F466482

General Info

Members Datasets Scaffolds Average Seq Length
585 377 493 286

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0016028|Ga0495638_0016028_2214_3191
Length 325
Sequence MTGRFGPRSGRVLGEDGGPGKARGQEIRVGLGSKKEPKMEHLTVQANGAALHVAHMGAGRPLLLLHGWPEFWLTWEPVMTRLADRFTLYAPDLRGFGDSDKPEGLFGPDQQAADMLALMDALGLAQAGIVGHDVGGALMQPLARLAPERIAGLFFFDFVYPGIGRRMAEPERLNNIWYQSFHQMEMAPALVGASRESCRRYIGHFLKAWSHRKHVFDDQLDAFTDNFLKSGNLAGGFAHYRAVHAGRVRMMKGEAPAPAPIGVPTCVRWAEHDPLFPYEWTDRLGETFTNLDLAMFPDVGHFPHREDPDRAASDIAAFFTRIGWH

Samples

Sample ID Description Type Environment
1 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
2 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
3 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
4 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
5 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
6 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
7 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
8 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
9 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
10 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
11 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
12 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
13 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
14 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
15 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
16 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
17 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
18 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
19 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
20 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
21 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
22 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
23 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
24 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
25 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
26 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
27 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
28 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
29 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
30 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
31 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
32 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
33 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
34 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
35 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
36 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
37 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
38 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
39 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
40 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
41 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
42 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
43 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
44 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
45 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
46 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
47 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
48 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
49 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
50 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
51 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
52 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
53 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
54 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
55 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
56 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
57 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
58 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
59 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
60 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
61 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
62 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
63 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
64 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
65 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
66 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
67 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
68 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
69 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
70 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
71 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
72 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
73 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
74 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
75 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
76 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
77 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
78 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
79 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
80 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
81 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
83 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
85 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
86 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
87 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
88 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
89 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
90 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
91 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
92 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
93 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
94 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
95 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
96 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
97 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
98 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
99 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
100 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
101 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
102 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
103 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
104 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
105 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
106 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
107 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
108 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
109 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
110 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
111 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
112 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
113 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
116 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
117 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
118 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
119 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
120 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
121 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
122 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
123 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
124 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
125 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
126 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
127 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
128 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
129 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
130 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
131 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
132 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
133 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
134 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
135 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
136 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
137 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
138 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
139 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
140 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
141 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
142 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
143 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
144 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
145 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
146 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
150 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
153 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
154 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
158 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
159 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
160 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
161 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
164 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
165 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
166 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
167 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
168 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
169 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
170 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
171 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
172 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
173 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
174 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
175 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
176 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
177 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
180 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
227 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
228 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
229 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
233 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
236 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
237 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
240 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
243 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
256 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
259 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
260 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
263 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
269 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
270 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
278 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
279 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
280 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
281 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
293 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
301 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
302 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
303 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
306 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
334 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
338 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
345 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
346 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
347 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
348 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
351 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
352 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
353 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
354 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
355 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
356 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
357 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
358 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
359 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
360 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
361 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
362 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
363 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
364 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
365 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
366 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
367 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
368 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
369 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
370 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
371 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
372 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
373 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
374 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
375 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
376 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
377 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.56
Metatranscriptomes 0
Isolates 15.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.89
Nodule 11.45
Rhizoplane 5.98
Rhizosphere 61.37
Stem 0
Stem Tuber 0
Unclassified 12.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10026689 3300002077 Bacteria 1120
2 JGI25406J46586_10000256 3300003203 Bacteria 23743
3 JGI25160J50197_1010119 3300003354 Bacteria 3436
4 JGI25404J52841_10030083 3300003659 Bacteria 1164
5 Ga0070676_10051365 3300005328 Bacteria 2420
6 Ga0070683_100004493 3300005329 Bacteria 11507
7 Ga0070683_100225276 3300005329 Bacteria 1782
8 Ga0070683_100267135 3300005329 Bacteria 1627
9 Ga0068869_100231800 3300005334 Bacteria 1467
10 Ga0070680_100084955 3300005336 Bacteria 2614
11 Ga0070680_100172832 3300005336 Bacteria 1818
12 Ga0068868_100063413 3300005338 Bacteria 2931
13 Ga0070661_100215637 3300005344 Bacteria 1470
14 Ga0070668_100064385 3300005347 Bacteria 2842
15 Ga0070668_100391541 3300005347 Bacteria 1185
16 Ga0070668_100531356 3300005347 Bacteria 1021
17 Ga0070671_100211609 3300005355 Bacteria 1644
18 Ga0070674_100437666 3300005356 Bacteria 1076
19 Ga0070659_100229930 3300005366 Bacteria 1532
20 Ga0070667_100329723 3300005367 Bacteria 1379
21 Ga0070709_10205373 3300005434 Bacteria 1397
22 Ga0070709_10248826 3300005434 Bacteria 1279
23 Ga0070713_100017781 3300005436 Bacteria 5390
24 Ga0070713_100035194 3300005436 Bacteria 4029
25 Ga0070713_100664969 3300005436 Bacteria 993
26 Ga0070710_10013404 3300005437 Bacteria 4106
27 Ga0070710_10066561 3300005437 Bacteria 2066
28 Ga0070710_10110412 3300005437 Bacteria 1651
29 Ga0070711_100024466 3300005439 Bacteria 3938
30 Ga0070711_100092851 3300005439 Bacteria 2179
31 Ga0070711_100214900 3300005439 Bacteria 1491
32 Ga0070663_100084709 3300005455 Bacteria 2337
33 Ga0070663_100128118 3300005455 Bacteria 1924
34 Ga0070663_100152397 3300005455 Bacteria 1773
35 Ga0070663_100524167 3300005455 Bacteria 987
36 Ga0070678_100068347 3300005456 Bacteria 2648
37 Ga0070678_100088081 3300005456 Bacteria 2372
38 Ga0070678_100098874 3300005456 Bacteria 2257
39 Ga0070678_100409735 3300005456 Bacteria 1179
40 Ga0070681_10004178 3300005458 Bacteria 13672
41 Ga0070681_10506463 3300005458 Bacteria 1120
42 Ga0070707_100254287 3300005468 Bacteria 1709
43 Ga0070698_100296410 3300005471 Bacteria 1548
44 Ga0070679_100085452 3300005530 Bacteria 3142
45 Ga0070679_100143811 3300005530 Bacteria 2363
46 Ga0070684_100008530 3300005535 Bacteria 8019
47 Ga0070684_100017771 3300005535 Bacteria 5843
48 Ga0070672_100274030 3300005543 Bacteria 1425
49 Ga0070672_100311923 3300005543 Bacteria 1335
50 Ga0070696_100092391 3300005546 Bacteria 2157
51 Ga0070665_100007488 3300005548 Bacteria 11101
52 Ga0070665_100056755 3300005548 Bacteria 3926
53 Ga0070665_100164203 3300005548 Bacteria 2223
54 Ga0070665_100309934 3300005548 Bacteria 1582
55 Ga0070665_100556015 3300005548 Bacteria 1160
56 Ga0070665_100604721 3300005548 Bacteria 1109
57 Ga0068855_100142216 3300005563 Bacteria 2733
58 Ga0068855_100321361 3300005563 Bacteria 1711
59 Ga0070664_100070506 3300005564 Bacteria 2993
60 Ga0070664_100233122 3300005564 Bacteria 1650
61 Ga0068857_100262780 3300005577 Bacteria 1584
62 Ga0068856_100158774 3300005614 Bacteria 2271
63 Ga0068856_100167938 3300005614 Bacteria 2205
64 Ga0068856_100171369 3300005614 Bacteria 2182
65 Ga0070702_100082056 3300005615 Bacteria 1934
66 Ga0068852_100088408 3300005616 Bacteria 2767
67 Ga0068852_100237125 3300005616 Bacteria 1741
68 Ga0068852_100332500 3300005616 Bacteria 1479
69 Ga0068864_100055366 3300005618 Bacteria 3424
70 Ga0068861_100248587 3300005719 Bacteria 1516
71 Ga0068861_100253242 3300005719 Bacteria 1503
72 Ga0068851_10132809 3300005834 Bacteria 1348
73 Ga0068863_100169065 3300005841 Bacteria 2096
74 Ga0068858_100137134 3300005842 Bacteria 2296
75 Ga0068860_100012321 3300005843 Bacteria 8425
76 Ga0068860_100650921 3300005843 Bacteria 1061
77 Ga0068862_100083456 3300005844 Bacteria 2774
78 Ga0068862_100185626 3300005844 Bacteria 1868
79 Ga0068862_100383487 3300005844 Bacteria 1311
80 Ga0081455_10013159 3300005937 Bacteria 8199
81 Ga0081455_10102881 3300005937 Bacteria 2289
82 Ga0081455_10195921 3300005937 Bacteria 1517
83 Ga0081455_10228712 3300005937 Bacteria 1374
84 Ga0081540_1002532 3300005983 Bacteria 14825
85 Ga0081540_1004042 3300005983 Bacteria 11359
86 Ga0081540_1005765 3300005983 Bacteria 9169
87 Ga0081540_1012681 3300005983 Bacteria 5529
88 Ga0081540_1026337 3300005983 Bacteria 3322
89 Ga0081540_1030647 3300005983 Bacteria 2975
90 Ga0081540_1030772 3300005983 Bacteria 2966
91 Ga0081540_1033763 3300005983 Bacteria 2772
92 Ga0081540_1043864 3300005983 Bacteria 2289
93 Ga0081540_1100942 3300005983 Bacteria 1243
94 Ga0081539_10000608 3300005985 Bacteria 72799
95 Ga0081539_10002743 3300005985 Bacteria 23762
96 Ga0081539_10015726 3300005985 Bacteria 5476
97 Ga0070717_10071574 3300006028 Bacteria 2893
98 Ga0075365_10055327 3300006038 Bacteria 2633
99 Ga0075365_10156257 3300006038 Bacteria 1587
100 Ga0075368_10020073 3300006042 Bacteria 2527
101 Ga0075363_100027180 3300006048 Bacteria 2932
102 Ga0075363_100067041 3300006048 Bacteria 1944
103 Ga0075363_100123870 3300006048 Bacteria 1445
104 Ga0075364_10176890 3300006051 Bacteria 1443
105 Ga0070716_100011909 3300006173 Bacteria 4394
106 Ga0070716_100178917 3300006173 Bacteria 1390
107 Ga0070712_100003832 3300006175 Bacteria 9259
108 Ga0070712_100205057 3300006175 Bacteria 1551
109 Ga0075362_10139874 3300006177 Bacteria 1156
110 Ga0075367_10219987 3300006178 Bacteria 1188
111 Ga0075369_10145700 3300006186 Bacteria 1081
112 Ga0075370_10063578 3300006353 Bacteria 2104
113 Ga0075370_10066654 3300006353 Bacteria 2054
114 Ga0075370_10190787 3300006353 Bacteria 1207
115 Ga0068871_100275134 3300006358 Bacteria 1471
116 Ga0068871_100312572 3300006358 Bacteria 1381
117 Ga0075428_100609249 3300006844 Bacteria 1166
118 Ga0075433_10337240 3300006852 Bacteria 1333
119 Ga0075434_100272871 3300006871 Bacteria 1710
120 Ga0075434_100502163 3300006871 Bacteria 1234
121 Ga0068865_100026883 3300006881 Bacteria 3797
122 Ga0068865_100190263 3300006881 Bacteria 1586
123 Ga0099825_1041592 3300006941 Bacteria 1311
124 Ga0099824_1010733 3300006942 Bacteria 10649
125 Ga0099823_1024318 3300006944 Bacteria 5485
126 Ga0075435_100278872 3300007076 Bacteria 1427
127 Ga0099794_10039477 3300007265 Bacteria 2241
128 Ga0099794_10042583 3300007265 Bacteria 2165
129 Ga0099794_10166001 3300007265 Bacteria 1124
130 Ga0099795_10033741 3300007788 Bacteria 1779
131 Ga0099795_10058832 3300007788 Bacteria 1420
132 Ga0105240_10083500 3300009093 Bacteria 3919
133 Ga0105240_10107526 3300009093 Bacteria 3381
134 Ga0105240_10481236 3300009093 Bacteria 1384
135 Ga0111539_10395682 3300009094 Bacteria 1609
136 Ga0111539_11021987 3300009094 Bacteria 961
137 Ga0105245_10358380 3300009098 Bacteria 1447
138 Ga0114129_10065816 3300009147 Bacteria 5057
139 Ga0105243_10204135 3300009148 Bacteria 1735
140 Ga0105241_10131574 3300009174 Bacteria 2026
141 Ga0105242_10063484 3300009176 Bacteria 3041
142 Ga0105242_10074820 3300009176 Bacteria 2819
143 Ga0105248_10363041 3300009177 Bacteria 1631
144 Ga0105248_10403707 3300009177 Bacteria 1539
145 Ga0105248_10665248 3300009177 Bacteria 1175
146 Ga0105248_10813745 3300009177 Bacteria 1054
147 Ga0105237_10328542 3300009545 Bacteria 1533
148 Ga0105238_10449372 3300009551 Bacteria 1286
149 Ga0105249_10155359 3300009553 Bacteria 2206
150 Ga0105249_10306303 3300009553 Bacteria 1595
151 Ga0105249_10777957 3300009553 Bacteria 1020
152 Ga0099796_10064718 3300010159 Bacteria 1305
153 Ga0099796_10070882 3300010159 Bacteria 1258
154 Ga0105239_10120748 3300010375 Bacteria 2910
155 Ga0105239_10254404 3300010375 Bacteria 1973
156 Ga0157328_1001009 3300012478 Bacteria 1138
157 Ga0157370_10188253 3300013104 Bacteria 1916
158 Ga0157369_10076832 3300013105 Bacteria 3579
159 Ga0157369_10100287 3300013105 Bacteria 3087
160 Ga0157369_10106771 3300013105 Bacteria 2979
161 Ga0157374_10155243 3300013296 Bacteria 2227
162 Ga0157374_10318837 3300013296 Bacteria 1540
163 Ga0157378_10042708 3300013297 Bacteria 4024
164 Ga0157378_10216804 3300013297 Bacteria 1818
165 Ga0163162_10110451 3300013306 Bacteria 2846
166 Ga0163162_10365186 3300013306 Bacteria 1576
167 Ga0163162_10415051 3300013306 Bacteria 1478
168 Ga0157372_10172224 3300013307 Bacteria 2505
169 Ga0157372_10598202 3300013307 Bacteria 1286
170 Ga0157375_10225207 3300013308 Bacteria 2034
171 Ga0157375_10275017 3300013308 Bacteria 1846
172 Ga0157375_10423671 3300013308 Bacteria 1497
173 Ga0163163_10075527 3300014325 Bacteria 3363
174 Ga0163163_10095036 3300014325 Bacteria 3000
175 Ga0157380_10069744 3300014326 Bacteria 2838
176 Ga0157379_10159655 3300014968 Bacteria 2035
177 Ga0157379_10194410 3300014968 Bacteria 1833
178 Ga0157376_10058496 3300014969 Bacteria 3229
179 Ga0163161_10171795 3300017792 Bacteria 1658
180 Ga0214544_1000665 3300021320 Bacteria 65630
181 Ga0214542_1000486 3300021321 Bacteria 71884
182 Ga0214545_1000307 3300021324 Bacteria 71884
183 Ga0213875_10001636 3300021388 Bacteria 14148
184 Ga0209564_1003322 3300025295 Bacteria 11175
185 Ga0209758_1007720 3300025297 Bacteria 7220
186 Ga0209758_1008227 3300025297 Bacteria 6830
187 Ga0209758_1026917 3300025297 Bacteria 2474
188 Ga0209758_1049406 3300025297 Bacteria 1485
189 Ga0207426_1000227 3300025302 Bacteria 129311
190 Ga0207426_1015497 3300025302 Bacteria 2761
191 Ga0207656_10017867 3300025321 Bacteria 2785
192 Ga0207653_10042857 3300025885 Bacteria 1489
193 Ga0207692_10057636 3300025898 Bacteria 1998
194 Ga0207688_10085686 3300025901 Bacteria 1804
195 Ga0207688_10136080 3300025901 Bacteria 1443
196 Ga0207680_10274061 3300025903 Bacteria 1171
197 Ga0207685_10008828 3300025905 Bacteria 2895
198 Ga0207699_10016829 3300025906 Bacteria 3834
199 Ga0207645_10169027 3300025907 Bacteria 1432
200 Ga0207643_10028484 3300025908 Bacteria 3102
201 Ga0207643_10204988 3300025908 Bacteria 1202
202 Ga0207654_10035660 3300025911 Bacteria 2773
203 Ga0207707_10001922 3300025912 Bacteria 18882
204 Ga0207707_10004003 3300025912 Bacteria 13084
205 Ga0207707_10146040 3300025912 Bacteria 2068
206 Ga0207695_10195102 3300025913 Bacteria 1941
207 Ga0207693_10004965 3300025915 Bacteria 11173
208 Ga0207693_10031046 3300025915 Bacteria 4221
209 Ga0207663_10099686 3300025916 Bacteria 1948
210 Ga0207663_10163013 3300025916 Bacteria 1576
211 Ga0207663_10302644 3300025916 Bacteria 1195
212 Ga0207660_10277349 3300025917 Bacteria 1329
213 Ga0207660_10390337 3300025917 Bacteria 1120
214 Ga0207649_10208901 3300025920 Bacteria 1384
215 Ga0207649_10238119 3300025920 Bacteria 1305
216 Ga0207650_10127360 3300025925 Bacteria 1989
217 Ga0207687_10029203 3300025927 Bacteria 3708
218 Ga0207700_10019075 3300025928 Bacteria 4626
219 Ga0207700_10066757 3300025928 Bacteria 2750
220 Ga0207700_10380321 3300025928 Bacteria 1235
221 Ga0207664_10022137 3300025929 Bacteria 4741
222 Ga0207664_10086456 3300025929 Bacteria 2561
223 Ga0207644_10036883 3300025931 Bacteria 3435
224 Ga0207644_10094104 3300025931 Bacteria 2238
225 Ga0207644_10182793 3300025931 Bacteria 1644
226 Ga0207644_10334960 3300025931 Bacteria 1226
227 Ga0207644_10357459 3300025931 Bacteria 1187
228 Ga0207686_10103139 3300025934 Bacteria 1908
229 Ga0207709_10160378 3300025935 Bacteria 1568
230 Ga0207709_10309115 3300025935 Bacteria 1179
231 Ga0207670_10200708 3300025936 Bacteria 1515
232 Ga0207669_10351900 3300025937 Bacteria 1138
233 Ga0207669_10392569 3300025937 Bacteria 1084
234 Ga0207704_10076792 3300025938 Bacteria 2142
235 Ga0207704_10175380 3300025938 Bacteria 1543
236 Ga0207665_10002143 3300025939 Bacteria 13354
237 Ga0207665_10029872 3300025939 Bacteria 3602
238 Ga0207665_10082302 3300025939 Bacteria 2218
239 Ga0207665_10379223 3300025939 Bacteria 1073
240 Ga0207691_10206849 3300025940 Bacteria 1706
241 Ga0207691_10536211 3300025940 Bacteria 993
242 Ga0207711_10197843 3300025941 Bacteria 1833
243 Ga0207711_10337525 3300025941 Bacteria 1394
244 Ga0207711_10411125 3300025941 Bacteria 1258
245 Ga0207711_10496534 3300025941 Bacteria 1137
246 Ga0207689_10080784 3300025942 Bacteria 2672
247 Ga0207689_10256320 3300025942 Bacteria 1447
248 Ga0207661_10001440 3300025944 Bacteria 16041
249 Ga0207667_10015124 3300025949 Bacteria 8775
250 Ga0207667_10373276 3300025949 Bacteria 1453
251 Ga0207667_10390788 3300025949 Bacteria 1417
252 Ga0207712_10079702 3300025961 Bacteria 2379
253 Ga0207668_10172071 3300025972 Bacteria 1699
254 Ga0207640_10345526 3300025981 Bacteria 1193
255 Ga0207658_10394923 3300025986 Bacteria 1214
256 Ga0207677_10031839 3300026023 Bacteria 3382
257 Ga0207703_10179288 3300026035 Bacteria 1869
258 Ga0207703_10293039 3300026035 Bacteria 1481
259 Ga0207678_10018024 3300026067 Bacteria 6203
260 Ga0207678_10173868 3300026067 Bacteria 1839
261 Ga0207678_10266536 3300026067 Bacteria 1468
262 Ga0207678_10328124 3300026067 Bacteria 1317
263 Ga0207708_10194866 3300026075 Bacteria 1614
264 Ga0207641_10163747 3300026088 Bacteria 2024
265 Ga0207641_10239518 3300026088 Bacteria 1690
266 Ga0207648_10039454 3300026089 Bacteria 4152
267 Ga0207676_10041483 3300026095 Bacteria 3533
268 Ga0207674_10489534 3300026116 Bacteria 1189
269 Ga0207675_100535515 3300026118 Bacteria 1169
270 Ga0207683_10137722 3300026121 Bacteria 2198
271 Ga0207683_10264107 3300026121 Bacteria 1572
272 Ga0209389_1000102 3300027296 Bacteria 78475
273 Ga0209489_100404 3300027361 Bacteria 78473
274 Ga0209700_100408 3300027363 Bacteria 78496
275 Ga0209588_1020217 3300027671 Bacteria 2084
276 Ga0268266_10001335 3300028379 Bacteria 29884
277 Ga0268266_10007399 3300028379 Bacteria 9916
278 Ga0268266_10041505 3300028379 Bacteria 3926
279 Ga0268266_10131781 3300028379 Bacteria 2236
280 Ga0268266_10268529 3300028379 Bacteria 1583
281 Ga0268266_10403715 3300028379 Bacteria 1292
282 Ga0268265_10351825 3300028380 Bacteria 1345
283 Ga0268265_10393734 3300028380 Bacteria 1278
284 Ga0268265_10663750 3300028380 Bacteria 1003
285 Ga0307517_10000232 3300028786 Bacteria 94332
286 Ga0307517_10235784 3300028786 Bacteria 1092
287 Ga0307515_10014473 3300028794 Bacteria 14620
288 Ga0307515_10227436 3300028794 Bacteria 1667
289 Ga0307513_10228685 3300031456 Bacteria 1674
290 Ga0307508_10337453 3300031616 Bacteria 1099
291 Ga0307508_10362687 3300031616 Bacteria 1040
292 Ga0307516_10003539 3300031730 Bacteria 19976
293 Ga0307516_10189204 3300031730 Bacteria 1785
294 Ga0307407_10119493 3300031903 Bacteria 1668
295 Ga0307415_100059673 3300032126 Bacteria 2632
296 Ga0307510_10006006 3300033180 Bacteria 14485
297 Ga0307510_10031035 3300033180 Bacteria 6045
298 Ga0373923_0002828 3300035111 Bacteria 5435
299 Ga0373936_0114110 3300035113 Bacteria 1149
300 Ga0373945_0116258 3300035116 Bacteria 1060
301 Ga0373924_0059621 3300035410 Bacteria 1594
302 Ga0373931_0011946 3300035691 Bacteria 4201
303 Ga0373931_0116542 3300035691 Bacteria 1522
304 Ga0373931_0181362 3300035691 Bacteria 1247
305 Ga0373927_0056083 3300035695 Bacteria 2547
306 Ga0373927_0131622 3300035695 Bacteria 1634
307 Ga0373933_0109287 3300035724 Bacteria 1723
308 Ga0373947_0073801 3300035725 Bacteria 2097
309 Ga0373937_0299585 3300036401 Bacteria 1519
310 Ga0373925_0007366 3300037068 Bacteria 8029
311 Ga0373925_0432033 3300037068 Bacteria 1077
312 Ga0395900_0013918 3300037418 Bacteria 8211
313 Ga0395898_0216683 3300037466 Bacteria 1826
314 Ga0395898_0233678 3300037466 Bacteria 1753
315 Ga0395905_0005023 3300037471 Bacteria 13625
316 Ga0395905_0092570 3300037471 Bacteria 2835
317 Ga0436364_1210479 3300037853 Bacteria 6917
318 Ga0436364_1557054 3300037853 Bacteria 23701
319 Ga0395901_0061354 3300038443 Bacteria 3912
320 Ga0436365_1053579 3300039437 Bacteria 3004
321 Ga0436365_1552613 3300039437 Bacteria 2091
322 Ga0436360_0314278 3300039438 Bacteria 1102
323 Ga0436361_0065851 3300039447 Bacteria 5607
324 Ga0436361_0203807 3300039447 Bacteria 2005
325 Ga0436363_1615506 3300039450 Bacteria 3328
326 Ga0439465_0090232 3300041413 Bacteria 1048
327 Ga0451853_0630845 3300041512 Bacteria 1143
328 Ga0466963_0074583 3300044694 Bacteria 2288
329 Ga0466964_0125131 3300044706 Bacteria 1164
330 Ga0466960_0083184 3300044901 Bacteria 1617
331 Ga0466960_0084589 3300044901 Bacteria 1605
332 Ga0495592_0086820 3300046454 Bacteria 2252
333 Ga0495603_0026994 3300046455 Bacteria 3467
334 Ga0495603_0038286 3300046455 Bacteria 2876
335 Ga0495603_0152586 3300046455 Bacteria 1341
336 Ga0495629_0069802 3300046459 Bacteria 2452
337 Ga0495638_0000880 3300046460 Bacteria 30953
338 Ga0495638_0016028 3300046460 Bacteria 5022
339 Ga0495650_0120184 3300046471 Bacteria 968
340 Ga0495580_0008306 3300046472 Bacteria 8262
341 Ga0495582_0125826 3300046473 Bacteria 1446
342 Ga0495639_0174414 3300046475 Bacteria 1045
343 Ga0495664_0076788 3300046477 Bacteria 1999
344 Ga0495664_0196285 3300046477 Bacteria 1223
345 Ga0495607_0046038 3300046501 Bacteria 2564
346 Ga0495606_0027491 3300046507 Bacteria 4033
347 Ga0495606_0177447 3300046507 Bacteria 1231
348 Ga0495606_0233003 3300046507 Bacteria 1031
349 Ga0495608_0097163 3300046511 Bacteria 1901
350 Ga0495618_0217781 3300046514 Bacteria 1205
351 Ga0495628_0039866 3300046516 Bacteria 3756
352 Ga0495630_0245660 3300046517 Bacteria 1367
353 Ga0495630_0300701 3300046517 Bacteria 1226
354 Ga0495631_0044402 3300046518 Bacteria 1958
355 Ga0495648_0166067 3300046524 Bacteria 1136
356 Ga0495648_0251686 3300046524 Bacteria 852
357 Ga0495666_0184384 3300046526 Bacteria 963
358 Ga0495665_0059931 3300046531 Bacteria 2009
359 Ga0495640_0094732 3300046533 Bacteria 1966
360 Ga0495586_0066391 3300046535 Bacteria 1967
361 Ga0495645_0235879 3300046543 Bacteria 1223
362 Ga0495622_0134533 3300046557 Bacteria 1124
363 Ga0495633_0163055 3300046558 Bacteria 1028
364 Ga0495667_0254202 3300046559 Bacteria 1118
365 Ga0495668_0041407 3300046616 Bacteria 2566
366 Ga0495668_0072360 3300046616 Bacteria 1894
367 Ga0495668_0095614 3300046616 Bacteria 1626
368 Ga0495668_0112011 3300046616 Bacteria 1492
369 Ga0495634_0007375 3300046642 Bacteria 8275
370 Ga0495635_0038630 3300046663 Bacteria 3304
371 Ga0495588_0048023 3300046674 Bacteria 2193
372 Ga0495599_0103854 3300046678 Bacteria 1771
373 Ga0495623_0135665 3300046679 Bacteria 1469
374 Ga0495647_0047425 3300046681 Bacteria 1658
375 Ga0495658_0082202 3300046683 Bacteria 1892
376 Ga0495658_0228587 3300046683 Bacteria 1166
377 Ga0495669_0124823 3300046684 Bacteria 1209
378 Ga0495669_0152493 3300046684 Bacteria 1094
379 Ga0495670_0158017 3300046691 Bacteria 1190
380 Ga0495600_0105711 3300046809 Bacteria 1834
381 Ga0495660_0135853 3300046810 Bacteria 1229
382 Ga0495604_0152879 3300047317 Bacteria 1638
383 Ga0495604_0170620 3300047317 Bacteria 1530
384 Ga0495674_0030756 3300047319 Bacteria 4879
385 Ga0495674_0355654 3300047319 Bacteria 1188
386 Ga0495676_0114377 3300047321 Bacteria 1974
387 Ga0495680_0033981 3300047322 Bacteria 4125
388 Ga0495683_0084414 3300047323 Bacteria 1545
389 Ga0495673_0059562 3300047469 Bacteria 1641
390 Ga0495684_0046672 3300047471 Bacteria 3313
391 Ga0495686_0035021 3300047472 Bacteria 3230
392 Ga0495686_0065554 3300047472 Bacteria 2245
393 Ga0495686_0206115 3300047472 Bacteria 1126
394 Ga0496101_0052618 3300048904 Bacteria 2936
395 Ga0496101_0064543 3300048904 Bacteria 2667
396 Ga0496101_0142579 3300048904 Bacteria 1827
397 Ga0496101_0483125 3300048904 Bacteria 978
398 Ga0496102_0086858 3300048905 Bacteria 2889
399 Ga0496102_0154865 3300048905 Bacteria 2154
400 Ga0496102_0276551 3300048905 Bacteria 1582
401 Ga0496102_0760026 3300048905 Bacteria 892
402 Ga0496103_0007418 3300048906 Bacteria 6536
403 Ga0496103_0166258 3300048906 Bacteria 1415
404 Ga0496104_0116558 3300048907 Bacteria 2563
405 Ga0496105_0076445 3300048908 Bacteria 2764
406 Ga0496106_0108762 3300048909 Bacteria 2156
407 Ga0496106_0166362 3300048909 Bacteria 1746
408 Ga0496107_0014960 3300048910 Bacteria 5434
409 Ga0496107_0039070 3300048910 Bacteria 3404
410 Ga0496107_0246619 3300048910 Bacteria 1329
411 Ga0496107_0273407 3300048910 Bacteria 1257
412 Ga0496107_0340372 3300048910 Bacteria 1116
413 Ga0496108_0019609 3300048911 Bacteria 5555
414 Ga0496109_0033949 3300048912 Bacteria 4591
415 Ga0496110_0026542 3300048913 Bacteria 4958
416 Ga0496110_0072012 3300048913 Bacteria 3066
417 Ga0496110_0373117 3300048913 Bacteria 1300
418 Ga0496112_0015093 3300048915 Bacteria 7195
419 Ga0496112_0086931 3300048915 Bacteria 3093
420 Ga0496112_0329513 3300048915 Bacteria 1471
421 Ga0496112_0493312 3300048915 Bacteria 1160
422 Ga0496113_0043069 3300048916 Bacteria 3338
423 Ga0496113_0158851 3300048916 Bacteria 1786
424 Ga0496113_0198708 3300048916 Bacteria 1593
425 Ga0496113_0696067 3300048916 Bacteria 811
426 Ga0496114_0156448 3300048917 Bacteria 1979
427 Ga0496114_0334799 3300048917 Bacteria 1338
428 Ga0496115_0035724 3300048918 Bacteria 3933
429 Ga0496117_0217221 3300048920 Bacteria 1067
430 Ga0496118_0130421 3300048921 Bacteria 1615
431 Ga0496119_0044301 3300048922 Bacteria 2803
432 Ga0496121_0000278 3300048924 Bacteria 106838
433 Ga0496121_0122719 3300048924 Bacteria 1959
434 Ga0496121_0284956 3300048924 Bacteria 1128
435 Ga0496122_0151453 3300048925 Bacteria 1431
436 Ga0496124_0305261 3300048927 Bacteria 1147
437 Ga0496125_0037843 3300048928 Bacteria 4189
438 Ga0496125_0120877 3300048928 Bacteria 1869
439 Ga0496126_0009449 3300048929 Bacteria 10350
440 Ga0496126_0012242 3300048929 Bacteria 8800
441 Ga0496126_0050659 3300048929 Bacteria 3783
442 Ga0496126_0057355 3300048929 Bacteria 3516
443 Ga0496126_0074141 3300048929 Bacteria 3023
444 Ga0496126_0127219 3300048929 Bacteria 2204
445 Ga0496126_0170929 3300048929 Bacteria 1852
446 Ga0496126_0223286 3300048929 Bacteria 1581
447 Ga0496126_0229433 3300048929 Bacteria 1556
448 Ga0496126_0313338 3300048929 Bacteria 1291
449 Ga0496126_0446454 3300048929 Bacteria 1042
450 Ga0501040_0254531 3300049576 Bacteria 1253
451 Ga0501047_0023892 3300049581 Bacteria 5870
452 Ga0501070_0380293 3300049586 Bacteria 1144
453 Ga0501076_0058517 3300049592 Bacteria 3064
454 Ga0501076_0331795 3300049592 Bacteria 1248
455 Ga0501080_0016386 3300049742 Bacteria 6845
456 Ga0501044_0017585 3300049823 Bacteria 7669
457 nmdc:mga03n38_12446_c1 3300050490 Bacteria 3202
458 nmdc:mga00v17_91427_c1 3300050491 Bacteria 1912
459 nmdc:mga0yw44_284956_c1 3300050492 Bacteria 1105
460 nmdc:mga0yw44_31098_c1 3300050492 Bacteria 3101
461 nmdc:mga0k408_14290_c1 3300050493 Bacteria 4371
462 nmdc:mga06z11_10188_c1 3300050494 Bacteria 3993
463 nmdc:mga07m45_11611_c1 3300050496 Bacteria 4631
464 nmdc:mga07m45_131205_c1 3300050496 Bacteria 1450
465 nmdc:mga07m45_44347_c1 3300050496 Bacteria 2496
466 nmdc:mga05p37_366330_c1 3300050507 Bacteria 1692
467 nmdc:mga0n895_193078_c1 3300050512 Bacteria 2067
468 nmdc:mga0rr50_206933_c1 3300050513 Bacteria 1615
469 nmdc:mga08x19_70835_c1 3300050514 Bacteria 2272
470 nmdc:mga0a205_274433_c1 3300050515 Bacteria 1562
471 nmdc:mga0sz30_97188_c2 3300050516 Bacteria 1034
472 Ga0495619_0075885 3300053085 Bacteria 2256
473 Ga0500643_000112 3300053087 Bacteria 84793
474 Ga0500566_0000262 3300053094 Bacteria 28125
475 Ga0500566_0001195 3300053094 Bacteria 15155
476 Ga0500566_0043727 3300053094 Bacteria 2580
477 Ga0500641_0053787 3300053096 Bacteria 1663
478 Ga0500555_049746 3300053103 Bacteria 1149
479 Ga0500556_0013991 3300053104 Bacteria 2441
480 Ga0500569_020432 3300053109 Bacteria 1738
481 Ga0500572_004331 3300053111 Bacteria 3222
482 Ga0500595_000510 3300053119 Bacteria 23431
483 Ga0500595_006468 3300053119 Bacteria 4966
484 Ga0500595_007359 3300053119 Bacteria 4572
485 Ga0500621_133385 3300053126 Bacteria 950
486 Ga0500568_0024502 3300053139 Bacteria 2555
487 Ga0500603_034509 3300053150 Bacteria 1322
488 Ga0500604_0051318 3300053151 Bacteria 1274
489 Ga0500616_0051130 3300053153 Bacteria 2179
490 Ga0500622_0018162 3300053156 Bacteria 3740
491 Ga0500637_0033859 3300053178 Bacteria 2855
492 Ga0500596_002288 3300053735 Bacteria 3790
493 Ga0500601_000103 3300053737 Bacteria 17658

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053085 Ga0495619_0075885 Ga0495619_0075885_1184_2056 241
2 3300046507 Ga0495606_0233003 Ga0495606_0233003_236_1021 261
3 3300048916 Ga0496113_0696067 Ga0496113_0696067_13_798 261
4 3300046524 Ga0495648_0251686 Ga0495648_0251686_34_822 262
5 3300013105 Ga0157369_10100287 Ga0157369_101002872 266
6 3300046691 Ga0495670_0158017 Ga0495670_0158017_20_832 270
7 3300048929 Ga0496126_0446454 Ga0496126_0446454_44_907 270
8 3300050492 nmdc:mga0yw44_284956_c1 nmdc:mga0yw44_284956_c1_277_1089 270
9 3300053126 Ga0500621_133385 Ga0500621_133385_18_830 270
10 3300006852 Ga0075433_10337240 Ga0075433_103372402 271
11 3300048905 Ga0496102_0760026 Ga0496102_0760026_11_832 273
12 3300025939 Ga0207665_10002143 Ga0207665_100021439 275
13 3300048924 Ga0496121_0284956 Ga0496121_0284956_49_888 276
14 3300037466 Ga0395898_0216683 Ga0395898_0216683_791_1627 278
15 3300037471 Ga0395905_0092570 Ga0395905_0092570_1858_2694 278
16 3300046454 Ga0495592_0086820 Ga0495592_0086820_92_949 278
17 3300048929 Ga0496126_0229433 Ga0496126_0229433_432_1334 279
18 3300047322 Ga0495680_0033981 Ga0495680_0033981_3022_3885 280
19 iso_pu_bacteria 2861691609 2861695531 281
20 3300025928 Ga0207700_10019075 Ga0207700_100190751 282
21 3300025942 Ga0207689_10256320 Ga0207689_102563203 283
22 3300050513 nmdc:mga0rr50_206933_c1 nmdc:mga0rr50_206933_c1_148_1011 283
23 3300050514 nmdc:mga08x19_70835_c1 nmdc:mga08x19_70835_c1_571_1434 283
24 3300050515 nmdc:mga0a205_274433_c1 nmdc:mga0a205_274433_c1_442_1305 283
25 3300053151 Ga0500604_0051318 Ga0500604_0051318_238_1089 283
26 iso_pu_bacteria 2513237092 2513623888 283
27 iso_pu_bacteria 2517572143 2517889085 283
28 iso_pu_bacteria 2524023205 2524441478 283
29 iso_pu_bacteria 2528768022 2528852695 283
30 iso_pu_bacteria 2617270741 2617373494 283
31 iso_pu_bacteria 2728368998 2728755251 283
32 iso_pu_bacteria 2744054633 2745077612 283
33 iso_pu_bacteria 2791355197 2793072674 283
34 iso_pu_bacteria 2791355199 2793078265 283
35 iso_pu_bacteria 2824653114 2824656333 283
36 iso_pu_bacteria 2824679649 2824684703 283
37 iso_pu_bacteria 2824704595 2824710353 283
38 iso_pu_bacteria 2824732956 2824737653 283
39 iso_pu_bacteria 2824746037 2824751175 283
40 iso_pu_bacteria 2824753945 2824760689 283
41 iso_pu_bacteria 2824763712 2824768493 283
42 iso_pu_bacteria 2841957949 2841965310 283
43 iso_pu_bacteria 2847930680 2847931284 283
44 iso_pu_bacteria 2857509624 2857516316 283
45 iso_pu_bacteria 2874612657 2874618680 283
46 iso_pu_bacteria 2874628541 2874628566 283
47 iso_pu_bacteria 2879083081 2879083807 283
48 iso_pu_bacteria 2879110137 2879113269 283
49 iso_pu_bacteria 2881364244 2881368963 283
50 iso_pu_bacteria 2881665667 2881666522 283
51 iso_pu_bacteria 2885374607 2885377593 283
52 iso_pu_bacteria 2885383462 2885385892 283
53 iso_pu_bacteria 2885409591 2885417958 283
54 iso_pu_bacteria 2888388044 2888390464 283
55 iso_pu_bacteria 2888419890 2888420084 283
56 iso_pu_bacteria 2889033259 2889035267 283
57 iso_pu_bacteria 2904711408 2904716291 283
58 iso_pu_bacteria 2906643746 2906648373 283
59 iso_pu_bacteria 2908739725 2908747690 283
60 iso_pu_bacteria 2908756301 2908757027 283
61 iso_pu_bacteria 2908775508 2908775965 283
62 iso_pu_bacteria 2922368715 2922369345 283
63 iso_pu_bacteria 2922393267 2922396544 283
64 iso_pu_bacteria 2929199973 2929203046 283
65 iso_pu_bacteria 2929615660 2929618827 283
66 iso_pu_bacteria 2929624759 2929628488 283
67 iso_pu_bacteria 2932784394 2932791004 283
68 iso_pu_bacteria 2932794094 2932794107 283
69 iso_pu_bacteria 2932801729 2932809182 283
70 iso_pu_bacteria 2932828146 2932833720 283
71 iso_pu_bacteria 2933577622 2933580463 283
72 iso_pu_bacteria 2935616580 2935623247 283
73 iso_pu_bacteria 2935630451 2935636004 283
74 iso_pu_bacteria 2935638405 2935644321 283
75 iso_pu_bacteria 2935665750 2935674962 283
76 iso_pu_bacteria 2935675223 2935679380 283
77 iso_pu_bacteria 2935684952 2935686622 283
78 iso_pu_bacteria 2935694250 2935700405 283
79 iso_pu_bacteria 2935703347 2935710354 283
80 iso_pu_bacteria 2935713505 2935716310 283
81 iso_pu_bacteria 2935722832 2935723566 283
82 iso_pu_bacteria 2935732158 2935735121 283
83 iso_pu_bacteria 2935741537 2935744088 283
84 iso_pu_bacteria 2935750917 2935752588 283
85 iso_pu_bacteria 2935801545 2935808345 283
86 iso_pu_bacteria 2935827899 2935833435 283
87 iso_pu_bacteria 2935837841 2935846007 283
88 iso_pu_bacteria 2935855204 2935861495 283
89 iso_pu_bacteria 2935864058 2935869614 283
90 iso_pu_bacteria 2935873716 2935879943 283
91 iso_pu_bacteria 2935883170 2935889134 283
92 iso_pu_bacteria 2935959822 2935966680 283
93 iso_pu_bacteria 2935992306 2935997835 283
94 iso_pu_bacteria 2936002035 2936008900 283
95 iso_pu_bacteria 2940556831 2940558501 283
96 iso_pu_bacteria 2941507105 2941512692 283
97 iso_pu_bacteria 2941515067 2941520470 283
98 iso_pu_bacteria 2941523033 2941528484 283
99 iso_pu_bacteria 2941538514 2941547112 283
100 iso_pu_bacteria 3005483717 3005486636 283
101 iso_pu_bacteria 3005587118 3005593255 283
102 iso_pu_bacteria 3005594810 3005595273 283
103 iso_pu_bacteria 3005718088 3005718520 283
104 iso_pu_bacteria 8006926726 8006927287 283
105 iso_pu_bacteria 8006984368 8006991143 283
106 iso_pu_bacteria 8016511872 8016517950 283
107 iso_pu_bacteria 8017057580 8017058688 283
108 iso_pu_bacteria 8019576017 8019576966 283
109 iso_pu_bacteria 8019586578 8019595032 283
110 iso_pu_bacteria 8019597564 8019606712 283
111 iso_pu_bacteria 8019608314 8019611798 283
112 iso_pu_bacteria 8019648815 8019652241 283
113 iso_pu_bacteria 8055742211 8055742676 283
114 iso_pu_bacteria 8055909800 8055912808 283
115 3300005329 Ga0070683_100004493 Ga0070683_10000449312 285
116 3300005336 Ga0070680_100084955 Ga0070680_1000849551 285
117 3300005434 Ga0070709_10205373 Ga0070709_102053732 285
118 3300005455 Ga0070663_100524167 Ga0070663_1005241671 285
119 3300005458 Ga0070681_10004178 Ga0070681_1000417818 285
120 3300005530 Ga0070679_100143811 Ga0070679_1001438112 285
121 3300005535 Ga0070684_100017771 Ga0070684_1000177717 285
122 3300005563 Ga0068855_100321361 Ga0068855_1003213611 285
123 3300005577 Ga0068857_100262780 Ga0068857_1002627802 285
124 3300006175 Ga0070712_100205057 Ga0070712_1002050572 285
125 3300009093 Ga0105240_10083500 Ga0105240_100835002 285
126 3300009174 Ga0105241_10131574 Ga0105241_101315742 285
127 3300009545 Ga0105237_10328542 Ga0105237_103285422 285
128 3300013105 Ga0157369_10106771 Ga0157369_101067712 285
129 3300013307 Ga0157372_10598202 Ga0157372_105982021 285
130 3300025911 Ga0207654_10035660 Ga0207654_100356601 285
131 3300025912 Ga0207707_10001922 Ga0207707_1000192217 285
132 3300025912 Ga0207707_10004003 Ga0207707_100040035 285
133 3300025916 Ga0207663_10302644 Ga0207663_103026441 285
134 3300025939 Ga0207665_10029872 Ga0207665_100298724 285
135 3300025949 Ga0207667_10390788 Ga0207667_103907882 285
136 3300026116 Ga0207674_10489534 Ga0207674_104895341 285
137 3300031730 Ga0307516_10189204 Ga0307516_101892042 285
138 3300035111 Ga0373923_0002828 Ga0373923_0002828_2285_3145 285
139 3300035410 Ga0373924_0059621 Ga0373924_0059621_466_1356 285
140 3300035695 Ga0373927_0131622 Ga0373927_0131622_669_1529 285
141 3300035724 Ga0373933_0109287 Ga0373933_0109287_218_1078 285
142 3300035725 Ga0373947_0073801 Ga0373947_0073801_589_1449 285
143 3300036401 Ga0373937_0299585 Ga0373937_0299585_390_1250 285
144 3300037068 Ga0373925_0007366 Ga0373925_0007366_585_1445 285
145 3300039447 Ga0436361_0065851 Ga0436361_0065851_1721_2578 285
146 3300044694 Ga0466963_0074583 Ga0466963_0074583_1076_1936 285
147 3300044706 Ga0466964_0125131 Ga0466964_0125131_261_1121 285
148 3300046472 Ga0495580_0008306 Ga0495580_0008306_823_1683 285
149 3300046473 Ga0495582_0125826 Ga0495582_0125826_106_966 285
150 3300046477 Ga0495664_0076788 Ga0495664_0076788_700_1560 285
151 3300046511 Ga0495608_0097163 Ga0495608_0097163_629_1489 285
152 3300046514 Ga0495618_0217781 Ga0495618_0217781_236_1096 285
153 3300046516 Ga0495628_0039866 Ga0495628_0039866_2003_2863 285
154 3300046517 Ga0495630_0245660 Ga0495630_0245660_200_1060 285
155 3300046531 Ga0495665_0059931 Ga0495665_0059931_443_1303 285
156 3300046533 Ga0495640_0094732 Ga0495640_0094732_559_1419 285
157 3300046535 Ga0495586_0066391 Ga0495586_0066391_1062_1949 285
158 3300046543 Ga0495645_0235879 Ga0495645_0235879_138_1028 285
159 3300046642 Ga0495634_0007375 Ga0495634_0007375_403_1263 285
160 3300046663 Ga0495635_0038630 Ga0495635_0038630_126_1016 285
161 3300046678 Ga0495599_0103854 Ga0495599_0103854_623_1483 285
162 3300046679 Ga0495623_0135665 Ga0495623_0135665_453_1313 285
163 3300046681 Ga0495647_0047425 Ga0495647_0047425_755_1615 285
164 3300046683 Ga0495658_0082202 Ga0495658_0082202_763_1623 285
165 3300047317 Ga0495604_0170620 Ga0495604_0170620_151_1041 285
166 3300047319 Ga0495674_0030756 Ga0495674_0030756_1909_2769 285
167 3300047471 Ga0495684_0046672 Ga0495684_0046672_1862_2722 285
168 3300048917 Ga0496114_0334799 Ga0496114_0334799_125_1024 285
169 3300048924 Ga0496121_0122719 Ga0496121_0122719_887_1747 285
170 3300031456 Ga0307513_10228685 Ga0307513_102286852 286
171 3300048929 Ga0496126_0127219 Ga0496126_0127219_146_1009 286
172 iso_pu_bacteria 2595698237 2596375655 286
173 iso_pu_bacteria 2928125067 2928130153 286
174 3300002077 JGI24744J21845_10026689 JGI24744J21845_100266891 287
175 3300003203 JGI25406J46586_10000256 JGI25406J46586_100002568 287
176 3300003354 JGI25160J50197_1010119 JGI25160J50197_10101194 287
177 3300003659 JGI25404J52841_10030083 JGI25404J52841_100300832 287
178 3300005328 Ga0070676_10051365 Ga0070676_100513652 287
179 3300005329 Ga0070683_100225276 Ga0070683_1002252763 287
180 3300005329 Ga0070683_100267135 Ga0070683_1002671352 287
181 3300005334 Ga0068869_100231800 Ga0068869_1002318003 287
182 3300005336 Ga0070680_100172832 Ga0070680_1001728321 287
183 3300005338 Ga0068868_100063413 Ga0068868_1000634133 287
184 3300005344 Ga0070661_100215637 Ga0070661_1002156373 287
185 3300005347 Ga0070668_100064385 Ga0070668_1000643852 287
186 3300005347 Ga0070668_100391541 Ga0070668_1003915411 287
187 3300005347 Ga0070668_100531356 Ga0070668_1005313561 287
188 3300005355 Ga0070671_100211609 Ga0070671_1002116092 287
189 3300005356 Ga0070674_100437666 Ga0070674_1004376661 287
190 3300005366 Ga0070659_100229930 Ga0070659_1002299302 287
191 3300005367 Ga0070667_100329723 Ga0070667_1003297232 287
192 3300005434 Ga0070709_10248826 Ga0070709_102488262 287
193 3300005436 Ga0070713_100017781 Ga0070713_1000177817 287
194 3300005436 Ga0070713_100035194 Ga0070713_1000351942 287
195 3300005436 Ga0070713_100664969 Ga0070713_1006649691 287
196 3300005437 Ga0070710_10013404 Ga0070710_100134041 287
197 3300005437 Ga0070710_10066561 Ga0070710_100665613 287
198 3300005437 Ga0070710_10110412 Ga0070710_101104121 287
199 3300005439 Ga0070711_100024466 Ga0070711_1000244662 287
200 3300005439 Ga0070711_100092851 Ga0070711_1000928513 287
201 3300005439 Ga0070711_100214900 Ga0070711_1002149002 287
202 3300005455 Ga0070663_100084709 Ga0070663_1000847093 287
203 3300005455 Ga0070663_100128118 Ga0070663_1001281182 287
204 3300005455 Ga0070663_100152397 Ga0070663_1001523972 287
205 3300005456 Ga0070678_100068347 Ga0070678_1000683473 287
206 3300005456 Ga0070678_100088081 Ga0070678_1000880813 287
207 3300005456 Ga0070678_100098874 Ga0070678_1000988742 287
208 3300005456 Ga0070678_100409735 Ga0070678_1004097352 287
209 3300005458 Ga0070681_10506463 Ga0070681_105064631 287
210 3300005468 Ga0070707_100254287 Ga0070707_1002542873 287
211 3300005471 Ga0070698_100296410 Ga0070698_1002964101 287
212 3300005530 Ga0070679_100085452 Ga0070679_1000854524 287
213 3300005535 Ga0070684_100008530 Ga0070684_10000853010 287
214 3300005543 Ga0070672_100274030 Ga0070672_1002740302 287
215 3300005543 Ga0070672_100311923 Ga0070672_1003119232 287
216 3300005546 Ga0070696_100092391 Ga0070696_1000923911 287
217 3300005548 Ga0070665_100007488 Ga0070665_1000074884 287
218 3300005548 Ga0070665_100056755 Ga0070665_1000567554 287
219 3300005548 Ga0070665_100164203 Ga0070665_1001642032 287
220 3300005548 Ga0070665_100309934 Ga0070665_1003099342 287
221 3300005548 Ga0070665_100556015 Ga0070665_1005560152 287
222 3300005548 Ga0070665_100604721 Ga0070665_1006047212 287
223 3300005563 Ga0068855_100142216 Ga0068855_1001422162 287
224 3300005564 Ga0070664_100070506 Ga0070664_1000705064 287
225 3300005564 Ga0070664_100233122 Ga0070664_1002331222 287
226 3300005614 Ga0068856_100158774 Ga0068856_1001587742 287
227 3300005614 Ga0068856_100167938 Ga0068856_1001679383 287
228 3300005614 Ga0068856_100171369 Ga0068856_1001713692 287
229 3300005615 Ga0070702_100082056 Ga0070702_1000820561 287
230 3300005616 Ga0068852_100088408 Ga0068852_1000884082 287
231 3300005616 Ga0068852_100237125 Ga0068852_1002371252 287
232 3300005616 Ga0068852_100332500 Ga0068852_1003325002 287
233 3300005618 Ga0068864_100055366 Ga0068864_1000553662 287
234 3300005719 Ga0068861_100248587 Ga0068861_1002485872 287
235 3300005719 Ga0068861_100253242 Ga0068861_1002532422 287
236 3300005834 Ga0068851_10132809 Ga0068851_101328091 287
237 3300005841 Ga0068863_100169065 Ga0068863_1001690651 287
238 3300005842 Ga0068858_100137134 Ga0068858_1001371342 287
239 3300005843 Ga0068860_100012321 Ga0068860_1000123216 287
240 3300005843 Ga0068860_100650921 Ga0068860_1006509211 287
241 3300005844 Ga0068862_100083456 Ga0068862_1000834562 287
242 3300005844 Ga0068862_100185626 Ga0068862_1001856262 287
243 3300005844 Ga0068862_100383487 Ga0068862_1003834872 287
244 3300005937 Ga0081455_10013159 Ga0081455_100131599 287
245 3300005937 Ga0081455_10102881 Ga0081455_101028813 287
246 3300005937 Ga0081455_10195921 Ga0081455_101959212 287
247 3300005937 Ga0081455_10228712 Ga0081455_102287122 287
248 3300005983 Ga0081540_1002532 Ga0081540_100253210 287
249 3300005983 Ga0081540_1004042 Ga0081540_10040427 287
250 3300005983 Ga0081540_1005765 Ga0081540_10057653 287
251 3300005983 Ga0081540_1012681 Ga0081540_10126811 287
252 3300005983 Ga0081540_1026337 Ga0081540_10263373 287
253 3300005983 Ga0081540_1030647 Ga0081540_10306473 287
254 3300005983 Ga0081540_1030772 Ga0081540_10307723 287
255 3300005983 Ga0081540_1033763 Ga0081540_10337632 287
256 3300005983 Ga0081540_1043864 Ga0081540_10438642 287
257 3300005983 Ga0081540_1100942 Ga0081540_11009421 287
258 3300005985 Ga0081539_10000608 Ga0081539_1000060827 287
259 3300005985 Ga0081539_10002743 Ga0081539_1000274316 287
260 3300005985 Ga0081539_10015726 Ga0081539_100157264 287
261 3300006028 Ga0070717_10071574 Ga0070717_100715741 287
262 3300006038 Ga0075365_10055327 Ga0075365_100553272 287
263 3300006038 Ga0075365_10156257 Ga0075365_101562572 287
264 3300006042 Ga0075368_10020073 Ga0075368_100200733 287
265 3300006048 Ga0075363_100027180 Ga0075363_1000271802 287
266 3300006048 Ga0075363_100067041 Ga0075363_1000670412 287
267 3300006048 Ga0075363_100123870 Ga0075363_1001238701 287
268 3300006051 Ga0075364_10176890 Ga0075364_101768902 287
269 3300006173 Ga0070716_100011909 Ga0070716_1000119092 287
270 3300006173 Ga0070716_100178917 Ga0070716_1001789172 287
271 3300006175 Ga0070712_100003832 Ga0070712_1000038328 287
272 3300006177 Ga0075362_10139874 Ga0075362_101398742 287
273 3300006178 Ga0075367_10219987 Ga0075367_102199872 287
274 3300006186 Ga0075369_10145700 Ga0075369_101457001 287
275 3300006353 Ga0075370_10063578 Ga0075370_100635781 287
276 3300006353 Ga0075370_10066654 Ga0075370_100666543 287
277 3300006353 Ga0075370_10190787 Ga0075370_101907871 287
278 3300006358 Ga0068871_100275134 Ga0068871_1002751341 287
279 3300006358 Ga0068871_100312572 Ga0068871_1003125721 287
280 3300006844 Ga0075428_100609249 Ga0075428_1006092492 287
281 3300006871 Ga0075434_100272871 Ga0075434_1002728712 287
282 3300006871 Ga0075434_100502163 Ga0075434_1005021632 287
283 3300006881 Ga0068865_100026883 Ga0068865_1000268836 287
284 3300006881 Ga0068865_100190263 Ga0068865_1001902631 287
285 3300006941 Ga0099825_1041592 Ga0099825_10415923 287
286 3300006942 Ga0099824_1010733 Ga0099824_101073311 287
287 3300006944 Ga0099823_1024318 Ga0099823_10243182 287
288 3300007076 Ga0075435_100278872 Ga0075435_1002788722 287
289 3300007265 Ga0099794_10039477 Ga0099794_100394772 287
290 3300007265 Ga0099794_10042583 Ga0099794_100425832 287
291 3300007265 Ga0099794_10166001 Ga0099794_101660012 287
292 3300007788 Ga0099795_10033741 Ga0099795_100337412 287
293 3300007788 Ga0099795_10058832 Ga0099795_100588322 287
294 3300009093 Ga0105240_10107526 Ga0105240_101075263 287
295 3300009093 Ga0105240_10481236 Ga0105240_104812362 287
296 3300009094 Ga0111539_10395682 Ga0111539_103956822 287
297 3300009094 Ga0111539_11021987 Ga0111539_110219871 287
298 3300009098 Ga0105245_10358380 Ga0105245_103583801 287
299 3300009147 Ga0114129_10065816 Ga0114129_100658163 287
300 3300009148 Ga0105243_10204135 Ga0105243_102041352 287
301 3300009176 Ga0105242_10063484 Ga0105242_100634842 287
302 3300009176 Ga0105242_10074820 Ga0105242_100748202 287
303 3300009177 Ga0105248_10363041 Ga0105248_103630412 287
304 3300009177 Ga0105248_10403707 Ga0105248_104037073 287
305 3300009177 Ga0105248_10665248 Ga0105248_106652482 287
306 3300009177 Ga0105248_10813745 Ga0105248_108137451 287
307 3300009551 Ga0105238_10449372 Ga0105238_104493721 287
308 3300009553 Ga0105249_10155359 Ga0105249_101553592 287
309 3300009553 Ga0105249_10306303 Ga0105249_103063032 287
310 3300009553 Ga0105249_10777957 Ga0105249_107779571 287
311 3300010159 Ga0099796_10064718 Ga0099796_100647181 287
312 3300010159 Ga0099796_10070882 Ga0099796_100708821 287
313 3300010375 Ga0105239_10120748 Ga0105239_101207483 287
314 3300010375 Ga0105239_10254404 Ga0105239_102544042 287
315 3300012478 Ga0157328_1001009 Ga0157328_10010091 287
316 3300013104 Ga0157370_10188253 Ga0157370_101882532 287
317 3300013105 Ga0157369_10076832 Ga0157369_100768324 287
318 3300013296 Ga0157374_10155243 Ga0157374_101552433 287
319 3300013296 Ga0157374_10318837 Ga0157374_103188372 287
320 3300013297 Ga0157378_10042708 Ga0157378_100427081 287
321 3300013297 Ga0157378_10216804 Ga0157378_102168043 287
322 3300013306 Ga0163162_10110451 Ga0163162_101104513 287
323 3300013306 Ga0163162_10365186 Ga0163162_103651861 287
324 3300013306 Ga0163162_10415051 Ga0163162_104150512 287
325 3300013307 Ga0157372_10172224 Ga0157372_101722242 287
326 3300013308 Ga0157375_10225207 Ga0157375_102252072 287
327 3300013308 Ga0157375_10275017 Ga0157375_102750172 287
328 3300013308 Ga0157375_10423671 Ga0157375_104236713 287
329 3300014325 Ga0163163_10075527 Ga0163163_100755274 287
330 3300014325 Ga0163163_10095036 Ga0163163_100950362 287
331 3300014326 Ga0157380_10069744 Ga0157380_100697444 287
332 3300014968 Ga0157379_10159655 Ga0157379_101596552 287
333 3300014968 Ga0157379_10194410 Ga0157379_101944103 287
334 3300014969 Ga0157376_10058496 Ga0157376_100584964 287
335 3300017792 Ga0163161_10171795 Ga0163161_101717951 287
336 3300021320 Ga0214544_1000665 Ga0214544_100066545 287
337 3300021321 Ga0214542_1000486 Ga0214542_100048645 287
338 3300021324 Ga0214545_1000307 Ga0214545_100030745 287
339 3300021388 Ga0213875_10001636 Ga0213875_100016368 287
340 3300025295 Ga0209564_1003322 Ga0209564_10033223 287
341 3300025297 Ga0209758_1007720 Ga0209758_10077205 287
342 3300025297 Ga0209758_1008227 Ga0209758_10082273 287
343 3300025297 Ga0209758_1026917 Ga0209758_10269172 287
344 3300025297 Ga0209758_1049406 Ga0209758_10494062 287
345 3300025302 Ga0207426_1000227 Ga0207426_10002274 287
346 3300025302 Ga0207426_1015497 Ga0207426_10154972 287
347 3300025321 Ga0207656_10017867 Ga0207656_100178672 287
348 3300025885 Ga0207653_10042857 Ga0207653_100428572 287
349 3300025898 Ga0207692_10057636 Ga0207692_100576361 287
350 3300025901 Ga0207688_10085686 Ga0207688_100856863 287
351 3300025901 Ga0207688_10136080 Ga0207688_101360802 287
352 3300025903 Ga0207680_10274061 Ga0207680_102740612 287
353 3300025905 Ga0207685_10008828 Ga0207685_100088282 287
354 3300025906 Ga0207699_10016829 Ga0207699_100168291 287
355 3300025907 Ga0207645_10169027 Ga0207645_101690272 287
356 3300025908 Ga0207643_10028484 Ga0207643_100284843 287
357 3300025908 Ga0207643_10204988 Ga0207643_102049881 287
358 3300025912 Ga0207707_10146040 Ga0207707_101460402 287
359 3300025913 Ga0207695_10195102 Ga0207695_101951021 287
360 3300025915 Ga0207693_10004965 Ga0207693_1000496512 287
361 3300025915 Ga0207693_10031046 Ga0207693_100310468 287
362 3300025916 Ga0207663_10099686 Ga0207663_100996862 287
363 3300025916 Ga0207663_10163013 Ga0207663_101630131 287
364 3300025917 Ga0207660_10277349 Ga0207660_102773492 287
365 3300025917 Ga0207660_10390337 Ga0207660_103903371 287
366 3300025920 Ga0207649_10208901 Ga0207649_102089012 287
367 3300025920 Ga0207649_10238119 Ga0207649_102381192 287
368 3300025925 Ga0207650_10127360 Ga0207650_101273601 287
369 3300025927 Ga0207687_10029203 Ga0207687_100292035 287
370 3300025928 Ga0207700_10066757 Ga0207700_100667573 287
371 3300025928 Ga0207700_10380321 Ga0207700_103803212 287
372 3300025929 Ga0207664_10022137 Ga0207664_100221373 287
373 3300025929 Ga0207664_10086456 Ga0207664_100864562 287
374 3300025931 Ga0207644_10036883 Ga0207644_100368832 287
375 3300025931 Ga0207644_10094104 Ga0207644_100941042 287
376 3300025931 Ga0207644_10182793 Ga0207644_101827932 287
377 3300025931 Ga0207644_10334960 Ga0207644_103349602 287
378 3300025931 Ga0207644_10357459 Ga0207644_103574592 287
379 3300025934 Ga0207686_10103139 Ga0207686_101031393 287
380 3300025935 Ga0207709_10160378 Ga0207709_101603781 287
381 3300025935 Ga0207709_10309115 Ga0207709_103091152 287
382 3300025936 Ga0207670_10200708 Ga0207670_102007082 287
383 3300025937 Ga0207669_10351900 Ga0207669_103519001 287
384 3300025937 Ga0207669_10392569 Ga0207669_103925691 287
385 3300025938 Ga0207704_10076792 Ga0207704_100767921 287
386 3300025938 Ga0207704_10175380 Ga0207704_101753802 287
387 3300025939 Ga0207665_10082302 Ga0207665_100823022 287
388 3300025939 Ga0207665_10379223 Ga0207665_103792231 287
389 3300025940 Ga0207691_10206849 Ga0207691_102068492 287
390 3300025940 Ga0207691_10536211 Ga0207691_105362111 287
391 3300025941 Ga0207711_10197843 Ga0207711_101978432 287
392 3300025941 Ga0207711_10337525 Ga0207711_103375252 287
393 3300025941 Ga0207711_10411125 Ga0207711_104111251 287
394 3300025941 Ga0207711_10496534 Ga0207711_104965342 287
395 3300025942 Ga0207689_10080784 Ga0207689_100807843 287
396 3300025944 Ga0207661_10001440 Ga0207661_1000144015 287
397 3300025949 Ga0207667_10015124 Ga0207667_100151242 287
398 3300025949 Ga0207667_10373276 Ga0207667_103732761 287
399 3300025961 Ga0207712_10079702 Ga0207712_100797021 287
400 3300025972 Ga0207668_10172071 Ga0207668_101720712 287
401 3300025981 Ga0207640_10345526 Ga0207640_103455262 287
402 3300025986 Ga0207658_10394923 Ga0207658_103949231 287
403 3300026023 Ga0207677_10031839 Ga0207677_100318393 287
404 3300026035 Ga0207703_10179288 Ga0207703_101792881 287
405 3300026035 Ga0207703_10293039 Ga0207703_102930391 287
406 3300026067 Ga0207678_10018024 Ga0207678_100180248 287
407 3300026067 Ga0207678_10173868 Ga0207678_101738682 287
408 3300026067 Ga0207678_10266536 Ga0207678_102665362 287
409 3300026067 Ga0207678_10328124 Ga0207678_103281242 287
410 3300026075 Ga0207708_10194866 Ga0207708_101948662 287
411 3300026088 Ga0207641_10163747 Ga0207641_101637471 287
412 3300026088 Ga0207641_10239518 Ga0207641_102395182 287
413 3300026089 Ga0207648_10039454 Ga0207648_100394546 287
414 3300026095 Ga0207676_10041483 Ga0207676_100414832 287
415 3300026118 Ga0207675_100535515 Ga0207675_1005355151 287
416 3300026121 Ga0207683_10137722 Ga0207683_101377222 287
417 3300026121 Ga0207683_10264107 Ga0207683_102641072 287
418 3300027296 Ga0209389_1000102 Ga0209389_100010221 287
419 3300027361 Ga0209489_100404 Ga0209489_10040421 287
420 3300027363 Ga0209700_100408 Ga0209700_10040821 287
421 3300027671 Ga0209588_1020217 Ga0209588_10202172 287
422 3300028379 Ga0268266_10001335 Ga0268266_1000133521 287
423 3300028379 Ga0268266_10007399 Ga0268266_1000739912 287
424 3300028379 Ga0268266_10041505 Ga0268266_100415054 287
425 3300028379 Ga0268266_10131781 Ga0268266_101317812 287
426 3300028379 Ga0268266_10268529 Ga0268266_102685291 287
427 3300028379 Ga0268266_10403715 Ga0268266_104037151 287
428 3300028380 Ga0268265_10351825 Ga0268265_103518252 287
429 3300028380 Ga0268265_10393734 Ga0268265_103937341 287
430 3300028380 Ga0268265_10663750 Ga0268265_106637501 287
431 3300028786 Ga0307517_10000232 Ga0307517_1000023265 287
432 3300028786 Ga0307517_10235784 Ga0307517_102357841 287
433 3300028794 Ga0307515_10014473 Ga0307515_1001447314 287
434 3300028794 Ga0307515_10227436 Ga0307515_102274362 287
435 3300031616 Ga0307508_10337453 Ga0307508_103374531 287
436 3300031616 Ga0307508_10362687 Ga0307508_103626871 287
437 3300031730 Ga0307516_10003539 Ga0307516_1000353913 287
438 3300031903 Ga0307407_10119493 Ga0307407_101194932 287
439 3300032126 Ga0307415_100059673 Ga0307415_1000596735 287
440 3300033180 Ga0307510_10006006 Ga0307510_1000600613 287
441 3300033180 Ga0307510_10031035 Ga0307510_100310353 287
442 3300035113 Ga0373936_0114110 Ga0373936_0114110_269_1135 287
443 3300035116 Ga0373945_0116258 Ga0373945_0116258_171_1034 287
444 3300035691 Ga0373931_0011946 Ga0373931_0011946_3280_4143 287
445 3300035691 Ga0373931_0116542 Ga0373931_0116542_18_881 287
446 3300035691 Ga0373931_0181362 Ga0373931_0181362_348_1211 287
447 3300035695 Ga0373927_0056083 Ga0373927_0056083_309_1181 287
448 3300037068 Ga0373925_0432033 Ga0373925_0432033_41_904 287
449 3300037418 Ga0395900_0013918 Ga0395900_0013918_119_985 287
450 3300037466 Ga0395898_0233678 Ga0395898_0233678_457_1323 287
451 3300037471 Ga0395905_0005023 Ga0395905_0005023_9463_10326 287
452 3300037853 Ga0436364_1210479 Ga0436364_1210479_1577_2449 287
453 3300037853 Ga0436364_1557054 Ga0436364_1557054_8925_9794 287
454 3300038443 Ga0395901_0061354 Ga0395901_0061354_2530_3396 287
455 3300039437 Ga0436365_1053579 Ga0436365_1053579_1714_2580 287
456 3300039437 Ga0436365_1552613 Ga0436365_1552613_1169_2035 287
457 3300039438 Ga0436360_0314278 Ga0436360_0314278_23_886 287
458 3300039447 Ga0436361_0203807 Ga0436361_0203807_284_1147 287
459 3300039450 Ga0436363_1615506 Ga0436363_1615506_595_1464 287
460 3300041413 Ga0439465_0090232 Ga0439465_0090232_28_891 287
461 3300041512 Ga0451853_0630845 Ga0451853_0630845_119_982 287
462 3300044901 Ga0466960_0083184 Ga0466960_0083184_184_1071 287
463 3300044901 Ga0466960_0084589 Ga0466960_0084589_102_965 287
464 3300046455 Ga0495603_0026994 Ga0495603_0026994_301_1164 287
465 3300046455 Ga0495603_0038286 Ga0495603_0038286_222_1085 287
466 3300046455 Ga0495603_0152586 Ga0495603_0152586_295_1158 287
467 3300046459 Ga0495629_0069802 Ga0495629_0069802_1207_2070 287
468 3300046460 Ga0495638_0000880 Ga0495638_0000880_24834_25697 287
469 3300046460 Ga0495638_0016028 Ga0495638_0016028_2214_3191 287
470 3300046471 Ga0495650_0120184 Ga0495650_0120184_28_891 287
471 3300046475 Ga0495639_0174414 Ga0495639_0174414_148_1011 287
472 3300046477 Ga0495664_0196285 Ga0495664_0196285_95_964 287
473 3300046501 Ga0495607_0046038 Ga0495607_0046038_68_931 287
474 3300046507 Ga0495606_0027491 Ga0495606_0027491_1159_2022 287
475 3300046507 Ga0495606_0177447 Ga0495606_0177447_103_966 287
476 3300046517 Ga0495630_0300701 Ga0495630_0300701_310_1203 287
477 3300046518 Ga0495631_0044402 Ga0495631_0044402_828_1691 287
478 3300046524 Ga0495648_0166067 Ga0495648_0166067_172_1035 287
479 3300046526 Ga0495666_0184384 Ga0495666_0184384_40_903 287
480 3300046557 Ga0495622_0134533 Ga0495622_0134533_145_1008 287
481 3300046558 Ga0495633_0163055 Ga0495633_0163055_73_1005 287
482 3300046559 Ga0495667_0254202 Ga0495667_0254202_172_1035 287
483 3300046616 Ga0495668_0041407 Ga0495668_0041407_1671_2534 287
484 3300046616 Ga0495668_0072360 Ga0495668_0072360_923_1786 287
485 3300046616 Ga0495668_0095614 Ga0495668_0095614_151_1014 287
486 3300046616 Ga0495668_0112011 Ga0495668_0112011_590_1453 287
487 3300046674 Ga0495588_0048023 Ga0495588_0048023_1107_1970 287
488 3300046683 Ga0495658_0228587 Ga0495658_0228587_144_1007 287
489 3300046684 Ga0495669_0124823 Ga0495669_0124823_239_1102 287
490 3300046684 Ga0495669_0152493 Ga0495669_0152493_29_892 287
491 3300046809 Ga0495600_0105711 Ga0495600_0105711_85_948 287
492 3300046810 Ga0495660_0135853 Ga0495660_0135853_158_1021 287
493 3300047317 Ga0495604_0152879 Ga0495604_0152879_236_1102 287
494 3300047319 Ga0495674_0355654 Ga0495674_0355654_62_955 287
495 3300047321 Ga0495676_0114377 Ga0495676_0114377_129_992 287
496 3300047323 Ga0495683_0084414 Ga0495683_0084414_457_1320 287
497 3300047469 Ga0495673_0059562 Ga0495673_0059562_423_1298 287
498 3300047472 Ga0495686_0035021 Ga0495686_0035021_953_1816 287
499 3300047472 Ga0495686_0065554 Ga0495686_0065554_113_976 287
500 3300047472 Ga0495686_0206115 Ga0495686_0206115_136_999 287
501 3300048904 Ga0496101_0052618 Ga0496101_0052618_127_990 287
502 3300048904 Ga0496101_0064543 Ga0496101_0064543_1564_2427 287
503 3300048904 Ga0496101_0142579 Ga0496101_0142579_364_1227 287
504 3300048904 Ga0496101_0483125 Ga0496101_0483125_29_892 287
505 3300048905 Ga0496102_0086858 Ga0496102_0086858_514_1377 287
506 3300048905 Ga0496102_0154865 Ga0496102_0154865_1081_1944 287
507 3300048905 Ga0496102_0276551 Ga0496102_0276551_496_1359 287
508 3300048906 Ga0496103_0007418 Ga0496103_0007418_5583_6446 287
509 3300048906 Ga0496103_0166258 Ga0496103_0166258_199_1062 287
510 3300048907 Ga0496104_0116558 Ga0496104_0116558_1332_2195 287
511 3300048908 Ga0496105_0076445 Ga0496105_0076445_243_1106 287
512 3300048909 Ga0496106_0108762 Ga0496106_0108762_1082_1945 287
513 3300048909 Ga0496106_0166362 Ga0496106_0166362_478_1341 287
514 3300048910 Ga0496107_0014960 Ga0496107_0014960_3926_4789 287
515 3300048910 Ga0496107_0039070 Ga0496107_0039070_339_1202 287
516 3300048910 Ga0496107_0246619 Ga0496107_0246619_283_1146 287
517 3300048910 Ga0496107_0273407 Ga0496107_0273407_342_1205 287
518 3300048910 Ga0496107_0340372 Ga0496107_0340372_242_1105 287
519 3300048911 Ga0496108_0019609 Ga0496108_0019609_1968_2831 287
520 3300048912 Ga0496109_0033949 Ga0496109_0033949_253_1116 287
521 3300048913 Ga0496110_0026542 Ga0496110_0026542_235_1098 287
522 3300048913 Ga0496110_0072012 Ga0496110_0072012_1552_2415 287
523 3300048913 Ga0496110_0373117 Ga0496110_0373117_333_1196 287
524 3300048915 Ga0496112_0015093 Ga0496112_0015093_4675_5538 287
525 3300048915 Ga0496112_0086931 Ga0496112_0086931_873_1736 287
526 3300048915 Ga0496112_0329513 Ga0496112_0329513_42_905 287
527 3300048915 Ga0496112_0493312 Ga0496112_0493312_50_991 287
528 3300048916 Ga0496113_0043069 Ga0496113_0043069_299_1162 287
529 3300048916 Ga0496113_0158851 Ga0496113_0158851_653_1516 287
530 3300048916 Ga0496113_0198708 Ga0496113_0198708_492_1355 287
531 3300048917 Ga0496114_0156448 Ga0496114_0156448_151_1014 287
532 3300048918 Ga0496115_0035724 Ga0496115_0035724_1061_1924 287
533 3300048920 Ga0496117_0217221 Ga0496117_0217221_36_899 287
534 3300048921 Ga0496118_0130421 Ga0496118_0130421_299_1162 287
535 3300048922 Ga0496119_0044301 Ga0496119_0044301_115_1056 287
536 3300048924 Ga0496121_0000278 Ga0496121_0000278_90242_91105 287
537 3300048925 Ga0496122_0151453 Ga0496122_0151453_341_1204 287
538 3300048927 Ga0496124_0305261 Ga0496124_0305261_251_1114 287
539 3300048928 Ga0496125_0037843 Ga0496125_0037843_198_1061 287
540 3300048928 Ga0496125_0120877 Ga0496125_0120877_783_1646 287
541 3300048929 Ga0496126_0009449 Ga0496126_0009449_1924_2787 287
542 3300048929 Ga0496126_0012242 Ga0496126_0012242_1105_1968 287
543 3300048929 Ga0496126_0050659 Ga0496126_0050659_1426_2289 287
544 3300048929 Ga0496126_0057355 Ga0496126_0057355_1368_2231 287
545 3300048929 Ga0496126_0074141 Ga0496126_0074141_1017_1883 287
546 3300048929 Ga0496126_0170929 Ga0496126_0170929_347_1210 287
547 3300048929 Ga0496126_0223286 Ga0496126_0223286_476_1339 287
548 3300048929 Ga0496126_0313338 Ga0496126_0313338_13_876 287
549 3300049576 Ga0501040_0254531 Ga0501040_0254531_227_1090 287
550 3300049581 Ga0501047_0023892 Ga0501047_0023892_224_1090 287
551 3300049586 Ga0501070_0380293 Ga0501070_0380293_44_907 287
552 3300049592 Ga0501076_0058517 Ga0501076_0058517_2187_3050 287
553 3300049592 Ga0501076_0331795 Ga0501076_0331795_139_1002 287
554 3300049742 Ga0501080_0016386 Ga0501080_0016386_4324_5190 287
555 3300049823 Ga0501044_0017585 Ga0501044_0017585_2272_3138 287
556 3300050490 nmdc:mga03n38_12446_c1 nmdc:mga03n38_12446_c1_2194_3057 287
557 3300050491 nmdc:mga00v17_91427_c1 nmdc:mga00v17_91427_c1_955_1818 287
558 3300050492 nmdc:mga0yw44_31098_c1 nmdc:mga0yw44_31098_c1_1782_2645 287
559 3300050493 nmdc:mga0k408_14290_c1 nmdc:mga0k408_14290_c1_37_900 287
560 3300050494 nmdc:mga06z11_10188_c1 nmdc:mga06z11_10188_c1_2903_3766 287
561 3300050496 nmdc:mga07m45_11611_c1 nmdc:mga07m45_11611_c1_3620_4483 287
562 3300050496 nmdc:mga07m45_131205_c1 nmdc:mga07m45_131205_c1_352_1215 287
563 3300050496 nmdc:mga07m45_44347_c1 nmdc:mga07m45_44347_c1_1226_2089 287
564 3300050507 nmdc:mga05p37_366330_c1 nmdc:mga05p37_366330_c1_344_1207 287
565 3300050512 nmdc:mga0n895_193078_c1 nmdc:mga0n895_193078_c1_99_962 287
566 3300050516 nmdc:mga0sz30_97188_c2 nmdc:mga0sz30_97188_c2_81_944 287
567 3300053087 Ga0500643_000112 Ga0500643_000112_49524_50387 287
568 3300053094 Ga0500566_0000262 Ga0500566_0000262_19334_20197 287
569 3300053094 Ga0500566_0001195 Ga0500566_0001195_13931_14797 287
570 3300053094 Ga0500566_0043727 Ga0500566_0043727_1504_2367 287
571 3300053096 Ga0500641_0053787 Ga0500641_0053787_749_1612 287
572 3300053103 Ga0500555_049746 Ga0500555_049746_40_903 287
573 3300053104 Ga0500556_0013991 Ga0500556_0013991_1234_2097 287
574 3300053109 Ga0500569_020432 Ga0500569_020432_837_1700 287
575 3300053111 Ga0500572_004331 Ga0500572_004331_528_1394 287
576 3300053119 Ga0500595_000510 Ga0500595_000510_18661_19524 287
577 3300053119 Ga0500595_006468 Ga0500595_006468_4055_4918 287
578 3300053119 Ga0500595_007359 Ga0500595_007359_3467_4330 287
579 3300053139 Ga0500568_0024502 Ga0500568_0024502_1169_2032 287
580 3300053150 Ga0500603_034509 Ga0500603_034509_280_1146 287
581 3300053153 Ga0500616_0051130 Ga0500616_0051130_901_1764 287
582 3300053156 Ga0500622_0018162 Ga0500622_0018162_1909_2772 287
583 3300053178 Ga0500637_0033859 Ga0500637_0033859_234_1097 287
584 3300053735 Ga0500596_002288 Ga0500596_002288_796_1662 287
585 3300053737 Ga0500601_000103 Ga0500601_000103_12454_13317 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

60

308

0.79

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

62

314

0.59

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hgu-assembly1.cif.gz_B epoxide hydrolase from bosea sp. pamc 26642 0.9789 2 281
8hgu-assembly1.cif.gz_B epoxide hydrolase from bosea sp. pamc 26642 0.952 2 281
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.9179 2 123
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.9165 2 123
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.9145 2 121
ID Description Score Start End Superfamily
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9391 11 121 3.40.50.12270
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9315 2 122 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9119 2 85 3.40.50.12270
5ng7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9078 2 283 3.40.50.1820
af_P96811_2_293_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8936 2 281 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0R3BR81-F1-model_v4 deleted 0.998 1 287
AF-A0A7S7Z0V4-F1-model_v4 Alpha/beta hydrolase 0.9976 1 287 GO:0016787
AF-A0A0S6UKJ3-F1-model_v4 Soluble epoxide hydrolase 0.9965 1 287 GO:0016787
AF-A0A0S6UKJ3-F1-model_v4 Soluble epoxide hydrolase 0.9931 1 287 GO:0016787
AF-A7IG07-F1-model_v4 Alpha/beta hydrolase fold 0.9872 2 284 GO:0016787

Feature Viewer

pLDDT pTM Quality
96.15 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map