3300005336 | Ga0070680_100172832 | Ga0070680_1001728321 | 287 |
| 183 | 3300005338 | Ga0068868_100063413 | Ga0068868_1000634133 | 287 |
| 184 | 3300005344 | Ga0070661_100215637 | Ga0070661_1002156373 | 287 |
| 185 | 3300005347 | Ga0070668_100064385 | Ga0070668_1000643852 | 287 |
| 186 | 3300005347 | Ga0070668_100391541 | Ga0070668_1003915411 | 287 |
| 187 | 3300005347 | Ga0070668_100531356 | Ga0070668_1005313561 | 287 |
| 188 | 3300005355 | Ga0070671_100211609 | Ga0070671_1002116092 | 287 |
| 189 | 3300005356 | Ga0070674_100437666 | Ga0070674_1004376661 | 287 |
| 190 | 3300005366 | Ga0070659_100229930 | Ga0070659_1002299302 | 287 |
| 191 | 3300005367 | Ga0070667_100329723 | Ga0070667_1003297232 | 287 |
| 192 | 3300005434 | Ga0070709_10248826 | Ga0070709_102488262 | 287 |
| 193 | 3300005436 | Ga0070713_100017781 | Ga0070713_1000177817 | 287 |
| 194 | 3300005436 | Ga0070713_100035194 | Ga0070713_1000351942 | 287 |
| 195 | 3300005436 | Ga0070713_100664969 | Ga0070713_1006649691 | 287 |
| 196 | 3300005437 | Ga0070710_10013404 | Ga0070710_100134041 | 287 |
| 197 | 3300005437 | Ga0070710_10066561 | Ga0070710_100665613 | 287 |
| 198 | 3300005437 | Ga0070710_10110412 | Ga0070710_101104121 | 287 |
| 199 | 3300005439 | Ga0070711_100024466 | Ga0070711_1000244662 | 287 |
| 200 | 3300005439 | Ga0070711_100092851 | Ga0070711_1000928513 | 287 |
| 201 | 3300005439 | Ga0070711_100214900 | Ga0070711_1002149002 | 287 |
| 202 | 3300005455 | Ga0070663_100084709 | Ga0070663_1000847093 | 287 |
| 203 | 3300005455 | Ga0070663_100128118 | Ga0070663_1001281182 | 287 |
| 204 | 3300005455 | Ga0070663_100152397 | Ga0070663_1001523972 | 287 |
| 205 | 3300005456 | Ga0070678_100068347 | Ga0070678_1000683473 | 287 |
| 206 | 3300005456 | Ga0070678_100088081 | Ga0070678_1000880813 | 287 |
| 207 | 3300005456 | Ga0070678_100098874 | Ga0070678_1000988742 | 287 |
| 208 | 3300005456 | Ga0070678_100409735 | Ga0070678_1004097352 | 287 |
| 209 | 3300005458 | Ga0070681_10506463 | Ga0070681_105064631 | 287 |
| 210 | 3300005468 | Ga0070707_100254287 | Ga0070707_1002542873 | 287 |
| 211 | 3300005471 | Ga0070698_100296410 | Ga0070698_1002964101 | 287 |
| 212 | 3300005530 | Ga0070679_100085452 | Ga0070679_1000854524 | 287 |
| 213 | 3300005535 | Ga0070684_100008530 | Ga0070684_10000853010 | 287 |
| 214 | 3300005543 | Ga0070672_100274030 | Ga0070672_1002740302 | 287 |
| 215 | 3300005543 | Ga0070672_100311923 | Ga0070672_1003119232 | 287 |
| 216 | 3300005546 | Ga0070696_100092391 | Ga0070696_1000923911 | 287 |
| 217 | 3300005548 | Ga0070665_100007488 | Ga0070665_1000074884 | 287 |
| 218 | 3300005548 | Ga0070665_100056755 | Ga0070665_1000567554 | 287 |
| 219 | 3300005548 | Ga0070665_100164203 | Ga0070665_1001642032 | 287 |
| 220 | 3300005548 | Ga0070665_100309934 | Ga0070665_1003099342 | 287 |
| 221 | 3300005548 | Ga0070665_100556015 | Ga0070665_1005560152 | 287 |
| 222 | 3300005548 | Ga0070665_100604721 | Ga0070665_1006047212 | 287 |
| 223 | 3300005563 | Ga0068855_100142216 | Ga0068855_1001422162 | 287 |
| 224 | 3300005564 | Ga0070664_100070506 | Ga0070664_1000705064 | 287 |
| 225 | 3300005564 | Ga0070664_100233122 | Ga0070664_1002331222 | 287 |
| 226 | 3300005614 | Ga0068856_100158774 | Ga0068856_1001587742 | 287 |
| 227 | 3300005614 | Ga0068856_100167938 | Ga0068856_1001679383 | 287 |
| 228 | 3300005614 | Ga0068856_100171369 | Ga0068856_1001713692 | 287 |
| 229 | 3300005615 | Ga0070702_100082056 | Ga0070702_1000820561 | 287 |
| 230 | 3300005616 | Ga0068852_100088408 | Ga0068852_1000884082 | 287 |
| 231 | 3300005616 | Ga0068852_100237125 | Ga0068852_1002371252 | 287 |
| 232 | 3300005616 | Ga0068852_100332500 | Ga0068852_1003325002 | 287 |
| 233 | 3300005618 | Ga0068864_100055366 | Ga0068864_1000553662 | 287 |
| 234 | 3300005719 | Ga0068861_100248587 | Ga0068861_1002485872 | 287 |
| 235 | 3300005719 | Ga0068861_100253242 | Ga0068861_1002532422 | 287 |
| 236 | 3300005834 | Ga0068851_10132809 | Ga0068851_101328091 | 287 |
| 237 | 3300005841 | Ga0068863_100169065 | Ga0068863_1001690651 | 287 |
| 238 | 3300005842 | Ga0068858_100137134 | Ga0068858_1001371342 | 287 |
| 239 | 3300005843 | Ga0068860_100012321 | Ga0068860_1000123216 | 287 |
| 240 | 3300005843 | Ga0068860_100650921 | Ga0068860_1006509211 | 287 |
| 241 | 3300005844 | Ga0068862_100083456 | Ga0068862_1000834562 | 287 |
| 242 | 3300005844 | Ga0068862_100185626 | Ga0068862_1001856262 | 287 |
| 243 | 3300005844 | Ga0068862_100383487 | Ga0068862_1003834872 | 287 |
| 244 | 3300005937 | Ga0081455_10013159 | Ga0081455_100131599 | 287 |
| 245 | 3300005937 | Ga0081455_10102881 | Ga0081455_101028813 | 287 |
| 246 | 3300005937 | Ga0081455_10195921 | Ga0081455_101959212 | 287 |
| 247 | 3300005937 | Ga0081455_10228712 | Ga0081455_102287122 | 287 |
| 248 | 3300005983 | Ga0081540_1002532 | Ga0081540_100253210 | 287 |
| 249 | 3300005983 | Ga0081540_1004042 | Ga0081540_10040427 | 287 |
| 250 | 3300005983 | Ga0081540_1005765 | Ga0081540_10057653 | 287 |
| 251 | 3300005983 | Ga0081540_1012681 | Ga0081540_10126811 | 287 |
| 252 | 3300005983 | Ga0081540_1026337 | Ga0081540_10263373 | 287 |
| 253 | 3300005983 | Ga0081540_1030647 | Ga0081540_10306473 | 287 |
| 254 | 3300005983 | Ga0081540_1030772 | Ga0081540_10307723 | 287 |
| 255 | 3300005983 | Ga0081540_1033763 | Ga0081540_10337632 | 287 |
| 256 | 3300005983 | Ga0081540_1043864 | Ga0081540_10438642 | 287 |
| 257 | 3300005983 | Ga0081540_1100942 | Ga0081540_11009421 | 287 |
| 258 | 3300005985 | Ga0081539_10000608 | Ga0081539_1000060827 | 287 |
| 259 | 3300005985 | Ga0081539_10002743 | Ga0081539_1000274316 | 287 |
| 260 | 3300005985 | Ga0081539_10015726 | Ga0081539_100157264 | 287 |
| 261 | 3300006028 | Ga0070717_10071574 | Ga0070717_100715741 | 287 |
| 262 | 3300006038 | Ga0075365_10055327 | Ga0075365_100553272 | 287 |
| 263 | 3300006038 | Ga0075365_10156257 | Ga0075365_101562572 | 287 |
| 264 | 3300006042 | Ga0075368_10020073 | Ga0075368_100200733 | 287 |
| 265 | 3300006048 | Ga0075363_100027180 | Ga0075363_1000271802 | 287 |
| 266 | 3300006048 | Ga0075363_100067041 | Ga0075363_1000670412 | 287 |
| 267 | 3300006048 | Ga0075363_100123870 | Ga0075363_1001238701 | 287 |
| 268 | 3300006051 | Ga0075364_10176890 | Ga0075364_101768902 | 287 |
| 269 | 3300006173 | Ga0070716_100011909 | Ga0070716_1000119092 | 287 |
| 270 | 3300006173 | Ga0070716_100178917 | Ga0070716_1001789172 | 287 |
| 271 | 3300006175 | Ga0070712_100003832 | Ga0070712_1000038328 | 287 |
| 272 | 3300006177 | Ga0075362_10139874 | Ga0075362_101398742 | 287 |
| 273 | 3300006178 | Ga0075367_10219987 | Ga0075367_102199872 | 287 |
| 274 | 3300006186 | Ga0075369_10145700 | Ga0075369_101457001 | 287 |
| 275 | 3300006353 | Ga0075370_10063578 | Ga0075370_100635781 | 287 |
| 276 | 3300006353 | Ga0075370_10066654 | Ga0075370_100666543 | 287 |
| 277 | 3300006353 | Ga0075370_10190787 | Ga0075370_101907871 | 287 |
| 278 | 3300006358 | Ga0068871_100275134 | Ga0068871_1002751341 | 287 |
| 279 | 3300006358 | Ga0068871_100312572 | Ga0068871_1003125721 | 287 |
| 280 | 3300006844 | Ga0075428_100609249 | Ga0075428_1006092492 | 287 |
| 281 | 3300006871 | Ga0075434_100272871 | Ga0075434_1002728712 | 287 |
| 282 | 3300006871 | Ga0075434_100502163 | Ga0075434_1005021632 | 287 |
| 283 | 3300006881 | Ga0068865_100026883 | Ga0068865_1000268836 | 287 |
| 284 | 3300006881 | Ga0068865_100190263 | Ga0068865_1001902631 | 287 |
| 285 | 3300006941 | Ga0099825_1041592 | Ga0099825_10415923 | 287 |
| 286 | 3300006942 | Ga0099824_1010733 | Ga0099824_101073311 | 287 |
| 287 | 3300006944 | Ga0099823_1024318 | Ga0099823_10243182 | 287 |
| 288 | 3300007076 | Ga0075435_100278872 | Ga0075435_1002788722 | 287 |
| 289 | 3300007265 | Ga0099794_10039477 | Ga0099794_100394772 | 287 |
| 290 | 3300007265 | Ga0099794_10042583 | Ga0099794_100425832 | 287 |
| 291 | 3300007265 | Ga0099794_10166001 | Ga0099794_101660012 | 287 |
| 292 | 3300007788 | Ga0099795_10033741 | Ga0099795_100337412 | 287 |
| 293 | 3300007788 | Ga0099795_10058832 | Ga0099795_100588322 | 287 |
| 294 | 3300009093 | Ga0105240_10107526 | Ga0105240_101075263 | 287 |
| 295 | 3300009093 | Ga0105240_10481236 | Ga0105240_104812362 | 287 |
| 296 | 3300009094 | Ga0111539_10395682 | Ga0111539_103956822 | 287 |
| 297 | 3300009094 | Ga0111539_11021987 | Ga0111539_110219871 | 287 |
| 298 | 3300009098 | Ga0105245_10358380 | Ga0105245_103583801 | 287 |
| 299 | 3300009147 | Ga0114129_10065816 | Ga0114129_100658163 | 287 |
| 300 | 3300009148 | Ga0105243_10204135 | Ga0105243_102041352 | 287 |
| 301 | 3300009176 | Ga0105242_10063484 | Ga0105242_100634842 | 287 |
| 302 | 3300009176 | Ga0105242_10074820 | Ga0105242_100748202 | 287 |
| 303 | 3300009177 | Ga0105248_10363041 | Ga0105248_103630412 | 287 |
| 304 | 3300009177 | Ga0105248_10403707 | Ga0105248_104037073 | 287 |
| 305 | 3300009177 | Ga0105248_10665248 | Ga0105248_106652482 | 287 |
| 306 | 3300009177 | Ga0105248_10813745 | Ga0105248_108137451 | 287 |
| 307 | 3300009551 | Ga0105238_10449372 | Ga0105238_104493721 | 287 |
| 308 | 3300009553 | Ga0105249_10155359 | Ga0105249_101553592 | 287 |
| 309 | 3300009553 | Ga0105249_10306303 | Ga0105249_103063032 | 287 |
| 310 | 3300009553 | Ga0105249_10777957 | Ga0105249_107779571 | 287 |
| 311 | 3300010159 | Ga0099796_10064718 | Ga0099796_100647181 | 287 |
| 312 | 3300010159 | Ga0099796_10070882 | Ga0099796_100708821 | 287 |
| 313 | 3300010375 | Ga0105239_10120748 | Ga0105239_101207483 | 287 |
| 314 | 3300010375 | Ga0105239_10254404 | Ga0105239_102544042 | 287 |
| 315 | 3300012478 | Ga0157328_1001009 | Ga0157328_10010091 | 287 |
| 316 | 3300013104 | Ga0157370_10188253 | Ga0157370_101882532 | 287 |
| 317 | 3300013105 | Ga0157369_10076832 | Ga0157369_100768324 | 287 |
| 318 | 3300013296 | Ga0157374_10155243 | Ga0157374_101552433 | 287 |
| 319 | 3300013296 | Ga0157374_10318837 | Ga0157374_103188372 | 287 |
| 320 | 3300013297 | Ga0157378_10042708 | Ga0157378_100427081 | 287 |
| 321 | 3300013297 | Ga0157378_10216804 | Ga0157378_102168043 | 287 |
| 322 | 3300013306 | Ga0163162_10110451 | Ga0163162_101104513 | 287 |
| 323 | 3300013306 | Ga0163162_10365186 | Ga0163162_103651861 | 287 |
| 324 | 3300013306 | Ga0163162_10415051 | Ga0163162_104150512 | 287 |
| 325 | 3300013307 | Ga0157372_10172224 | Ga0157372_101722242 | 287 |
| 326 | 3300013308 | Ga0157375_10225207 | Ga0157375_102252072 | 287 |
| 327 | 3300013308 | Ga0157375_10275017 | Ga0157375_102750172 | 287 |
| 328 | 3300013308 | Ga0157375_10423671 | Ga0157375_104236713 | 287 |
| 329 | 3300014325 | Ga0163163_10075527 | Ga0163163_100755274 | 287 |
| 330 | 3300014325 | Ga0163163_10095036 | Ga0163163_100950362 | 287 |
| 331 | 3300014326 | Ga0157380_10069744 | Ga0157380_100697444 | 287 |
| 332 | 3300014968 | Ga0157379_10159655 | Ga0157379_101596552 | 287 |
| 333 | 3300014968 | Ga0157379_10194410 | Ga0157379_101944103 | 287 |
| 334 | 3300014969 | Ga0157376_10058496 | Ga0157376_100584964 | 287 |
| 335 | 3300017792 | Ga0163161_10171795 | Ga0163161_101717951 | 287 |
| 336 | 3300021320 | Ga0214544_1000665 | Ga0214544_100066545 | 287 |
| 337 | 3300021321 | Ga0214542_1000486 | Ga0214542_100048645 | 287 |
| 338 | 3300021324 | Ga0214545_1000307 | Ga0214545_100030745 | 287 |
| 339 | 3300021388 | Ga0213875_10001636 | Ga0213875_100016368 | 287 |
| 340 | 3300025295 | Ga0209564_1003322 | Ga0209564_10033223 | 287 |
| 341 | 3300025297 | Ga0209758_1007720 | Ga0209758_10077205 | 287 |
| 342 | 3300025297 | Ga0209758_1008227 | Ga0209758_10082273 | 287 |
| 343 | 3300025297 | Ga0209758_1026917 | Ga0209758_10269172 | 287 |
| 344 | 3300025297 | Ga0209758_1049406 | Ga0209758_10494062 | 287 |
| 345 | 3300025302 | Ga0207426_1000227 | Ga0207426_10002274 | 287 |
| 346 | 3300025302 | Ga0207426_1015497 | Ga0207426_10154972 | 287 |
| 347 | 3300025321 | Ga0207656_10017867 | Ga0207656_100178672 | 287 |
| 348 | 3300025885 | Ga0207653_10042857 | Ga0207653_100428572 | 287 |
| 349 | 3300025898 | Ga0207692_10057636 | Ga0207692_100576361 | 287 |
| 350 | 3300025901 | Ga0207688_10085686 | Ga0207688_100856863 | 287 |
| 351 | 3300025901 | Ga0207688_10136080 | Ga0207688_101360802 | 287 |
| 352 | 3300025903 | Ga0207680_10274061 | Ga0207680_102740612 | 287 |
| 353 | 3300025905 | Ga0207685_10008828 | Ga0207685_100088282 | 287 |
| 354 | 3300025906 | Ga0207699_10016829 | Ga0207699_100168291 | 287 |
| 355 | 3300025907 | Ga0207645_10169027 | Ga0207645_101690272 | 287 |
| 356 | 3300025908 | Ga0207643_10028484 | Ga0207643_100284843 | 287 |
| 357 | 3300025908 | Ga0207643_10204988 | Ga0207643_102049881 | 287 |
| 358 | 3300025912 | Ga0207707_10146040 | Ga0207707_101460402 | 287 |
| 359 | 3300025913 | Ga0207695_10195102 | Ga0207695_101951021 | 287 |
| 360 | 3300025915 | Ga0207693_10004965 | Ga0207693_1000496512 | 287 |
| 361 | 3300025915 | Ga0207693_10031046 | Ga0207693_100310468 | 287 |
| 362 | 3300025916 | Ga0207663_10099686 | Ga0207663_100996862 | 287 |
| 363 | 3300025916 | Ga0207663_10163013 | Ga0207663_101630131 | 287 |
| 364 | 3300025917 | Ga0207660_10277349 | Ga0207660_102773492 | 287 |
| 365 | 3300025917 | Ga0207660_10390337 | Ga0207660_103903371 | 287 |
| 366 | 3300025920 | Ga0207649_10208901 | Ga0207649_102089012 | 287 |
| 367 | 3300025920 | Ga0207649_10238119 | Ga0207649_102381192 | 287 |
| 368 | 3300025925 | Ga0207650_10127360 | Ga0207650_101273601 | 287 |
| 369 | 3300025927 | Ga0207687_10029203 | Ga0207687_100292035 | 287 |
| 370 | 3300025928 | Ga0207700_10066757 | Ga0207700_100667573 | 287 |
| 371 | 3300025928 | Ga0207700_10380321 | Ga0207700_103803212 | 287 |
| 372 | 3300025929 | Ga0207664_10022137 | Ga0207664_100221373 | 287 |
| 373 | 3300025929 | Ga0207664_10086456 | Ga0207664_100864562 | 287 |
| 374 | 3300025931 | Ga0207644_10036883 | Ga0207644_100368832 | 287 |
| 375 | 3300025931 | Ga0207644_10094104 | Ga0207644_100941042 | 287 |
| 376 | 3300025931 | Ga0207644_10182793 | Ga0207644_101827932 | 287 |
| 377 | 3300025931 | Ga0207644_10334960 | Ga0207644_103349602 | 287 |
| 378 | 3300025931 | Ga0207644_10357459 | Ga0207644_103574592 | 287 |
| 379 | 3300025934 | Ga0207686_10103139 | Ga0207686_101031393 | 287 |
| 380 | 3300025935 | Ga0207709_10160378 | Ga0207709_101603781 | 287 |
| 381 | 3300025935 | Ga0207709_10309115 | Ga0207709_103091152 | 287 |
| 382 | 3300025936 | Ga0207670_10200708 | Ga0207670_102007082 | 287 |
| 383 | 3300025937 | Ga0207669_10351900 | Ga0207669_103519001 | 287 |
| 384 | 3300025937 | Ga0207669_10392569 | Ga0207669_103925691 | 287 |
| 385 | 3300025938 | Ga0207704_10076792 | Ga0207704_100767921 | 287 |
| 386 | 3300025938 | Ga0207704_10175380 | Ga0207704_101753802 | 287 |
| 387 | 3300025939 | Ga0207665_10082302 | Ga0207665_100823022 | 287 |
| 388 | 3300025939 | Ga0207665_10379223 | Ga0207665_103792231 | 287 |
| 389 | 3300025940 | Ga0207691_10206849 | Ga0207691_102068492 | 287 |
| 390 | 3300025940 | Ga0207691_10536211 | Ga0207691_105362111 | 287 |
| 391 | 3300025941 | Ga0207711_10197843 | Ga0207711_101978432 | 287 |
| 392 | 3300025941 | Ga0207711_10337525 | Ga0207711_103375252 | 287 |
| 393 | 3300025941 | Ga0207711_10411125 | Ga0207711_104111251 | 287 |
| 394 | 3300025941 | Ga0207711_10496534 | Ga0207711_104965342 | 287 |
| 395 | 3300025942 | Ga0207689_10080784 | Ga0207689_100807843 | 287 |
| 396 | 3300025944 | Ga0207661_10001440 | Ga0207661_1000144015 | 287 |
| 397 | 3300025949 | Ga0207667_10015124 | Ga0207667_100151242 | 287 |
| 398 | 3300025949 | Ga0207667_10373276 | Ga0207667_103732761 | 287 |
| 399 | 3300025961 | Ga0207712_10079702 | Ga0207712_100797021 | 287 |
| 400 | 3300025972 | Ga0207668_10172071 | Ga0207668_101720712 | 287 |
| 401 | 3300025981 | Ga0207640_10345526 | Ga0207640_103455262 | 287 |
| 402 | 3300025986 | Ga0207658_10394923 | Ga0207658_103949231 | 287 |
| 403 | 3300026023 | Ga0207677_10031839 | Ga0207677_100318393 | 287 |
| 404 | 3300026035 | Ga0207703_10179288 | Ga0207703_101792881 | 287 |
| 405 | 3300026035 | Ga0207703_10293039 | Ga0207703_102930391 | 287 |
| 406 | 3300026067 | Ga0207678_10018024 | Ga0207678_100180248 | 287 |
| 407 | 3300026067 | Ga0207678_10173868 | Ga0207678_101738682 | 287 |
| 408 | 3300026067 | Ga0207678_10266536 | Ga0207678_102665362 | 287 |
| 409 | 3300026067 | Ga0207678_10328124 | Ga0207678_103281242 | 287 |
| 410 | 3300026075 | Ga0207708_10194866 | Ga0207708_101948662 | 287 |
| 411 | 3300026088 | Ga0207641_10163747 | Ga0207641_101637471 | 287 |
| 412 | 3300026088 | Ga0207641_10239518 | Ga0207641_102395182 | 287 |
| 413 | 3300026089 | Ga0207648_10039454 | Ga0207648_100394546 | 287 |
| 414 | 3300026095 | Ga0207676_10041483 | Ga0207676_100414832 | 287 |
| 415 | 3300026118 | Ga0207675_100535515 | Ga0207675_1005355151 | 287 |
| 416 | 3300026121 | Ga0207683_10137722 | Ga0207683_101377222 | 287 |
| 417 | 3300026121 | Ga0207683_10264107 | Ga0207683_102641072 | 287 |
| 418 | 3300027296 | Ga0209389_1000102 | Ga0209389_100010221 | 287 |
| 419 | 3300027361 | Ga0209489_100404 | Ga0209489_10040421 | 287 |
| 420 | 3300027363 | Ga0209700_100408 | Ga0209700_10040821 | 287 |
| 421 | 3300027671 | Ga0209588_1020217 | Ga0209588_10202172 | 287 |
| 422 | 3300028379 | Ga0268266_10001335 | Ga0268266_1000133521 | 287 |
| 423 | 3300028379 | Ga0268266_10007399 | Ga0268266_1000739912 | 287 |
| 424 | 3300028379 | Ga0268266_10041505 | Ga0268266_100415054 | 287 |
| 425 | 3300028379 | Ga0268266_10131781 | Ga0268266_101317812 | 287 |
| 426 | 3300028379 | Ga0268266_10268529 | Ga0268266_102685291 | 287 |
| 427 | 3300028379 | Ga0268266_10403715 | Ga0268266_104037151 | 287 |
| 428 | 3300028380 | Ga0268265_10351825 | Ga0268265_103518252 | 287 |
| 429 | 3300028380 | Ga0268265_10393734 | Ga0268265_103937341 | 287 |
| 430 | 3300028380 | Ga0268265_10663750 | Ga0268265_106637501 | 287 |
| 431 | 3300028786 | Ga0307517_10000232 | Ga0307517_1000023265 | 287 |
| 432 | 3300028786 | Ga0307517_10235784 | Ga0307517_102357841 | 287 |
| 433 | 3300028794 | Ga0307515_10014473 | Ga0307515_1001447314 | 287 |
| 434 | 3300028794 | Ga0307515_10227436 | Ga0307515_102274362 | 287 |
| 435 | 3300031616 | Ga0307508_10337453 | Ga0307508_103374531 | 287 |
| 436 | 3300031616 | Ga0307508_10362687 | Ga0307508_103626871 | 287 |
| 437 | 3300031730 | Ga0307516_10003539 | Ga0307516_1000353913 | 287 |
| 438 | 3300031903 | Ga0307407_10119493 | Ga0307407_101194932 | 287 |
| 439 | 3300032126 | Ga0307415_100059673 | Ga0307415_1000596735 | 287 |
| 440 | 3300033180 | Ga0307510_10006006 | Ga0307510_1000600613 | 287 |
| 441 | 3300033180 | Ga0307510_10031035 | Ga0307510_100310353 | 287 |
| 442 | 3300035113 | Ga0373936_0114110 | Ga0373936_0114110_269_1135 | 287 |
| 443 | 3300035116 | Ga0373945_0116258 | Ga0373945_0116258_171_1034 | 287 |
| 444 | 3300035691 | Ga0373931_0011946 | Ga0373931_0011946_3280_4143 | 287 |
| 445 | 3300035691 | Ga0373931_0116542 | Ga0373931_0116542_18_881 | 287 |
| 446 | 3300035691 | Ga0373931_0181362 | Ga0373931_0181362_348_1211 | 287 |
| 447 | 3300035695 | Ga0373927_0056083 | Ga0373927_0056083_309_1181 | 287 |
| 448 | 3300037068 | Ga0373925_0432033 | Ga0373925_0432033_41_904 | 287 |
| 449 | 3300037418 | Ga0395900_0013918 | Ga0395900_0013918_119_985 | 287 |
| 450 | 3300037466 | Ga0395898_0233678 | Ga0395898_0233678_457_1323 | 287 |
| 451 | 3300037471 | Ga0395905_0005023 | Ga0395905_0005023_9463_10326 | 287 |
| 452 | 3300037853 | Ga0436364_1210479 | Ga0436364_1210479_1577_2449 | 287 |
| 453 | 3300037853 | Ga0436364_1557054 | Ga0436364_1557054_8925_9794 | 287 |
| 454 | 3300038443 | Ga0395901_0061354 | Ga0395901_0061354_2530_3396 | 287 |
| 455 | 3300039437 | Ga0436365_1053579 | Ga0436365_1053579_1714_2580 | 287 |
| 456 | 3300039437 | Ga0436365_1552613 | Ga0436365_1552613_1169_2035 | 287 |
| 457 | 3300039438 | Ga0436360_0314278 | Ga0436360_0314278_23_886 | 287 |
| 458 | 3300039447 | Ga0436361_0203807 | Ga0436361_0203807_284_1147 | 287 |
| 459 | 3300039450 | Ga0436363_1615506 | Ga0436363_1615506_595_1464 | 287 |
| 460 | 3300041413 | Ga0439465_0090232 | Ga0439465_0090232_28_891 | 287 |
| 461 | 3300041512 | Ga0451853_0630845 | Ga0451853_0630845_119_982 | 287 |
| 462 | 3300044901 | Ga0466960_0083184 | Ga0466960_0083184_184_1071 | 287 |
| 463 | 3300044901 | Ga0466960_0084589 | Ga0466960_0084589_102_965 | 287 |
| 464 | 3300046455 | Ga0495603_0026994 | Ga0495603_0026994_301_1164 | 287 |
| 465 | 3300046455 | Ga0495603_0038286 | Ga0495603_0038286_222_1085 | 287 |
| 466 | 3300046455 | Ga0495603_0152586 | Ga0495603_0152586_295_1158 | 287 |
| 467 | 3300046459 | Ga0495629_0069802 | Ga0495629_0069802_1207_2070 | 287 |
| 468 | 3300046460 | Ga0495638_0000880 | Ga0495638_0000880_24834_25697 | 287 |
| 469 | 3300046460 | Ga0495638_0016028 | Ga0495638_0016028_2214_3191 | 287 |
| 470 | 3300046471 | Ga0495650_0120184 | Ga0495650_0120184_28_891 | 287 |
| 471 | 3300046475 | Ga0495639_0174414 | Ga0495639_0174414_148_1011 | 287 |
| 472 | 3300046477 | Ga0495664_0196285 | Ga0495664_0196285_95_964 | 287 |
| 473 | 3300046501 | Ga0495607_0046038 | Ga0495607_0046038_68_931 | 287 |
| 474 | 3300046507 | Ga0495606_0027491 | Ga0495606_0027491_1159_2022 | 287 |
| 475 | 3300046507 | Ga0495606_0177447 | Ga0495606_0177447_103_966 | 287 |
| 476 | 3300046517 | Ga0495630_0300701 | Ga0495630_0300701_310_1203 | 287 |
| 477 | 3300046518 | Ga0495631_0044402 | Ga0495631_0044402_828_1691 | 287 |
| 478 | 3300046524 | Ga0495648_0166067 | Ga0495648_0166067_172_1035 | 287 |
| 479 | 3300046526 | Ga0495666_0184384 | Ga0495666_0184384_40_903 | 287 |
| 480 | 3300046557 | Ga0495622_0134533 | Ga0495622_0134533_145_1008 | 287 |
| 481 | 3300046558 | Ga0495633_0163055 | Ga0495633_0163055_73_1005 | 287 |
| 482 | 3300046559 | Ga0495667_0254202 | Ga0495667_0254202_172_1035 | 287 |
| 483 | 3300046616 | Ga0495668_0041407 | Ga0495668_0041407_1671_2534 | 287 |
| 484 | 3300046616 | Ga0495668_0072360 | Ga0495668_0072360_923_1786 | 287 |
| 485 | 3300046616 | Ga0495668_0095614 | Ga0495668_0095614_151_1014 | 287 |
| 486 | 3300046616 | Ga0495668_0112011 | Ga0495668_0112011_590_1453 | 287 |
| 487 | 3300046674 | Ga0495588_0048023 | Ga0495588_0048023_1107_1970 | 287 |
| 488 | 3300046683 | Ga0495658_0228587 | Ga0495658_0228587_144_1007 | 287 |
| 489 | 3300046684 | Ga0495669_0124823 | Ga0495669_0124823_239_1102 | 287 |
| 490 | 3300046684 | Ga0495669_0152493 | Ga0495669_0152493_29_892 | 287 |
| 491 | 3300046809 | Ga0495600_0105711 | Ga0495600_0105711_85_948 | 287 |
| 492 | 3300046810 | Ga0495660_0135853 | Ga0495660_0135853_158_1021 | 287 |
| 493 | 3300047317 | Ga0495604_0152879 | Ga0495604_0152879_236_1102 | 287 |
| 494 | 3300047319 | Ga0495674_0355654 | Ga0495674_0355654_62_955 | 287 |
| 495 | 3300047321 | Ga0495676_0114377 | Ga0495676_0114377_129_992 | 287 |
| 496 | 3300047323 | Ga0495683_0084414 | Ga0495683_0084414_457_1320 | 287 |
| 497 | 3300047469 | Ga0495673_0059562 | Ga0495673_0059562_423_1298 | 287 |
| 498 | 3300047472 | Ga0495686_0035021 | Ga0495686_0035021_953_1816 | 287 |
| 499 | 3300047472 | Ga0495686_0065554 | Ga0495686_0065554_113_976 | 287 |
| 500 | 3300047472 | Ga0495686_0206115 | Ga0495686_0206115_136_999 | 287 |
| 501 | 3300048904 | Ga0496101_0052618 | Ga0496101_0052618_127_990 | 287 |
| 502 | 3300048904 | Ga0496101_0064543 | Ga0496101_0064543_1564_2427 | 287 |
| 503 | 3300048904 | Ga0496101_0142579 | Ga0496101_0142579_364_1227 | 287 |
| 504 | 3300048904 | Ga0496101_0483125 | Ga0496101_0483125_29_892 | 287 |
| 505 | 3300048905 | Ga0496102_0086858 | Ga0496102_0086858_514_1377 | 287 |
| 506 | 3300048905 | Ga0496102_0154865 | Ga0496102_0154865_1081_1944 | 287 |
| 507 | 3300048905 | Ga0496102_0276551 | Ga0496102_0276551_496_1359 | 287 |
| 508 | 3300048906 | Ga0496103_0007418 | Ga0496103_0007418_5583_6446 | 287 |
| 509 | 3300048906 | Ga0496103_0166258 | Ga0496103_0166258_199_1062 | 287 |
| 510 | 3300048907 | Ga0496104_0116558 | Ga0496104_0116558_1332_2195 | 287 |
| 511 | 3300048908 | Ga0496105_0076445 | Ga0496105_0076445_243_1106 | 287 |
| 512 | 3300048909 | Ga0496106_0108762 | Ga0496106_0108762_1082_1945 | 287 |
| 513 | 3300048909 | Ga0496106_0166362 | Ga0496106_0166362_478_1341 | 287 |
| 514 | 3300048910 | Ga0496107_0014960 | Ga0496107_0014960_3926_4789 | 287 |
| 515 | 3300048910 | Ga0496107_0039070 | Ga0496107_0039070_339_1202 | 287 |
| 516 | 3300048910 | Ga0496107_0246619 | Ga0496107_0246619_283_1146 | 287 |
| 517 | 3300048910 | Ga0496107_0273407 | Ga0496107_0273407_342_1205 | 287 |
| 518 | 3300048910 | Ga0496107_0340372 | Ga0496107_0340372_242_1105 | 287 |
| 519 | 3300048911 | Ga0496108_0019609 | Ga0496108_0019609_1968_2831 | 287 |
| 520 | 3300048912 | Ga0496109_0033949 | Ga0496109_0033949_253_1116 | 287 |
| 521 | 3300048913 | Ga0496110_0026542 | Ga0496110_0026542_235_1098 | 287 |
| 522 | 3300048913 | Ga0496110_0072012 | Ga0496110_0072012_1552_2415 | 287 |
| 523 | 3300048913 | Ga0496110_0373117 | Ga0496110_0373117_333_1196 | 287 |
| 524 | 3300048915 | Ga0496112_0015093 | Ga0496112_0015093_4675_5538 | 287 |
| 525 | 3300048915 | Ga0496112_0086931 | Ga0496112_0086931_873_1736 | 287 |
| 526 | 3300048915 | Ga0496112_0329513 | Ga0496112_0329513_42_905 | 287 |
| 527 | 3300048915 | Ga0496112_0493312 | Ga0496112_0493312_50_991 | 287 |
| 528 | 3300048916 | Ga0496113_0043069 | Ga0496113_0043069_299_1162 | 287 |
| 529 | 3300048916 | Ga0496113_0158851 | Ga0496113_0158851_653_1516 | 287 |
| 530 | 3300048916 | Ga0496113_0198708 | Ga0496113_0198708_492_1355 | 287 |
| 531 | 3300048917 | Ga0496114_0156448 | Ga0496114_0156448_151_1014 | 287 |
| 532 | 3300048918 | Ga0496115_0035724 | Ga0496115_0035724_1061_1924 | 287 |
| 533 | 3300048920 | Ga0496117_0217221 | Ga0496117_0217221_36_899 | 287 |
| 534 | 3300048921 | Ga0496118_0130421 | Ga0496118_0130421_299_1162 | 287 |
| 535 | 3300048922 | Ga0496119_0044301 | Ga0496119_0044301_115_1056 | 287 |
| 536 | 3300048924 | Ga0496121_0000278 | Ga0496121_0000278_90242_91105 | 287 |
| 537 | 3300048925 | Ga0496122_0151453 | Ga0496122_0151453_341_1204 | 287 |
| 538 | 3300048927 | Ga0496124_0305261 | Ga0496124_0305261_251_1114 | 287 |
| 539 | 3300048928 | Ga0496125_0037843 | Ga0496125_0037843_198_1061 | 287 |
| 540 | 3300048928 | Ga0496125_0120877 | Ga0496125_0120877_783_1646 | 287 |
| 541 | 3300048929 | Ga0496126_0009449 | Ga0496126_0009449_1924_2787 | 287 |
| 542 | 3300048929 | Ga0496126_0012242 | Ga0496126_0012242_1105_1968 | 287 |
| 543 | 3300048929 | Ga0496126_0050659 | Ga0496126_0050659_1426_2289 | 287 |
| 544 | 3300048929 | Ga0496126_0057355 | Ga0496126_0057355_1368_2231 | 287 |
| 545 | 3300048929 | Ga0496126_0074141 | Ga0496126_0074141_1017_1883 | 287 |
| 546 | 3300048929 | Ga0496126_0170929 | Ga0496126_0170929_347_1210 | 287 |
| 547 | 3300048929 | Ga0496126_0223286 | Ga0496126_0223286_476_1339 | 287 |
| 548 | 3300048929 | Ga0496126_0313338 | Ga0496126_0313338_13_876 | 287 |
| 549 | 3300049576 | Ga0501040_0254531 | Ga0501040_0254531_227_1090 | 287 |
| 550 | 3300049581 | Ga0501047_0023892 | Ga0501047_0023892_224_1090 | 287 |
| 551 | 3300049586 | Ga0501070_0380293 | Ga0501070_0380293_44_907 | 287 |
| 552 | 3300049592 | Ga0501076_0058517 | Ga0501076_0058517_2187_3050 | 287 |
| 553 | 3300049592 | Ga0501076_0331795 | Ga0501076_0331795_139_1002 | 287 |
| 554 | 3300049742 | Ga0501080_0016386 | Ga0501080_0016386_4324_5190 | 287 |
| 555 | 3300049823 | Ga0501044_0017585 | Ga0501044_0017585_2272_3138 | 287 |
| 556 | 3300050490 | nmdc:mga03n38_12446_c1 | nmdc:mga03n38_12446_c1_2194_3057 | 287 |
| 557 | 3300050491 | nmdc:mga00v17_91427_c1 | nmdc:mga00v17_91427_c1_955_1818 | 287 |
| 558 | 3300050492 | nmdc:mga0yw44_31098_c1 | nmdc:mga0yw44_31098_c1_1782_2645 | 287 |
| 559 | 3300050493 | nmdc:mga0k408_14290_c1 | nmdc:mga0k408_14290_c1_37_900 | 287 |
| 560 | 3300050494 | nmdc:mga06z11_10188_c1 | nmdc:mga06z11_10188_c1_2903_3766 | 287 |
| 561 | 3300050496 | nmdc:mga07m45_11611_c1 | nmdc:mga07m45_11611_c1_3620_4483 | 287 |
| 562 | 3300050496 | nmdc:mga07m45_131205_c1 | nmdc:mga07m45_131205_c1_352_1215 | 287 |
| 563 | 3300050496 | nmdc:mga07m45_44347_c1 | nmdc:mga07m45_44347_c1_1226_2089 | 287 |
| 564 | 3300050507 | nmdc:mga05p37_366330_c1 | nmdc:mga05p37_366330_c1_344_1207 | 287 |
| 565 | 3300050512 | nmdc:mga0n895_193078_c1 | nmdc:mga0n895_193078_c1_99_962 | 287 |
| 566 | 3300050516 | nmdc:mga0sz30_97188_c2 | nmdc:mga0sz30_97188_c2_81_944 | 287 |
| 567 | 3300053087 | Ga0500643_000112 | Ga0500643_000112_49524_50387 | 287 |
| 568 | 3300053094 | Ga0500566_0000262 | Ga0500566_0000262_19334_20197 | 287 |
| 569 | 3300053094 | Ga0500566_0001195 | Ga0500566_0001195_13931_14797 | 287 |
| 570 | 3300053094 | Ga0500566_0043727 | Ga0500566_0043727_1504_2367 | 287 |
| 571 | 3300053096 | Ga0500641_0053787 | Ga0500641_0053787_749_1612 | 287 |
| 572 | 3300053103 | Ga0500555_049746 | Ga0500555_049746_40_903 | 287 |
| 573 | 3300053104 | Ga0500556_0013991 | Ga0500556_0013991_1234_2097 | 287 |
| 574 | 3300053109 | Ga0500569_020432 | Ga0500569_020432_837_1700 | 287 |
| 575 | 3300053111 | Ga0500572_004331 | Ga0500572_004331_528_1394 | 287 |
| 576 | 3300053119 | Ga0500595_000510 | Ga0500595_000510_18661_19524 | 287 |
| 577 | 3300053119 | Ga0500595_006468 | Ga0500595_006468_4055_4918 | 287 |
| 578 | 3300053119 | Ga0500595_007359 | Ga0500595_007359_3467_4330 | 287 |
| 579 | 3300053139 | Ga0500568_0024502 | Ga0500568_0024502_1169_2032 | 287 |
| 580 | 3300053150 | Ga0500603_034509 | Ga0500603_034509_280_1146 | 287 |
| 581 | 3300053153 | Ga0500616_0051130 | Ga0500616_0051130_901_1764 | 287 |
| 582 | 3300053156 | Ga0500622_0018162 | Ga0500622_0018162_1909_2772 | 287 |
| 583 | 3300053178 | Ga0500637_0033859 | Ga0500637_0033859_234_1097 | 287 |
| 584 | 3300053735 | Ga0500596_002288 | Ga0500596_002288_796_1662 | 287 |
| 585 | 3300053737 | Ga0500601_000103 | Ga0500601_000103_12454_13317 | 287 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hgu-assembly1.cif.gz_B | epoxide hydrolase from bosea sp. pamc 26642 | 0.9789 | 2 | 281 |
| 8hgu-assembly1.cif.gz_B | epoxide hydrolase from bosea sp. pamc 26642 | 0.952 | 2 | 281 |
| 8b6p-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) | 0.9179 | 2 | 123 |
| 8b6p-assembly2.cif.gz_B | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) | 0.9165 | 2 | 123 |
| 8b6o-assembly1.cif.gz_A | x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 | 0.9145 | 2 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4CQ94_14_186_3.40.50.12270 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9391 | 11 | 121 | 3.40.50.12270 |
| af_Q9NQF3_11_190_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9315 | 2 | 122 | 3.40.50.1820 |
| af_A0A0R0KMM0_1_93_3.40.50.12270 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9119 | 2 | 85 | 3.40.50.12270 |
| 5ng7B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9078 | 2 | 283 | 3.40.50.1820 |
| af_P96811_2_293_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8936 | 2 | 281 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0R3BR81-F1-model_v4 | deleted | 0.998 | 1 | 287 |
|
| AF-A0A7S7Z0V4-F1-model_v4 | Alpha/beta hydrolase | 0.9976 | 1 | 287 |
GO:0016787
|
| AF-A0A0S6UKJ3-F1-model_v4 | Soluble epoxide hydrolase | 0.9965 | 1 | 287 |
GO:0016787
|
| AF-A0A0S6UKJ3-F1-model_v4 | Soluble epoxide hydrolase | 0.9931 | 1 | 287 |
GO:0016787
|
| AF-A7IG07-F1-model_v4 | Alpha/beta hydrolase fold | 0.9872 | 2 | 284 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar