F466501

General Info

Members Datasets Scaffolds Average Seq Length
585 225 585 279

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0082426|Ga0501075_0082426_1112_2044
Length 310
Sequence MQDLAHRLHELCDPLPFDTSWFLKDWRTGATADRRGDVPVPSASTRKISILMATLAAVHAGKLALDQTVTIEARYQDNDSGTFQHLTPGFAITLRDALVMMIIVSDNTCTGMVVDLVGLGPLQRYCESIGLKRTIHRFGIPPRLGPDHALDQVTTTTPADQGLLLELIQRGTADAAVATRLGCTGALCRLAIDILSWQKLKTRLPSLLPAGTKIAHKTGTGSRGYMDAGIVFKDDRPLFILTAYTDHVPAALPDGTPGFAAANLLIGRLARACWDALAERDRHGRRPGTAHGQADRRLVSMNPVHEGRPA

Samples

Sample ID Description Type Environment
1 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
159 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
162 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
172 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
173 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
174 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
175 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
176 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.03
Rhizosphere 98.63
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26141J51220_1000549 3300003503 Bacteria 2112
2 Ga0058859_10715401 3300004798 Bacteria 1313
3 Ga0058860_11434841 3300004801 Bacteria 1507
4 Ga0065715_10310122 3300005293 Bacteria 1020
5 Ga0070676_10004841 3300005328 Bacteria 7123
6 Ga0070683_100346544 3300005329 Bacteria 1415
7 Ga0070690_100012799 3300005330 Bacteria 4942
8 Ga0070670_100010918 3300005331 Bacteria 7757
9 Ga0070677_10032626 3300005333 Bacteria 1999
10 Ga0068869_100004848 3300005334 Bacteria 8406
11 Ga0068869_100007099 3300005334 Bacteria 7136
12 Ga0068869_100109819 3300005334 Bacteria 2097
13 Ga0070680_100049024 3300005336 Bacteria 3442
14 Ga0070682_100000416 3300005337 Bacteria 27786
15 Ga0070660_100000083 3300005339 Bacteria 56648
16 Ga0070691_10006575 3300005341 Bacteria 5319
17 Ga0070691_10012905 3300005341 Bacteria 3826
18 Ga0070691_10020985 3300005341 Unclassified 3021
19 Ga0070691_10140875 3300005341 Bacteria 1229
20 Ga0070661_100000403 3300005344 Bacteria 33584
21 Ga0070692_10265290 3300005345 Unclassified 1034
22 Ga0070669_100062878 3300005353 Unclassified 2731
23 Ga0070673_100004405 3300005364 Bacteria 8904
24 Ga0070688_100166189 3300005365 Unclassified 1519
25 Ga0070659_100005267 3300005366 Bacteria 9282
26 Ga0070667_100097355 3300005367 Bacteria 2538
27 Ga0070703_10035063 3300005406 Bacteria 1535
28 Ga0070703_10055642 3300005406 Bacteria 1279
29 Ga0070701_10062815 3300005438 Unclassified 1963
30 Ga0070705_100001037 3300005440 Bacteria 15457
31 Ga0070705_100050177 3300005440 Bacteria 2426
32 Ga0070705_100068458 3300005440 Bacteria 2136
33 Ga0070705_100089873 3300005440 Bacteria 1910
34 Ga0070700_100012818 3300005441 Bacteria 4696
35 Ga0070700_100034282 3300005441 Bacteria 3065
36 Ga0070700_100347217 3300005441 Unclassified 1099
37 Ga0070694_100000219 3300005444 Bacteria 30020
38 Ga0070694_100001050 3300005444 Bacteria 15776
39 Ga0070694_100011718 3300005444 Bacteria 5433
40 Ga0070694_100015160 3300005444 Bacteria 4834
41 Ga0070708_100004339 3300005445 Bacteria 11140
42 Ga0070708_100013850 3300005445 Bacteria 6622
43 Ga0070708_100054517 3300005445 Bacteria 3551
44 Ga0070708_100088101 3300005445 Bacteria 2821
45 Ga0070663_100022346 3300005455 Unclassified 4228
46 Ga0070662_100046425 3300005457 Bacteria 3121
47 Ga0070681_10001393 3300005458 Bacteria 21189
48 Ga0070681_10091070 3300005458 Bacteria 3000
49 Ga0068867_100006130 3300005459 Bacteria 8513
50 Ga0068867_100053167 3300005459 Bacteria 2991
51 Ga0070706_100019070 3300005467 Bacteria 6328
52 Ga0070706_100210470 3300005467 Bacteria 1816
53 Ga0070706_100211962 3300005467 Bacteria 1809
54 Ga0070706_100263742 3300005467 Bacteria 1608
55 Ga0070706_100299887 3300005467 Unclassified 1499
56 Ga0070706_100527273 3300005467 Bacteria 1099
57 Ga0070707_100010295 3300005468 Bacteria 8705
58 Ga0070707_100014099 3300005468 Bacteria 7489
59 Ga0070707_100014511 3300005468 Bacteria 7384
60 Ga0070707_100045690 3300005468 Bacteria 4191
61 Ga0070707_100249720 3300005468 Bacteria 1726
62 Ga0070707_100296322 3300005468 Bacteria 1572
63 Ga0070698_100004982 3300005471 Bacteria 14550
64 Ga0070698_100012986 3300005471 Bacteria 8816
65 Ga0070698_100024328 3300005471 Bacteria 6319
66 Ga0070698_100155188 3300005471 Bacteria 2235
67 Ga0070698_100343214 3300005471 Unclassified 1425
68 Ga0070698_100494652 3300005471 Unclassified 1161
69 Ga0070699_100000839 3300005518 Bacteria 28508
70 Ga0070699_100004885 3300005518 Bacteria 11825
71 Ga0070699_100017315 3300005518 Bacteria 6189
72 Ga0070699_100077723 3300005518 Unclassified 2889
73 Ga0070699_100170093 3300005518 Unclassified 1931
74 Ga0070699_100308803 3300005518 Unclassified 1420
75 Ga0070699_100630721 3300005518 Unclassified 978
76 Ga0070679_100005008 3300005530 Bacteria 12225
77 Ga0070684_100230965 3300005535 Bacteria 1689
78 Ga0070697_100000775 3300005536 Bacteria 23943
79 Ga0070697_100062418 3300005536 Bacteria 3041
80 Ga0070697_100140799 3300005536 Unclassified 2029
81 Ga0070697_100229080 3300005536 Bacteria 1585
82 Ga0070697_100261161 3300005536 Bacteria 1483
83 Ga0068853_100000111 3300005539 Bacteria 55607
84 Ga0070672_100032643 3300005543 Bacteria 3932
85 Ga0070686_100073578 3300005544 Bacteria 2244
86 Ga0070695_100002386 3300005545 Bacteria 10791
87 Ga0070695_100003048 3300005545 Bacteria 9749
88 Ga0070695_100006201 3300005545 Bacteria 7061
89 Ga0070695_100006878 3300005545 Bacteria 6736
90 Ga0070695_100054611 3300005545 Bacteria 2572
91 Ga0070695_100106111 3300005545 Unclassified 1899
92 Ga0070695_100183636 3300005545 Bacteria 1484
93 Ga0070696_100000218 3300005546 Bacteria 34544
94 Ga0070696_100016744 3300005546 Bacteria 4944
95 Ga0070696_100040370 3300005546 Bacteria 3222
96 Ga0070696_100047398 3300005546 Bacteria 2982
97 Ga0070696_100147022 3300005546 Bacteria 1727
98 Ga0070696_100358820 3300005546 Unclassified 1130
99 Ga0070693_100003071 3300005547 Bacteria 7748
100 Ga0070704_100001454 3300005549 Bacteria 12701
101 Ga0070704_100019155 3300005549 Bacteria 4393
102 Ga0070704_100062208 3300005549 Bacteria 2674
103 Ga0070704_100228557 3300005549 Bacteria 1516
104 Ga0070704_100574394 3300005549 Unclassified 988
105 Ga0068855_100000219 3300005563 Bacteria 72993
106 Ga0070664_100004538 3300005564 Bacteria 11141
107 Ga0068857_100009753 3300005577 Bacteria 8339
108 Ga0068857_100039223 3300005577 Bacteria 4195
109 Ga0068857_100065527 3300005577 Bacteria 3231
110 Ga0068857_100143126 3300005577 Unclassified 2162
111 Ga0068856_100013237 3300005614 Bacteria 7989
112 Ga0070702_100002994 3300005615 Bacteria 7467
113 Ga0068852_100074561 3300005616 Bacteria 2989
114 Ga0068859_100024393 3300005617 Bacteria 6067
115 Ga0068859_100093863 3300005617 Bacteria 3052
116 Ga0068859_100226705 3300005617 Unclassified 1957
117 Ga0068864_100006889 3300005618 Bacteria 9315
118 Ga0068864_100234578 3300005618 Bacteria 1698
119 Ga0068861_100046293 3300005719 Bacteria 3279
120 Ga0068861_100293103 3300005719 Unclassified 1406
121 Ga0068870_10001517 3300005840 Bacteria 9423
122 Ga0068863_100017502 3300005841 Bacteria 6870
123 Ga0068863_100662496 3300005841 Unclassified 1036
124 Ga0068858_100009138 3300005842 Bacteria 9477
125 Ga0068860_100005840 3300005843 Bacteria 12388
126 Ga0068860_100067011 3300005843 Bacteria 3411
127 Ga0068860_100097865 3300005843 Bacteria 2798
128 Ga0068862_100001733 3300005844 Bacteria 19717
129 Ga0068862_100086443 3300005844 Bacteria 2726
130 Ga0068862_100299460 3300005844 Bacteria 1479
131 Ga0068862_100387043 3300005844 Bacteria 1305
132 Ga0081455_10000135 3300005937 Bacteria 87177
133 Ga0081455_10002839 3300005937 Bacteria 20393
134 Ga0081538_10015472 3300005981 Bacteria 5900
135 Ga0081538_10052752 3300005981 Bacteria 2426
136 Ga0081540_1017263 3300005983 Bacteria 4475
137 Ga0081540_1025218 3300005983 Bacteria 3428
138 Ga0081539_10000009 3300005985 Bacteria 509286
139 Ga0075432_10031285 3300006058 Bacteria 1842
140 Ga0075432_10039878 3300006058 Bacteria 1638
141 Ga0070716_100273114 3300006173 Bacteria 1163
142 Ga0075427_10007499 3300006194 Bacteria 1604
143 Ga0075428_100000622 3300006844 Bacteria 36242
144 Ga0075428_100008622 3300006844 Bacteria 11312
145 Ga0075428_100010752 3300006844 Bacteria 10172
146 Ga0075428_100019591 3300006844 Bacteria 7487
147 Ga0075428_100032165 3300006844 Bacteria 5795
148 Ga0075428_100052879 3300006844 Bacteria 4450
149 Ga0075428_100124425 3300006844 Bacteria 2806
150 Ga0075428_100170226 3300006844 Bacteria 2361
151 Ga0075430_100000084 3300006846 Bacteria 53212
152 Ga0075430_100000413 3300006846 Bacteria 31753
153 Ga0075430_100023643 3300006846 Bacteria 5232
154 Ga0075430_100185911 3300006846 Unclassified 1728
155 Ga0075430_100514569 3300006846 Unclassified 988
156 Ga0075431_100000186 3300006847 Bacteria 45028
157 Ga0075431_100001279 3300006847 Bacteria 22945
158 Ga0075431_100003814 3300006847 Bacteria 14657
159 Ga0075431_100004150 3300006847 Bacteria 14149
160 Ga0075431_100022898 3300006847 Bacteria 6386
161 Ga0075431_100119363 3300006847 Bacteria 2721
162 Ga0075431_100209782 3300006847 Bacteria 1990
163 Ga0075431_100579467 3300006847 Unclassified 1107
164 Ga0075431_100643973 3300006847 Bacteria 1041
165 Ga0075433_10000798 3300006852 Bacteria 21838
166 Ga0075433_10003625 3300006852 Bacteria 11929
167 Ga0075433_10007973 3300006852 Bacteria 8432
168 Ga0075433_10022248 3300006852 Bacteria 5320
169 Ga0075433_10092238 3300006852 Bacteria 2679
170 Ga0075433_10116927 3300006852 Bacteria 2366
171 Ga0075433_10400686 3300006852 Unclassified 1211
172 Ga0075433_10457400 3300006852 Bacteria 1125
173 Ga0075434_100038742 3300006871 Bacteria 4722
174 Ga0075434_100068184 3300006871 Bacteria 3543
175 Ga0075434_100079248 3300006871 Unclassified 3281
176 Ga0075434_100081663 3300006871 Bacteria 3230
177 Ga0075434_100094006 3300006871 Bacteria 3002
178 Ga0075434_100104411 3300006871 Bacteria 2843
179 Ga0075434_100109398 3300006871 Unclassified 2774
180 Ga0075434_100201599 3300006871 Bacteria 2010
181 Ga0075434_100364165 3300006871 Unclassified 1467
182 Ga0075434_100720127 3300006871 Unclassified 1015
183 Ga0075434_100786849 3300006871 Bacteria 968
184 Ga0075429_100000177 3300006880 Bacteria 41340
185 Ga0075429_100002426 3300006880 Bacteria 15697
186 Ga0075429_100007382 3300006880 Bacteria 9542
187 Ga0075429_100011909 3300006880 Bacteria 7541
188 Ga0075429_100038316 3300006880 Bacteria 4173
189 Ga0075429_100081015 3300006880 Bacteria 2830
190 Ga0075429_100087742 3300006880 Bacteria 2711
191 Ga0075429_100335838 3300006880 Unclassified 1322
192 Ga0075436_100004858 3300006914 Bacteria 9234
193 Ga0075436_100083119 3300006914 Bacteria 2222
194 Ga0097620_100024393 3300006931 Bacteria 6067
195 Ga0097620_100093860 3300006931 Bacteria 3052
196 Ga0097620_100226707 3300006931 Unclassified 1957
197 Ga0075435_100032631 3300007076 Bacteria 4114
198 Ga0075435_100060885 3300007076 Unclassified 3061
199 Ga0075435_100108409 3300007076 Unclassified 2307
200 Ga0075435_100364191 3300007076 Unclassified 1240
201 Ga0099794_10026488 3300007265 Bacteria 2681
202 Ga0105240_10342221 3300009093 Bacteria 1699
203 Ga0111539_10006868 3300009094 Bacteria 14621
204 Ga0111539_10032553 3300009094 Bacteria 6330
205 Ga0111539_10065254 3300009094 Bacteria 4303
206 Ga0105245_10343620 3300009098 Unclassified 1476
207 Ga0105247_10423834 3300009101 Unclassified 953
208 Ga0114129_10001251 3300009147 Bacteria 33869
209 Ga0114129_10001591 3300009147 Bacteria 30832
210 Ga0114129_10002356 3300009147 Bacteria 26214
211 Ga0114129_10004666 3300009147 Bacteria 19349
212 Ga0114129_10008480 3300009147 Bacteria 14644
213 Ga0114129_10011734 3300009147 Bacteria 12468
214 Ga0114129_10027822 3300009147 Bacteria 8007
215 Ga0114129_10051151 3300009147 Bacteria 5802
216 Ga0114129_10053512 3300009147 Bacteria 5661
217 Ga0114129_10073705 3300009147 Bacteria 4756
218 Ga0114129_10087073 3300009147 Bacteria 4332
219 Ga0114129_10098999 3300009147 Unclassified 4036
220 Ga0114129_10127803 3300009147 Bacteria 3493
221 Ga0114129_10146544 3300009147 Bacteria 3234
222 Ga0114129_10210627 3300009147 Bacteria 2628
223 Ga0114129_10339557 3300009147 Bacteria 1992
224 Ga0114129_10367601 3300009147 Bacteria 1902
225 Ga0114129_10413606 3300009147 Bacteria 1775
226 Ga0114129_10429290 3300009147 Bacteria 1736
227 Ga0114129_10495692 3300009147 Bacteria 1596
228 Ga0114129_10781564 3300009147 Bacteria 1220
229 Ga0105243_10066059 3300009148 Bacteria 2908
230 Ga0105243_10164784 3300009148 Bacteria 1914
231 Ga0105243_10215301 3300009148 Bacteria 1694
232 Ga0105241_10000389 3300009174 Bacteria 33246
233 Ga0105241_10110350 3300009174 Bacteria 2201
234 Ga0105242_10054429 3300009176 Bacteria 3270
235 Ga0105242_10099335 3300009176 Bacteria 2464
236 Ga0105242_10330497 3300009176 Unclassified 1401
237 Ga0105248_10384784 3300009177 Bacteria 1580
238 Ga0105249_10010302 3300009553 Bacteria 8212
239 Ga0105249_10072424 3300009553 Bacteria 3185
240 Ga0105249_10097311 3300009553 Bacteria 2762
241 Ga0105249_10208998 3300009553 Bacteria 1914
242 Ga0099796_10159475 3300010159 Bacteria 893
243 Ga0105239_10141195 3300010375 Unclassified 2684
244 Ga0157373_10002416 3300013100 Bacteria 14205
245 Ga0157371_10296128 3300013102 Bacteria 1171
246 Ga0157369_10007011 3300013105 Bacteria 13005
247 Ga0157378_10613481 3300013297 Bacteria 1100
248 Ga0157372_10001597 3300013307 Bacteria 24655
249 Ga0157372_10410316 3300013307 Unclassified 1578
250 Ga0157372_10462824 3300013307 Bacteria 1478
251 Ga0157375_10127156 3300013308 Bacteria 2665
252 Ga0157375_10153294 3300013308 Bacteria 2441
253 Ga0157380_10221167 3300014326 Bacteria 1694
254 Ga0182008_10048443 3300014497 Bacteria 2110
255 Ga0157379_10107006 3300014968 Unclassified 2510
256 Ga0182007_10033746 3300015262 Bacteria 1733
257 Ga0207653_10041079 3300025885 Bacteria 1518
258 Ga0207653_10054887 3300025885 Bacteria 1333
259 Ga0207653_10090966 3300025885 Unclassified 1069
260 Ga0207645_10004040 3300025907 Bacteria 10933
261 Ga0207643_10001853 3300025908 Bacteria 11690
262 Ga0207684_10000142 3300025910 Bacteria 127367
263 Ga0207684_10008680 3300025910 Bacteria 9020
264 Ga0207684_10029623 3300025910 Bacteria 4659
265 Ga0207684_10044882 3300025910 Bacteria 3748
266 Ga0207684_10060379 3300025910 Bacteria 3220
267 Ga0207684_10249490 3300025910 Unclassified 1531
268 Ga0207684_10253809 3300025910 Bacteria 1517
269 Ga0207684_10510742 3300025910 Bacteria 1030
270 Ga0207654_10001908 3300025911 Bacteria 10823
271 Ga0207707_10000047 3300025912 Bacteria 118016
272 Ga0207707_10080180 3300025912 Bacteria 2850
273 Ga0207671_10325265 3300025914 Bacteria 1217
274 Ga0207660_10002017 3300025917 Bacteria 13506
275 Ga0207657_10000021 3300025919 Bacteria 155900
276 Ga0207649_10001184 3300025920 Bacteria 15709
277 Ga0207652_10000582 3300025921 Bacteria 36770
278 Ga0207646_10000707 3300025922 Bacteria 43305
279 Ga0207646_10005687 3300025922 Bacteria 13076
280 Ga0207646_10012582 3300025922 Bacteria 8123
281 Ga0207646_10013130 3300025922 Bacteria 7928
282 Ga0207646_10087156 3300025922 Bacteria 2794
283 Ga0207646_10169430 3300025922 Unclassified 1972
284 Ga0207681_10033443 3300025923 Bacteria 3371
285 Ga0207681_10037895 3300025923 Bacteria 3190
286 Ga0207650_10066223 3300025925 Bacteria 2708
287 Ga0207690_10002230 3300025932 Bacteria 11821
288 Ga0207706_10001025 3300025933 Bacteria 28421
289 Ga0207706_10066645 3300025933 Bacteria 3169
290 Ga0207709_10058997 3300025935 Bacteria 2387
291 Ga0207709_10172530 3300025935 Unclassified 1519
292 Ga0207709_10181160 3300025935 Bacteria 1488
293 Ga0207709_10447294 3300025935 Bacteria 998
294 Ga0207670_10014933 3300025936 Bacteria 4625
295 Ga0207704_10355646 3300025938 Unclassified 1142
296 Ga0207665_10000411 3300025939 Bacteria 29470
297 Ga0207691_10036803 3300025940 Bacteria 4534
298 Ga0207691_10091900 3300025940 Bacteria 2718
299 Ga0207711_10252582 3300025941 Bacteria 1619
300 Ga0207711_10397573 3300025941 Bacteria 1280
301 Ga0207711_10462085 3300025941 Bacteria 1182
302 Ga0207689_10000616 3300025942 Bacteria 34010
303 Ga0207689_10002819 3300025942 Bacteria 16059
304 Ga0207689_10112492 3300025942 Bacteria 2238
305 Ga0207661_10023923 3300025944 Bacteria 4622
306 Ga0207679_10000824 3300025945 Bacteria 19931
307 Ga0207667_10016902 3300025949 Bacteria 8231
308 Ga0207651_10007271 3300025960 Bacteria 5887
309 Ga0207712_10021224 3300025961 Bacteria 4262
310 Ga0207668_10189932 3300025972 Bacteria 1627
311 Ga0207658_10054437 3300025986 Bacteria 2961
312 Ga0207677_10080291 3300026023 Bacteria 2336
313 Ga0207703_10013453 3300026035 Bacteria 6374
314 Ga0207678_10001854 3300026067 Bacteria 19324
315 Ga0207708_10021974 3300026075 Bacteria 4816
316 Ga0207708_10059379 3300026075 Bacteria 2919
317 Ga0207702_10001000 3300026078 Bacteria 28999
318 Ga0207641_10076652 3300026088 Bacteria 2891
319 Ga0207641_10141481 3300026088 Bacteria 2171
320 Ga0207641_10486144 3300026088 Unclassified 1197
321 Ga0207641_10641025 3300026088 Bacteria 1043
322 Ga0207648_10000527 3300026089 Bacteria 42832
323 Ga0207648_10055585 3300026089 Bacteria 3455
324 Ga0207648_10056805 3300026089 Bacteria 3415
325 Ga0207674_10000137 3300026116 Bacteria 84955
326 Ga0207674_10031104 3300026116 Bacteria 5608
327 Ga0207674_10228024 3300026116 Bacteria 1811
328 Ga0207675_100011157 3300026118 Bacteria 8416
329 Ga0207675_100061062 3300026118 Bacteria 3519
330 Ga0207675_100336727 3300026118 Unclassified 1476
331 Ga0209967_1001962 3300027364 Bacteria 2651
332 Ga0209995_1004026 3300027471 Bacteria 2347
333 Ga0209968_1000700 3300027526 Bacteria 5164
334 Ga0209999_1001286 3300027543 Bacteria 4302
335 Ga0209983_1000027 3300027665 Bacteria 19821
336 Ga0209983_1023019 3300027665 Bacteria 1308
337 Ga0209588_1032028 3300027671 Bacteria 1683
338 Ga0209971_1000018 3300027682 Bacteria 65254
339 Ga0209966_1000065 3300027695 Bacteria 47123
340 Ga0209998_10000062 3300027717 Bacteria 43841
341 Ga0209974_10001726 3300027876 Bacteria 7930
342 Ga0207428_10000063 3300027907 Bacteria 151868
343 Ga0207428_10000091 3300027907 Bacteria 125388
344 Ga0207428_10003665 3300027907 Bacteria 14806
345 Ga0207428_10045574 3300027907 Bacteria 3531
346 Ga0268265_10002646 3300028380 Bacteria 13295
347 Ga0268265_10016987 3300028380 Bacteria 5011
348 Ga0268265_10205035 3300028380 Bacteria 1713
349 Ga0268264_10026943 3300028381 Bacteria 4695
350 Ga0268264_10221724 3300028381 Unclassified 1741
351 Ga0268264_10315107 3300028381 Bacteria 1477
352 Ga0268264_10324915 3300028381 Bacteria 1456
353 Ga0307408_100013810 3300031548 Bacteria 5362
354 Ga0307408_100036511 3300031548 Bacteria 3455
355 Ga0307408_100101178 3300031548 Bacteria 2196
356 Ga0307408_100219922 3300031548 Bacteria 1549
357 Ga0307410_10322965 3300031852 Bacteria 1225
358 Ga0307412_10241231 3300031911 Bacteria 1398
359 Ga0307412_10494883 3300031911 Bacteria 1017
360 Ga0307409_100011687 3300031995 Bacteria 5551
361 Ga0307416_100081288 3300032002 Bacteria 2739
362 Ga0307416_100118413 3300032002 Bacteria 2353
363 Ga0307416_100255626 3300032002 Bacteria 1708
364 Ga0307411_10072930 3300032005 Unclassified 2333
365 Ga0307415_100102638 3300032126 Bacteria 2102
366 Ga0373948_0028014 3300034817 Bacteria 1119
367 Ga0373928_0026731 3300035084 Bacteria 1252
368 Ga0373940_0005357 3300035088 Bacteria 2773
369 Ga0373940_0015849 3300035088 Bacteria 1859
370 Ga0373949_0012267 3300035090 Bacteria 1894
371 Ga0373951_0003891 3300035091 Unclassified 3591
372 Ga0373941_0086623 3300035115 Bacteria 1067
373 Ga0373960_0005528 3300035121 Bacteria 2933
374 Ga0373961_0029397 3300035241 Bacteria 1522
375 Ga0373931_0010670 3300035691 Bacteria 4420
376 Ga0373931_0022659 3300035691 Bacteria 3163
377 Ga0395899_0012934 3300037312 Bacteria 6388
378 Ga0395900_0578402 3300037418 Bacteria 1065
379 Ga0395900_0937371 3300037418 Unclassified 788
380 Ga0395901_0004330 3300038443 Bacteria 14322
381 Ga0439448_0000780 3300042005 Bacteria 7719
382 Ga0439450_009005 3300042008 Bacteria 1881
383 Ga0439458_0006551 3300042157 Bacteria 2596
384 Ga0439435_0041144 3300042436 Unclassified 1294
385 Ga0439459_0002895 3300042438 Unclassified 2684
386 Ga0439464_0002668 3300042439 Bacteria 4419
387 Ga0439460_0001847 3300042461 Bacteria 5050
388 Ga0451577_0003104 3300042876 Bacteria 18729
389 Ga0451577_0007817 3300042876 Bacteria 10462
390 Ga0451577_0058541 3300042876 Bacteria 3435
391 Ga0453683_0043823 3300044673 Bacteria 2808
392 Ga0453683_0049017 3300044673 Unclassified 2648
393 Ga0466963_0329001 3300044694 Bacteria 1076
394 Ga0453684_0008557 3300044712 Bacteria 18260
395 Ga0453684_0608707 3300044712 Bacteria 1196
396 Ga0451576_0002399 3300045051 Bacteria 28145
397 Ga0451576_0021495 3300045051 Bacteria 7013
398 Ga0451576_0339585 3300045051 Bacteria 1572
399 Ga0495580_0001249 3300046472 Bacteria 22435
400 Ga0495580_0105796 3300046472 Bacteria 1955
401 Ga0495621_0106510 3300046539 Unclassified 1072
402 Ga0496102_0022019 3300048905 Bacteria 5645
403 Ga0496102_0060756 3300048905 Bacteria 3457
404 Ga0496102_0344222 3300048905 Unclassified 1404
405 Ga0496106_0295288 3300048909 Bacteria 1299
406 Ga0496109_0535772 3300048912 Archaea 1105
407 Ga0496112_0459056 3300048915 Bacteria 1211
408 Ga0501033_0135872 3300049570 Bacteria 1779
409 Ga0501033_0203817 3300049570 Bacteria 1412
410 Ga0501034_0416699 3300049571 Bacteria 1265
411 Ga0501036_0021990 3300049572 Bacteria 5363
412 Ga0501037_0016149 3300049573 Bacteria 5495
413 Ga0501038_0009653 3300049574 Bacteria 8852
414 Ga0501038_0192388 3300049574 Bacteria 1641
415 Ga0501038_0209605 3300049574 Unclassified 1560
416 Ga0501038_0340697 3300049574 Bacteria 1169
417 Ga0501039_0034041 3300049575 Bacteria 3931
418 Ga0501039_0036902 3300049575 Bacteria 3771
419 Ga0501039_0477218 3300049575 Unclassified 979
420 Ga0501040_0003584 3300049576 Bacteria 10044
421 Ga0501040_0012409 3300049576 Bacteria 5582
422 Ga0501040_0032102 3300049576 Bacteria 3552
423 Ga0501040_0032963 3300049576 Bacteria 3507
424 Ga0501040_0082439 3300049576 Bacteria 2230
425 Ga0501040_0276422 3300049576 Unclassified 1199
426 Ga0501041_0085073 3300049577 Bacteria 1949
427 Ga0501041_0095569 3300049577 Unclassified 1837
428 Ga0501041_0199745 3300049577 Bacteria 1253
429 Ga0501042_0010230 3300049578 Bacteria 6279
430 Ga0501046_0000473 3300049580 Bacteria 40255
431 Ga0501047_0072889 3300049581 Bacteria 3306
432 Ga0501048_0006631 3300049582 Bacteria 8798
433 Ga0501048_0031393 3300049582 Bacteria 3842
434 Ga0501048_0087546 3300049582 Bacteria 2197
435 Ga0501048_0181442 3300049582 Bacteria 1492
436 Ga0501068_0168278 3300049584 Bacteria 1382
437 Ga0501068_0299872 3300049584 Bacteria 1029
438 Ga0501069_0007526 3300049585 Bacteria 5718
439 Ga0501071_0038579 3300049587 Bacteria 3414
440 Ga0501071_0062831 3300049587 Bacteria 2691
441 Ga0501071_0101948 3300049587 Bacteria 2116
442 Ga0501072_0003706 3300049588 Bacteria 11527
443 Ga0501072_0003793 3300049588 Bacteria 11409
444 Ga0501072_0012712 3300049588 Bacteria 6437
445 Ga0501072_0062699 3300049588 Bacteria 2932
446 Ga0501072_0128431 3300049588 Bacteria 2020
447 Ga0501072_0156886 3300049588 Bacteria 1815
448 Ga0501072_0228955 3300049588 Unclassified 1481
449 Ga0501072_0232956 3300049588 Bacteria 1467
450 Ga0501073_0091786 3300049589 Bacteria 2111
451 Ga0501074_0012067 3300049590 Bacteria 6278
452 Ga0501074_0113450 3300049590 Bacteria 1939
453 Ga0501074_0116245 3300049590 Bacteria 1914
454 Ga0501075_0000078 3300049591 Bacteria 43796
455 Ga0501075_0020298 3300049591 Bacteria 4831
456 Ga0501075_0036012 3300049591 Bacteria 3692
457 Ga0501075_0067008 3300049591 Bacteria 2710
458 Ga0501075_0082426 3300049591 Bacteria 2436
459 Ga0501075_0131730 3300049591 Unclassified 1905
460 Ga0501075_0181966 3300049591 Unclassified 1603
461 Ga0501076_0000002 3300049592 Bacteria 165396
462 Ga0501076_0033398 3300049592 Bacteria 4017
463 Ga0501076_0043538 3300049592 Bacteria 3538
464 Ga0501076_0191628 3300049592 Bacteria 1668
465 Ga0501076_0206903 3300049592 Bacteria 1603
466 Ga0501077_0003957 3300049593 Bacteria 8933
467 Ga0501077_0004194 3300049593 Bacteria 8711
468 Ga0501077_0084628 3300049593 Bacteria 2010
469 Ga0501077_0139250 3300049593 Bacteria 1539
470 Ga0501079_0001001 3300049741 Bacteria 19537
471 Ga0501079_0009405 3300049741 Bacteria 7408
472 Ga0501079_0009589 3300049741 Bacteria 7342
473 Ga0501079_0011736 3300049741 Bacteria 6692
474 Ga0501079_0065232 3300049741 Bacteria 2809
475 Ga0501079_0076743 3300049741 Bacteria 2584
476 Ga0501079_0120103 3300049741 Bacteria 2044
477 Ga0501080_0128698 3300049742 Bacteria 2344
478 Ga0501080_0174192 3300049742 Bacteria 1983
479 Ga0501080_0211510 3300049742 Unclassified 1777
480 Ga0501081_0002207 3300049743 Bacteria 12249
481 Ga0501081_0002835 3300049743 Bacteria 11003
482 Ga0501081_0010886 3300049743 Bacteria 5945
483 Ga0501081_0019617 3300049743 Bacteria 4504
484 Ga0501081_0094918 3300049743 Unclassified 2102
485 Ga0501081_0133071 3300049743 Bacteria 1778
486 Ga0501081_0135820 3300049743 Bacteria 1760
487 Ga0501083_0355428 3300049744 Bacteria 952
488 Ga0501035_0099556 3300049822 Unclassified 2552
489 Ga0501035_0255056 3300049822 Bacteria 1488
490 Ga0501045_0044535 3300049824 Bacteria 3233
491 Ga0501045_0055251 3300049824 Bacteria 2904
492 Ga0501045_0058952 3300049824 Bacteria 2812
493 Ga0501045_0189016 3300049824 Unclassified 1535
494 nmdc:mga05p37_10791_c1 3300050507 Bacteria 10845
495 nmdc:mga05p37_12334_c1 3300050507 Bacteria 10207
496 nmdc:mga05p37_1316_c1 3300050507 Bacteria 28895
497 nmdc:mga05p37_157286_c1 3300050507 Bacteria 2777
498 nmdc:mga05p37_166852_c1 3300050507 Unclassified 2687
499 nmdc:mga05p37_1819_c1 3300050507 Bacteria 24861
500 nmdc:mga05p37_202854_c1 3300050507 Bacteria 2400
501 nmdc:mga05p37_2113_c1 3300050507 Bacteria 23219
502 nmdc:mga05p37_263652_c1 3300050507 Bacteria 2061
503 nmdc:mga05p37_2942_c1 3300050507 Bacteria 19772
504 nmdc:mga05p37_323810_c1 3300050507 Bacteria 1823
505 nmdc:mga05p37_326212_c1 3300050507 Bacteria 1815
506 nmdc:mga05p37_359102_c1 3300050507 Unclassified 1713
507 nmdc:mga05p37_39095_c1 3300050507 Bacteria 5821
508 nmdc:mga05p37_466472_c1 3300050507 Bacteria 1458
509 nmdc:mga05p37_57800_c1 3300050507 Bacteria 4777
510 nmdc:mga05p37_65063_c1 3300050507 Bacteria 4487
511 nmdc:mga05p37_732208_c1 3300050507 Bacteria 1093
512 nmdc:mga09592_26622_c1 3300050508 Bacteria 4793
513 nmdc:mga09592_321770_c1 3300050508 Unclassified 1340
514 nmdc:mga09592_445_c1 3300050508 Bacteria 30603
515 nmdc:mga09592_47270_c1 3300050508 Bacteria 3627
516 nmdc:mga09592_57122_c1 3300050508 Bacteria 3298
517 nmdc:mga09592_68296_c1 3300050508 Bacteria 3015
518 nmdc:mga0qj67_226562_c1 3300050509 Bacteria 1517
519 nmdc:mga0qj67_2851_c1 3300050509 Bacteria 12395
520 nmdc:mga0qj67_421_c1 3300050509 Bacteria 28998
521 nmdc:mga06r32_1003_c1 3300050510 Bacteria 25310
522 nmdc:mga06r32_114585_c1 3300050510 Bacteria 2654
523 nmdc:mga06r32_12854_c1 3300050510 Bacteria 7568
524 nmdc:mga06r32_1509_c1 3300050510 Bacteria 20920
525 nmdc:mga06r32_15708_c1 3300050510 Bacteria 6880
526 nmdc:mga06r32_19194_c1 3300050510 Bacteria 6274
527 nmdc:mga06r32_26091_c1 3300050510 Bacteria 5444
528 nmdc:mga06r32_288307_c1 3300050510 Bacteria 1628
529 nmdc:mga06r32_3250_c1 3300050510 Bacteria 14539
530 nmdc:mga06r32_541946_c1 3300050510 Unclassified 1138
531 nmdc:mga06r32_5805_c1 3300050510 Bacteria 11124
532 nmdc:mga08y16_121152_c1 3300050511 Bacteria 2722
533 nmdc:mga08y16_24788_c1 3300050511 Bacteria 6330
534 nmdc:mga08y16_4347_c1 3300050511 Bacteria 14805
535 nmdc:mga08y16_54210_c1 3300050511 Bacteria 4190
536 nmdc:mga08y16_60331_c1 3300050511 Bacteria 3962
537 nmdc:mga08y16_63096_c1 3300050511 Bacteria 3869
538 nmdc:mga08y16_7638_c1 3300050511 Bacteria 11316
539 nmdc:mga0n895_1185_c1 3300050512 Bacteria 19167
540 nmdc:mga0n895_134553_c1 3300050512 Bacteria 2498
541 nmdc:mga0n895_21841_c1 3300050512 Bacteria 5992
542 nmdc:mga0n895_222693_c1 3300050512 Bacteria 1915
543 nmdc:mga0n895_286269_c1 3300050512 Bacteria 1671
544 nmdc:mga0n895_30687_c1 3300050512 Bacteria 5140
545 nmdc:mga0n895_33153_c1 3300050512 Bacteria 4962
546 nmdc:mga0n895_43046_c1 3300050512 Bacteria 4398
547 nmdc:mga0n895_44545_c1 3300050512 Bacteria 4327
548 nmdc:mga0n895_55177_c1 3300050512 Bacteria 3910
549 nmdc:mga0n895_66999_c1 3300050512 Bacteria 3555
550 nmdc:mga0n895_736561_c1 3300050512 Unclassified 980
551 nmdc:mga0rr50_102393_c1 3300050513 Unclassified 2253
552 nmdc:mga0rr50_221737_c1 3300050513 Bacteria 1562
553 nmdc:mga0rr50_4128_c1 3300050513 Bacteria 8491
554 nmdc:mga0rr50_48289_c1 3300050513 Bacteria 3146
555 nmdc:mga0a205_110300_c1 3300050515 Bacteria 2650
556 nmdc:mga0a205_137776_c1 3300050515 Unclassified 2341
557 nmdc:mga0a205_15565_c1 3300050515 Bacteria 7108
558 nmdc:mga0a205_176647_c1 3300050515 Bacteria 2031
559 nmdc:mga0a205_184531_c1 3300050515 Unclassified 1980
560 nmdc:mga0a205_24902_c1 3300050515 Bacteria 5696
561 nmdc:mga0a205_33930_c1 3300050515 Bacteria 4895
562 nmdc:mga0a205_4127_c1 3300050515 Bacteria 12999
563 nmdc:mga0a205_71069_c1 3300050515 Bacteria 3361
564 nmdc:mga0a205_82419_c1 3300050515 Bacteria 3107
565 nmdc:mga0a205_8887_c1 3300050515 Bacteria 9155
566 Ga0501084_0003242 3300054114 Bacteria 13175
567 Ga0501084_0004703 3300054114 Bacteria 11151
568 Ga0501084_0038164 3300054114 Bacteria 4015
569 Ga0501084_0046600 3300054114 Bacteria 3632
570 Ga0501084_0055603 3300054114 Bacteria 3311
571 Ga0501084_0080133 3300054114 Unclassified 2738
572 Ga0501084_0398482 3300054114 Bacteria 1163
573 Ga0501084_0590734 3300054114 Bacteria 938
574 Ga0501082_0000407 3300060353 Bacteria 38099
575 Ga0501082_0022243 3300060353 Bacteria 5464
576 Ga0501082_0026311 3300060353 Bacteria 5013
577 Ga0501082_0063909 3300060353 Bacteria 3169
578 Ga0501082_0214454 3300060353 Bacteria 1675
579 Ga0530510_0000024 3300061734 Bacteria 68684
580 Ga0530510_0000913 3300061734 Bacteria 19483
581 Ga0530510_0019693 3300061734 Bacteria 4792
582 Ga0530510_0055748 3300061734 Bacteria 2855
583 Ga0530510_0081553 3300061734 Bacteria 2355
584 Ga0530510_0197904 3300061734 Bacteria 1492
585 Ga0530510_0510891 3300061734 Bacteria 911

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0937371 Ga0395900_0937371_88_777 228
2 3300006871 Ga0075434_100786849 Ga0075434_1007868492 254
3 3300026088 Ga0207641_10641025 Ga0207641_106410251 263
4 3300005577 Ga0068857_100143126 Ga0068857_1001431262 265
5 3300026116 Ga0207674_10228024 Ga0207674_102280241 265
6 3300031548 Ga0307408_100036511 Ga0307408_1000365113 268
7 3300032002 Ga0307416_100081288 Ga0307416_1000812883 268
8 3300032005 Ga0307411_10072930 Ga0307411_100729302 268
9 3300006871 Ga0075434_100720127 Ga0075434_1007201271 269
10 3300049585 Ga0501069_0007526 Ga0501069_0007526_975_1790 269
11 3300006871 Ga0075434_100079248 Ga0075434_1000792482 275
12 3300005445 Ga0070708_100088101 Ga0070708_1000881011 278
13 3300005467 Ga0070706_100299887 Ga0070706_1002998872 278
14 3300005468 Ga0070707_100045690 Ga0070707_1000456904 278
15 3300005518 Ga0070699_100077723 Ga0070699_1000777233 278
16 3300005518 Ga0070699_100630721 Ga0070699_1006307211 278
17 3300005543 Ga0070672_100032643 Ga0070672_1000326432 278
18 3300005546 Ga0070696_100016744 Ga0070696_1000167445 278
19 3300005546 Ga0070696_100047398 Ga0070696_1000473983 278
20 3300005546 Ga0070696_100147022 Ga0070696_1001470222 278
21 3300005549 Ga0070704_100019155 Ga0070704_1000191554 278
22 3300005549 Ga0070704_100574394 Ga0070704_1005743941 278
23 3300005719 Ga0068861_100046293 Ga0068861_1000462932 278
24 3300005719 Ga0068861_100293103 Ga0068861_1002931031 278
25 3300005843 Ga0068860_100097865 Ga0068860_1000978654 278
26 3300006844 Ga0075428_100008622 Ga0075428_1000086228 278
27 3300006846 Ga0075430_100023643 Ga0075430_1000236431 278
28 3300006847 Ga0075431_100209782 Ga0075431_1002097823 278
29 3300006847 Ga0075431_100643973 Ga0075431_1006439732 278
30 3300006880 Ga0075429_100081015 Ga0075429_1000810154 278
31 3300009094 Ga0111539_10032553 Ga0111539_100325534 278
32 3300009147 Ga0114129_10781564 Ga0114129_107815641 278
33 3300009177 Ga0105248_10384784 Ga0105248_103847842 278
34 3300013308 Ga0157375_10153294 Ga0157375_101532943 278
35 3300025923 Ga0207681_10033443 Ga0207681_100334432 278
36 3300025935 Ga0207709_10172530 Ga0207709_101725302 278
37 3300025940 Ga0207691_10091900 Ga0207691_100919002 278
38 3300025941 Ga0207711_10462085 Ga0207711_104620851 278
39 3300025972 Ga0207668_10189932 Ga0207668_101899322 278
40 3300026118 Ga0207675_100061062 Ga0207675_1000610622 278
41 3300026118 Ga0207675_100336727 Ga0207675_1003367272 278
42 3300027907 Ga0207428_10045574 Ga0207428_100455743 278
43 3300028381 Ga0268264_10324915 Ga0268264_103249152 278
44 3300031548 Ga0307408_100101178 Ga0307408_1001011784 278
45 3300031548 Ga0307408_100219922 Ga0307408_1002199221 278
46 3300031995 Ga0307409_100011687 Ga0307409_1000116873 278
47 3300032002 Ga0307416_100255626 Ga0307416_1002556261 278
48 3300046472 Ga0495580_0105796 Ga0495580_0105796_1042_1878 278
49 3300046539 Ga0495621_0106510 Ga0495621_0106510_12_848 278
50 3300049571 Ga0501034_0416699 Ga0501034_0416699_83_937 278
51 3300049576 Ga0501040_0012409 Ga0501040_0012409_4075_4911 278
52 3300049576 Ga0501040_0032963 Ga0501040_0032963_2032_2868 278
53 3300049577 Ga0501041_0199745 Ga0501041_0199745_64_900 278
54 3300049582 Ga0501048_0087546 Ga0501048_0087546_176_1012 278
55 3300049587 Ga0501071_0062831 Ga0501071_0062831_182_1018 278
56 3300049588 Ga0501072_0012712 Ga0501072_0012712_3426_4262 278
57 3300049588 Ga0501072_0156886 Ga0501072_0156886_866_1702 278
58 3300049588 Ga0501072_0232956 Ga0501072_0232956_239_1075 278
59 3300049590 Ga0501074_0116245 Ga0501074_0116245_513_1349 278
60 3300049591 Ga0501075_0020298 Ga0501075_0020298_3665_4501 278
61 3300049591 Ga0501075_0036012 Ga0501075_0036012_1799_2635 278
62 3300049592 Ga0501076_0033398 Ga0501076_0033398_1565_2401 278
63 3300049592 Ga0501076_0206903 Ga0501076_0206903_279_1115 278
64 3300049593 Ga0501077_0003957 Ga0501077_0003957_4169_5005 278
65 3300049593 Ga0501077_0139250 Ga0501077_0139250_399_1235 278
66 3300049741 Ga0501079_0009405 Ga0501079_0009405_4787_5623 278
67 3300049741 Ga0501079_0011736 Ga0501079_0011736_5846_6682 278
68 3300049742 Ga0501080_0174192 Ga0501080_0174192_350_1186 278
69 3300049743 Ga0501081_0010886 Ga0501081_0010886_3362_4198 278
70 3300049743 Ga0501081_0019617 Ga0501081_0019617_100_936 278
71 3300049743 Ga0501081_0133071 Ga0501081_0133071_857_1693 278
72 3300049824 Ga0501045_0189016 Ga0501045_0189016_314_1150 278
73 3300050507 nmdc:mga05p37_466472_c1 nmdc:mga05p37_466472_c1_474_1316 278
74 3300050507 nmdc:mga05p37_732208_c1 nmdc:mga05p37_732208_c1_164_1000 278
75 3300050510 nmdc:mga06r32_12854_c1 nmdc:mga06r32_12854_c1_4828_5664 278
76 3300050510 nmdc:mga06r32_288307_c1 nmdc:mga06r32_288307_c1_615_1451 278
77 3300050511 nmdc:mga08y16_24788_c1 nmdc:mga08y16_24788_c1_3283_4119 278
78 3300054114 Ga0501084_0046600 Ga0501084_0046600_2156_2992 278
79 3300054114 Ga0501084_0055603 Ga0501084_0055603_996_1832 278
80 3300060353 Ga0501082_0026311 Ga0501082_0026311_2448_3284 278
81 3300060353 Ga0501082_0063909 Ga0501082_0063909_1956_2792 278
82 3300060353 Ga0501082_0214454 Ga0501082_0214454_306_1142 278
83 3300061734 Ga0530510_0081553 Ga0530510_0081553_152_988 278
84 3300003503 JGI26141J51220_1000549 JGI26141J51220_10005493 279
85 3300004798 Ga0058859_10715401 Ga0058859_107154011 279
86 3300004801 Ga0058860_11434841 Ga0058860_114348412 279
87 3300005293 Ga0065715_10310122 Ga0065715_103101221 279
88 3300005328 Ga0070676_10004841 Ga0070676_100048415 279
89 3300005329 Ga0070683_100346544 Ga0070683_1003465442 279
90 3300005330 Ga0070690_100012799 Ga0070690_1000127997 279
91 3300005331 Ga0070670_100010918 Ga0070670_1000109187 279
92 3300005333 Ga0070677_10032626 Ga0070677_100326262 279
93 3300005334 Ga0068869_100004848 Ga0068869_1000048488 279
94 3300005334 Ga0068869_100007099 Ga0068869_1000070992 279
95 3300005334 Ga0068869_100109819 Ga0068869_1001098192 279
96 3300005336 Ga0070680_100049024 Ga0070680_1000490244 279
97 3300005337 Ga0070682_100000416 Ga0070682_10000041624 279
98 3300005339 Ga0070660_100000083 Ga0070660_10000008337 279
99 3300005341 Ga0070691_10006575 Ga0070691_100065754 279
100 3300005341 Ga0070691_10012905 Ga0070691_100129052 279
101 3300005341 Ga0070691_10020985 Ga0070691_100209852 279
102 3300005341 Ga0070691_10140875 Ga0070691_101408752 279
103 3300005344 Ga0070661_100000403 Ga0070661_10000040329 279
104 3300005345 Ga0070692_10265290 Ga0070692_102652901 279
105 3300005353 Ga0070669_100062878 Ga0070669_1000628784 279
106 3300005364 Ga0070673_100004405 Ga0070673_1000044053 279
107 3300005365 Ga0070688_100166189 Ga0070688_1001661892 279
108 3300005366 Ga0070659_100005267 Ga0070659_1000052676 279
109 3300005367 Ga0070667_100097355 Ga0070667_1000973553 279
110 3300005406 Ga0070703_10035063 Ga0070703_100350632 279
111 3300005406 Ga0070703_10055642 Ga0070703_100556421 279
112 3300005438 Ga0070701_10062815 Ga0070701_100628152 279
113 3300005440 Ga0070705_100001037 Ga0070705_1000010376 279
114 3300005440 Ga0070705_100050177 Ga0070705_1000501772 279
115 3300005440 Ga0070705_100068458 Ga0070705_1000684582 279
116 3300005440 Ga0070705_100089873 Ga0070705_1000898732 279
117 3300005441 Ga0070700_100012818 Ga0070700_1000128182 279
118 3300005441 Ga0070700_100034282 Ga0070700_1000342824 279
119 3300005441 Ga0070700_100347217 Ga0070700_1003472171 279
120 3300005444 Ga0070694_100000219 Ga0070694_10000021918 279
121 3300005444 Ga0070694_100001050 Ga0070694_10000105013 279
122 3300005444 Ga0070694_100011718 Ga0070694_1000117182 279
123 3300005444 Ga0070694_100015160 Ga0070694_1000151606 279
124 3300005445 Ga0070708_100004339 Ga0070708_1000043393 279
125 3300005445 Ga0070708_100013850 Ga0070708_1000138507 279
126 3300005445 Ga0070708_100054517 Ga0070708_1000545171 279
127 3300005455 Ga0070663_100022346 Ga0070663_1000223465 279
128 3300005457 Ga0070662_100046425 Ga0070662_1000464254 279
129 3300005458 Ga0070681_10001393 Ga0070681_100013935 279
130 3300005458 Ga0070681_10091070 Ga0070681_100910701 279
131 3300005459 Ga0068867_100006130 Ga0068867_1000061302 279
132 3300005459 Ga0068867_100053167 Ga0068867_1000531674 279
133 3300005467 Ga0070706_100019070 Ga0070706_1000190702 279
134 3300005467 Ga0070706_100210470 Ga0070706_1002104701 279
135 3300005467 Ga0070706_100211962 Ga0070706_1002119622 279
136 3300005467 Ga0070706_100263742 Ga0070706_1002637422 279
137 3300005467 Ga0070706_100527273 Ga0070706_1005272732 279
138 3300005468 Ga0070707_100010295 Ga0070707_1000102953 279
139 3300005468 Ga0070707_100014099 Ga0070707_1000140998 279
140 3300005468 Ga0070707_100014511 Ga0070707_1000145112 279
141 3300005468 Ga0070707_100249720 Ga0070707_1002497203 279
142 3300005468 Ga0070707_100296322 Ga0070707_1002963221 279
143 3300005471 Ga0070698_100004982 Ga0070698_1000049822 279
144 3300005471 Ga0070698_100012986 Ga0070698_1000129866 279
145 3300005471 Ga0070698_100024328 Ga0070698_1000243282 279
146 3300005471 Ga0070698_100155188 Ga0070698_1001551881 279
147 3300005471 Ga0070698_100343214 Ga0070698_1003432141 279
148 3300005471 Ga0070698_100494652 Ga0070698_1004946521 279
149 3300005518 Ga0070699_100000839 Ga0070699_10000083942 279
150 3300005518 Ga0070699_100004885 Ga0070699_1000048856 279
151 3300005518 Ga0070699_100017315 Ga0070699_1000173154 279
152 3300005518 Ga0070699_100170093 Ga0070699_1001700932 279
153 3300005518 Ga0070699_100308803 Ga0070699_1003088032 279
154 3300005530 Ga0070679_100005008 Ga0070679_10000500811 279
155 3300005535 Ga0070684_100230965 Ga0070684_1002309652 279
156 3300005536 Ga0070697_100000775 Ga0070697_10000077518 279
157 3300005536 Ga0070697_100062418 Ga0070697_1000624182 279
158 3300005536 Ga0070697_100140799 Ga0070697_1001407993 279
159 3300005536 Ga0070697_100229080 Ga0070697_1002290801 279
160 3300005536 Ga0070697_100261161 Ga0070697_1002611612 279
161 3300005539 Ga0068853_100000111 Ga0068853_1000001116 279
162 3300005544 Ga0070686_100073578 Ga0070686_1000735782 279
163 3300005545 Ga0070695_100002386 Ga0070695_10000238611 279
164 3300005545 Ga0070695_100003048 Ga0070695_10000304815 279
165 3300005545 Ga0070695_100006201 Ga0070695_1000062013 279
166 3300005545 Ga0070695_100006878 Ga0070695_1000068782 279
167 3300005545 Ga0070695_100054611 Ga0070695_1000546112 279
168 3300005545 Ga0070695_100106111 Ga0070695_1001061112 279
169 3300005545 Ga0070695_100183636 Ga0070695_1001836361 279
170 3300005546 Ga0070696_100000218 Ga0070696_10000021814 279
171 3300005546 Ga0070696_100040370 Ga0070696_1000403704 279
172 3300005546 Ga0070696_100358820 Ga0070696_1003588201 279
173 3300005547 Ga0070693_100003071 Ga0070693_1000030717 279
174 3300005549 Ga0070704_100001454 Ga0070704_1000014546 279
175 3300005549 Ga0070704_100062208 Ga0070704_1000622083 279
176 3300005549 Ga0070704_100228557 Ga0070704_1002285572 279
177 3300005563 Ga0068855_100000219 Ga0068855_10000021925 279
178 3300005564 Ga0070664_100004538 Ga0070664_1000045389 279
179 3300005577 Ga0068857_100009753 Ga0068857_1000097534 279
180 3300005577 Ga0068857_100039223 Ga0068857_1000392232 279
181 3300005577 Ga0068857_100065527 Ga0068857_1000655272 279
182 3300005614 Ga0068856_100013237 Ga0068856_1000132377 279
183 3300005615 Ga0070702_100002994 Ga0070702_1000029948 279
184 3300005616 Ga0068852_100074561 Ga0068852_1000745613 279
185 3300005617 Ga0068859_100024393 Ga0068859_1000243937 279
186 3300005617 Ga0068859_100093863 Ga0068859_1000938632 279
187 3300005617 Ga0068859_100226705 Ga0068859_1002267052 279
188 3300005618 Ga0068864_100006889 Ga0068864_10000688915 279
189 3300005618 Ga0068864_100234578 Ga0068864_1002345783 279
190 3300005840 Ga0068870_10001517 Ga0068870_1000151714 279
191 3300005841 Ga0068863_100017502 Ga0068863_1000175023 279
192 3300005841 Ga0068863_100662496 Ga0068863_1006624961 279
193 3300005842 Ga0068858_100009138 Ga0068858_1000091384 279
194 3300005843 Ga0068860_100005840 Ga0068860_1000058405 279
195 3300005843 Ga0068860_100067011 Ga0068860_1000670113 279
196 3300005844 Ga0068862_100001733 Ga0068862_10000173320 279
197 3300005844 Ga0068862_100086443 Ga0068862_1000864432 279
198 3300005844 Ga0068862_100299460 Ga0068862_1002994602 279
199 3300005844 Ga0068862_100387043 Ga0068862_1003870432 279
200 3300005937 Ga0081455_10000135 Ga0081455_1000013544 279
201 3300005937 Ga0081455_10002839 Ga0081455_1000283919 279
202 3300005981 Ga0081538_10015472 Ga0081538_100154723 279
203 3300005981 Ga0081538_10052752 Ga0081538_100527522 279
204 3300005983 Ga0081540_1017263 Ga0081540_10172633 279
205 3300005983 Ga0081540_1025218 Ga0081540_10252183 279
206 3300005985 Ga0081539_10000009 Ga0081539_10000009343 279
207 3300006058 Ga0075432_10031285 Ga0075432_100312852 279
208 3300006058 Ga0075432_10039878 Ga0075432_100398782 279
209 3300006173 Ga0070716_100273114 Ga0070716_1002731142 279
210 3300006194 Ga0075427_10007499 Ga0075427_100074992 279
211 3300006844 Ga0075428_100000622 Ga0075428_10000062211 279
212 3300006844 Ga0075428_100010752 Ga0075428_10001075211 279
213 3300006844 Ga0075428_100019591 Ga0075428_1000195916 279
214 3300006844 Ga0075428_100032165 Ga0075428_1000321655 279
215 3300006844 Ga0075428_100052879 Ga0075428_1000528792 279
216 3300006844 Ga0075428_100124425 Ga0075428_1001244253 279
217 3300006844 Ga0075428_100170226 Ga0075428_1001702262 279
218 3300006846 Ga0075430_100000084 Ga0075430_10000008429 279
219 3300006846 Ga0075430_100000413 Ga0075430_10000041325 279
220 3300006846 Ga0075430_100185911 Ga0075430_1001859113 279
221 3300006846 Ga0075430_100514569 Ga0075430_1005145691 279
222 3300006847 Ga0075431_100000186 Ga0075431_10000018646 279
223 3300006847 Ga0075431_100001279 Ga0075431_10000127915 279
224 3300006847 Ga0075431_100003814 Ga0075431_10000381414 279
225 3300006847 Ga0075431_100004150 Ga0075431_1000041505 279
226 3300006847 Ga0075431_100022898 Ga0075431_1000228985 279
227 3300006847 Ga0075431_100119363 Ga0075431_1001193632 279
228 3300006847 Ga0075431_100579467 Ga0075431_1005794671 279
229 3300006852 Ga0075433_10000798 Ga0075433_100007984 279
230 3300006852 Ga0075433_10003625 Ga0075433_100036256 279
231 3300006852 Ga0075433_10007973 Ga0075433_100079732 279
232 3300006852 Ga0075433_10022248 Ga0075433_100222486 279
233 3300006852 Ga0075433_10092238 Ga0075433_100922382 279
234 3300006852 Ga0075433_10116927 Ga0075433_101169272 279
235 3300006852 Ga0075433_10400686 Ga0075433_104006862 279
236 3300006852 Ga0075433_10457400 Ga0075433_104574001 279
237 3300006871 Ga0075434_100038742 Ga0075434_1000387425 279
238 3300006871 Ga0075434_100068184 Ga0075434_1000681845 279
239 3300006871 Ga0075434_100081663 Ga0075434_1000816632 279
240 3300006871 Ga0075434_100094006 Ga0075434_1000940063 279
241 3300006871 Ga0075434_100104411 Ga0075434_1001044112 279
242 3300006871 Ga0075434_100109398 Ga0075434_1001093983 279
243 3300006871 Ga0075434_100201599 Ga0075434_1002015991 279
244 3300006871 Ga0075434_100364165 Ga0075434_1003641652 279
245 3300006880 Ga0075429_100000177 Ga0075429_10000017737 279
246 3300006880 Ga0075429_100002426 Ga0075429_1000024267 279
247 3300006880 Ga0075429_100007382 Ga0075429_1000073829 279
248 3300006880 Ga0075429_100011909 Ga0075429_1000119092 279
249 3300006880 Ga0075429_100038316 Ga0075429_1000383163 279
250 3300006880 Ga0075429_100087742 Ga0075429_1000877424 279
251 3300006880 Ga0075429_100335838 Ga0075429_1003358383 279
252 3300006914 Ga0075436_100004858 Ga0075436_1000048583 279
253 3300006914 Ga0075436_100083119 Ga0075436_1000831192 279
254 3300006931 Ga0097620_100024393 Ga0097620_1000243937 279
255 3300006931 Ga0097620_100093860 Ga0097620_1000938602 279
256 3300006931 Ga0097620_100226707 Ga0097620_1002267072 279
257 3300007076 Ga0075435_100032631 Ga0075435_1000326316 279
258 3300007076 Ga0075435_100060885 Ga0075435_1000608852 279
259 3300007076 Ga0075435_100108409 Ga0075435_1001084093 279
260 3300007076 Ga0075435_100364191 Ga0075435_1003641912 279
261 3300007265 Ga0099794_10026488 Ga0099794_100264882 279
262 3300009093 Ga0105240_10342221 Ga0105240_103422212 279
263 3300009094 Ga0111539_10006868 Ga0111539_100068683 279
264 3300009094 Ga0111539_10065254 Ga0111539_100652543 279
265 3300009098 Ga0105245_10343620 Ga0105245_103436202 279
266 3300009101 Ga0105247_10423834 Ga0105247_104238341 279
267 3300009147 Ga0114129_10001251 Ga0114129_100012515 279
268 3300009147 Ga0114129_10001591 Ga0114129_1000159113 279
269 3300009147 Ga0114129_10002356 Ga0114129_1000235615 279
270 3300009147 Ga0114129_10004666 Ga0114129_100046665 279
271 3300009147 Ga0114129_10008480 Ga0114129_100084805 279
272 3300009147 Ga0114129_10011734 Ga0114129_100117344 279
273 3300009147 Ga0114129_10027822 Ga0114129_100278222 279
274 3300009147 Ga0114129_10051151 Ga0114129_100511512 279
275 3300009147 Ga0114129_10053512 Ga0114129_100535125 279
276 3300009147 Ga0114129_10073705 Ga0114129_100737053 279
277 3300009147 Ga0114129_10087073 Ga0114129_100870733 279
278 3300009147 Ga0114129_10098999 Ga0114129_100989995 279
279 3300009147 Ga0114129_10127803 Ga0114129_101278034 279
280 3300009147 Ga0114129_10146544 Ga0114129_101465442 279
281 3300009147 Ga0114129_10210627 Ga0114129_102106274 279
282 3300009147 Ga0114129_10339557 Ga0114129_103395572 279
283 3300009147 Ga0114129_10367601 Ga0114129_103676012 279
284 3300009147 Ga0114129_10413606 Ga0114129_104136062 279
285 3300009147 Ga0114129_10429290 Ga0114129_104292902 279
286 3300009147 Ga0114129_10495692 Ga0114129_104956922 279
287 3300009148 Ga0105243_10066059 Ga0105243_100660593 279
288 3300009148 Ga0105243_10164784 Ga0105243_101647842 279
289 3300009148 Ga0105243_10215301 Ga0105243_102153012 279
290 3300009174 Ga0105241_10000389 Ga0105241_1000038930 279
291 3300009174 Ga0105241_10110350 Ga0105241_101103502 279
292 3300009176 Ga0105242_10054429 Ga0105242_100544292 279
293 3300009176 Ga0105242_10099335 Ga0105242_100993354 279
294 3300009176 Ga0105242_10330497 Ga0105242_103304972 279
295 3300009553 Ga0105249_10010302 Ga0105249_100103028 279
296 3300009553 Ga0105249_10072424 Ga0105249_100724241 279
297 3300009553 Ga0105249_10097311 Ga0105249_100973112 279
298 3300009553 Ga0105249_10208998 Ga0105249_102089981 279
299 3300010159 Ga0099796_10159475 Ga0099796_101594751 279
300 3300010375 Ga0105239_10141195 Ga0105239_101411953 279
301 3300013100 Ga0157373_10002416 Ga0157373_100024168 279
302 3300013102 Ga0157371_10296128 Ga0157371_102961281 279
303 3300013105 Ga0157369_10007011 Ga0157369_100070112 279
304 3300013297 Ga0157378_10613481 Ga0157378_106134811 279
305 3300013307 Ga0157372_10001597 Ga0157372_100015975 279
306 3300013307 Ga0157372_10410316 Ga0157372_104103161 279
307 3300013307 Ga0157372_10462824 Ga0157372_104628242 279
308 3300013308 Ga0157375_10127156 Ga0157375_101271563 279
309 3300014326 Ga0157380_10221167 Ga0157380_102211672 279
310 3300014497 Ga0182008_10048443 Ga0182008_100484432 279
311 3300014968 Ga0157379_10107006 Ga0157379_101070062 279
312 3300015262 Ga0182007_10033746 Ga0182007_100337462 279
313 3300025885 Ga0207653_10041079 Ga0207653_100410792 279
314 3300025885 Ga0207653_10054887 Ga0207653_100548872 279
315 3300025885 Ga0207653_10090966 Ga0207653_100909662 279
316 3300025907 Ga0207645_10004040 Ga0207645_100040407 279
317 3300025908 Ga0207643_10001853 Ga0207643_100018537 279
318 3300025910 Ga0207684_10000142 Ga0207684_1000014229 279
319 3300025910 Ga0207684_10008680 Ga0207684_100086801 279
320 3300025910 Ga0207684_10029623 Ga0207684_100296232 279
321 3300025910 Ga0207684_10044882 Ga0207684_100448823 279
322 3300025910 Ga0207684_10060379 Ga0207684_100603794 279
323 3300025910 Ga0207684_10249490 Ga0207684_102494902 279
324 3300025910 Ga0207684_10253809 Ga0207684_102538092 279
325 3300025910 Ga0207684_10510742 Ga0207684_105107421 279
326 3300025911 Ga0207654_10001908 Ga0207654_100019086 279
327 3300025912 Ga0207707_10000047 Ga0207707_1000004789 279
328 3300025912 Ga0207707_10080180 Ga0207707_100801802 279
329 3300025914 Ga0207671_10325265 Ga0207671_103252652 279
330 3300025917 Ga0207660_10002017 Ga0207660_100020174 279
331 3300025919 Ga0207657_10000021 Ga0207657_1000002143 279
332 3300025920 Ga0207649_10001184 Ga0207649_100011847 279
333 3300025921 Ga0207652_10000582 Ga0207652_1000058234 279
334 3300025922 Ga0207646_10000707 Ga0207646_1000070714 279
335 3300025922 Ga0207646_10005687 Ga0207646_100056879 279
336 3300025922 Ga0207646_10012582 Ga0207646_100125829 279
337 3300025922 Ga0207646_10013130 Ga0207646_100131306 279
338 3300025922 Ga0207646_10087156 Ga0207646_100871561 279
339 3300025922 Ga0207646_10169430 Ga0207646_101694303 279
340 3300025923 Ga0207681_10037895 Ga0207681_100378954 279
341 3300025925 Ga0207650_10066223 Ga0207650_100662233 279
342 3300025932 Ga0207690_10002230 Ga0207690_1000223013 279
343 3300025933 Ga0207706_10001025 Ga0207706_100010251 279
344 3300025933 Ga0207706_10066645 Ga0207706_100666452 279
345 3300025935 Ga0207709_10058997 Ga0207709_100589972 279
346 3300025935 Ga0207709_10181160 Ga0207709_101811602 279
347 3300025935 Ga0207709_10447294 Ga0207709_104472941 279
348 3300025936 Ga0207670_10014933 Ga0207670_100149333 279
349 3300025938 Ga0207704_10355646 Ga0207704_103556462 279
350 3300025939 Ga0207665_10000411 Ga0207665_100004117 279
351 3300025940 Ga0207691_10036803 Ga0207691_100368032 279
352 3300025941 Ga0207711_10252582 Ga0207711_102525821 279
353 3300025941 Ga0207711_10397573 Ga0207711_103975732 279
354 3300025942 Ga0207689_10000616 Ga0207689_1000061621 279
355 3300025942 Ga0207689_10002819 Ga0207689_1000281919 279
356 3300025942 Ga0207689_10112492 Ga0207689_101124922 279
357 3300025944 Ga0207661_10023923 Ga0207661_100239232 279
358 3300025945 Ga0207679_10000824 Ga0207679_1000082417 279
359 3300025949 Ga0207667_10016902 Ga0207667_100169023 279
360 3300025960 Ga0207651_10007271 Ga0207651_100072717 279
361 3300025961 Ga0207712_10021224 Ga0207712_100212245 279
362 3300025986 Ga0207658_10054437 Ga0207658_100544373 279
363 3300026023 Ga0207677_10080291 Ga0207677_100802913 279
364 3300026035 Ga0207703_10013453 Ga0207703_1001345310 279
365 3300026067 Ga0207678_10001854 Ga0207678_1000185416 279
366 3300026075 Ga0207708_10021974 Ga0207708_100219745 279
367 3300026075 Ga0207708_10059379 Ga0207708_100593792 279
368 3300026078 Ga0207702_10001000 Ga0207702_1000100032 279
369 3300026088 Ga0207641_10076652 Ga0207641_100766523 279
370 3300026088 Ga0207641_10141481 Ga0207641_101414811 279
371 3300026088 Ga0207641_10486144 Ga0207641_104861441 279
372 3300026089 Ga0207648_10000527 Ga0207648_1000052740 279
373 3300026089 Ga0207648_10055585 Ga0207648_100555853 279
374 3300026089 Ga0207648_10056805 Ga0207648_100568054 279
375 3300026116 Ga0207674_10000137 Ga0207674_1000013764 279
376 3300026116 Ga0207674_10031104 Ga0207674_100311046 279
377 3300026118 Ga0207675_100011157 Ga0207675_1000111575 279
378 3300027364 Ga0209967_1001962 Ga0209967_10019622 279
379 3300027471 Ga0209995_1004026 Ga0209995_10040262 279
380 3300027526 Ga0209968_1000700 Ga0209968_10007004 279
381 3300027543 Ga0209999_1001286 Ga0209999_10012862 279
382 3300027665 Ga0209983_1000027 Ga0209983_10000273 279
383 3300027665 Ga0209983_1023019 Ga0209983_10230192 279
384 3300027671 Ga0209588_1032028 Ga0209588_10320281 279
385 3300027682 Ga0209971_1000018 Ga0209971_100001822 279
386 3300027695 Ga0209966_1000065 Ga0209966_100006512 279
387 3300027717 Ga0209998_10000062 Ga0209998_1000006233 279
388 3300027876 Ga0209974_10001726 Ga0209974_100017267 279
389 3300027907 Ga0207428_10000063 Ga0207428_1000006348 279
390 3300027907 Ga0207428_10000091 Ga0207428_1000009126 279
391 3300027907 Ga0207428_10003665 Ga0207428_1000366515 279
392 3300028380 Ga0268265_10002646 Ga0268265_1000264616 279
393 3300028380 Ga0268265_10016987 Ga0268265_100169877 279
394 3300028380 Ga0268265_10205035 Ga0268265_102050352 279
395 3300028381 Ga0268264_10026943 Ga0268264_100269432 279
396 3300028381 Ga0268264_10221724 Ga0268264_102217243 279
397 3300028381 Ga0268264_10315107 Ga0268264_103151071 279
398 3300031548 Ga0307408_100013810 Ga0307408_1000138102 279
399 3300031852 Ga0307410_10322965 Ga0307410_103229652 279
400 3300031911 Ga0307412_10241231 Ga0307412_102412311 279
401 3300031911 Ga0307412_10494883 Ga0307412_104948832 279
402 3300032002 Ga0307416_100118413 Ga0307416_1001184134 279
403 3300032126 Ga0307415_100102638 Ga0307415_1001026381 279
404 3300034817 Ga0373948_0028014 Ga0373948_0028014_238_1077 279
405 3300035084 Ga0373928_0026731 Ga0373928_0026731_350_1189 279
406 3300035088 Ga0373940_0005357 Ga0373940_0005357_434_1279 279
407 3300035088 Ga0373940_0015849 Ga0373940_0015849_753_1592 279
408 3300035090 Ga0373949_0012267 Ga0373949_0012267_849_1694 279
409 3300035091 Ga0373951_0003891 Ga0373951_0003891_2669_3508 279
410 3300035115 Ga0373941_0086623 Ga0373941_0086623_111_950 279
411 3300035121 Ga0373960_0005528 Ga0373960_0005528_1072_1911 279
412 3300035241 Ga0373961_0029397 Ga0373961_0029397_12_857 279
413 3300035691 Ga0373931_0010670 Ga0373931_0010670_153_998 279
414 3300035691 Ga0373931_0022659 Ga0373931_0022659_415_1254 279
415 3300037312 Ga0395899_0012934 Ga0395899_0012934_3075_3914 279
416 3300037418 Ga0395900_0578402 Ga0395900_0578402_60_905 279
417 3300038443 Ga0395901_0004330 Ga0395901_0004330_13119_13958 279
418 3300042005 Ga0439448_0000780 Ga0439448_0000780_5001_5840 279
419 3300042008 Ga0439450_009005 Ga0439450_009005_428_1267 279
420 3300042157 Ga0439458_0006551 Ga0439458_0006551_1519_2358 279
421 3300042436 Ga0439435_0041144 Ga0439435_0041144_149_997 279
422 3300042438 Ga0439459_0002895 Ga0439459_0002895_52_891 279
423 3300042439 Ga0439464_0002668 Ga0439464_0002668_857_1696 279
424 3300042461 Ga0439460_0001847 Ga0439460_0001847_2130_2969 279
425 3300042876 Ga0451577_0003104 Ga0451577_0003104_10737_11594 279
426 3300042876 Ga0451577_0007817 Ga0451577_0007817_574_1413 279
427 3300042876 Ga0451577_0058541 Ga0451577_0058541_98_937 279
428 3300044673 Ga0453683_0043823 Ga0453683_0043823_817_1656 279
429 3300044673 Ga0453683_0049017 Ga0453683_0049017_1212_2069 279
430 3300044694 Ga0466963_0329001 Ga0466963_0329001_128_970 279
431 3300044712 Ga0453684_0008557 Ga0453684_0008557_12661_13518 279
432 3300044712 Ga0453684_0608707 Ga0453684_0608707_294_1133 279
433 3300045051 Ga0451576_0002399 Ga0451576_0002399_17824_18663 279
434 3300045051 Ga0451576_0021495 Ga0451576_0021495_1625_2464 279
435 3300045051 Ga0451576_0339585 Ga0451576_0339585_716_1555 279
436 3300046472 Ga0495580_0001249 Ga0495580_0001249_14083_14922 279
437 3300048905 Ga0496102_0022019 Ga0496102_0022019_3200_4039 279
438 3300048905 Ga0496102_0060756 Ga0496102_0060756_1653_2492 279
439 3300048905 Ga0496102_0344222 Ga0496102_0344222_400_1242 279
440 3300048909 Ga0496106_0295288 Ga0496106_0295288_20_859 279
441 3300048912 Ga0496109_0535772 Ga0496109_0535772_238_1080 279
442 3300048915 Ga0496112_0459056 Ga0496112_0459056_51_890 279
443 3300049570 Ga0501033_0135872 Ga0501033_0135872_111_950 279
444 3300049570 Ga0501033_0203817 Ga0501033_0203817_82_924 279
445 3300049572 Ga0501036_0021990 Ga0501036_0021990_2054_2896 279
446 3300049573 Ga0501037_0016149 Ga0501037_0016149_2264_3103 279
447 3300049574 Ga0501038_0009653 Ga0501038_0009653_2485_3327 279
448 3300049574 Ga0501038_0192388 Ga0501038_0192388_751_1590 279
449 3300049574 Ga0501038_0209605 Ga0501038_0209605_292_1137 279
450 3300049574 Ga0501038_0340697 Ga0501038_0340697_307_1146 279
451 3300049575 Ga0501039_0034041 Ga0501039_0034041_2245_3087 279
452 3300049575 Ga0501039_0036902 Ga0501039_0036902_2333_3172 279
453 3300049575 Ga0501039_0477218 Ga0501039_0477218_30_875 279
454 3300049576 Ga0501040_0003584 Ga0501040_0003584_1348_2190 279
455 3300049576 Ga0501040_0032102 Ga0501040_0032102_1043_1882 279
456 3300049576 Ga0501040_0082439 Ga0501040_0082439_1326_2165 279
457 3300049576 Ga0501040_0276422 Ga0501040_0276422_85_924 279
458 3300049577 Ga0501041_0085073 Ga0501041_0085073_863_1702 279
459 3300049577 Ga0501041_0095569 Ga0501041_0095569_775_1614 279
460 3300049578 Ga0501042_0010230 Ga0501042_0010230_3092_3931 279
461 3300049580 Ga0501046_0000473 Ga0501046_0000473_9209_10048 279
462 3300049581 Ga0501047_0072889 Ga0501047_0072889_2363_3202 279
463 3300049582 Ga0501048_0006631 Ga0501048_0006631_6788_7627 279
464 3300049582 Ga0501048_0031393 Ga0501048_0031393_1977_2819 279
465 3300049582 Ga0501048_0181442 Ga0501048_0181442_630_1472 279
466 3300049584 Ga0501068_0168278 Ga0501068_0168278_527_1366 279
467 3300049584 Ga0501068_0299872 Ga0501068_0299872_139_978 279
468 3300049587 Ga0501071_0038579 Ga0501071_0038579_2376_3215 279
469 3300049587 Ga0501071_0101948 Ga0501071_0101948_986_1828 279
470 3300049588 Ga0501072_0003706 Ga0501072_0003706_10292_11134 279
471 3300049588 Ga0501072_0003793 Ga0501072_0003793_682_1521 279
472 3300049588 Ga0501072_0062699 Ga0501072_0062699_480_1319 279
473 3300049588 Ga0501072_0128431 Ga0501072_0128431_342_1181 279
474 3300049588 Ga0501072_0228955 Ga0501072_0228955_490_1332 279
475 3300049589 Ga0501073_0091786 Ga0501073_0091786_101_943 279
476 3300049590 Ga0501074_0012067 Ga0501074_0012067_2932_3771 279
477 3300049590 Ga0501074_0113450 Ga0501074_0113450_57_896 279
478 3300049591 Ga0501075_0000078 Ga0501075_0000078_29940_30782 279
479 3300049591 Ga0501075_0067008 Ga0501075_0067008_1853_2692 279
480 3300049591 Ga0501075_0082426 Ga0501075_0082426_1112_2044 279
481 3300049591 Ga0501075_0131730 Ga0501075_0131730_940_1779 279
482 3300049591 Ga0501075_0181966 Ga0501075_0181966_483_1322 279
483 3300049592 Ga0501076_0000002 Ga0501076_0000002_153131_153973 279
484 3300049592 Ga0501076_0043538 Ga0501076_0043538_1329_2168 279
485 3300049592 Ga0501076_0191628 Ga0501076_0191628_27_866 279
486 3300049593 Ga0501077_0004194 Ga0501077_0004194_7733_8572 279
487 3300049593 Ga0501077_0084628 Ga0501077_0084628_151_990 279
488 3300049741 Ga0501079_0001001 Ga0501079_0001001_16935_17774 279
489 3300049741 Ga0501079_0009589 Ga0501079_0009589_2974_3813 279
490 3300049741 Ga0501079_0065232 Ga0501079_0065232_1110_1949 279
491 3300049741 Ga0501079_0076743 Ga0501079_0076743_565_1407 279
492 3300049741 Ga0501079_0120103 Ga0501079_0120103_362_1204 279
493 3300049742 Ga0501080_0128698 Ga0501080_0128698_349_1188 279
494 3300049742 Ga0501080_0211510 Ga0501080_0211510_794_1633 279
495 3300049743 Ga0501081_0002207 Ga0501081_0002207_1900_2742 279
496 3300049743 Ga0501081_0002835 Ga0501081_0002835_4085_4924 279
497 3300049743 Ga0501081_0094918 Ga0501081_0094918_706_1545 279
498 3300049743 Ga0501081_0135820 Ga0501081_0135820_78_917 279
499 3300049744 Ga0501083_0355428 Ga0501083_0355428_68_910 279
500 3300049822 Ga0501035_0099556 Ga0501035_0099556_1685_2524 279
501 3300049822 Ga0501035_0255056 Ga0501035_0255056_56_895 279
502 3300049824 Ga0501045_0044535 Ga0501045_0044535_1151_1990 279
503 3300049824 Ga0501045_0055251 Ga0501045_0055251_1283_2122 279
504 3300049824 Ga0501045_0058952 Ga0501045_0058952_1330_2172 279
505 3300050507 nmdc:mga05p37_10791_c1 nmdc:mga05p37_10791_c1_7150_7995 279
506 3300050507 nmdc:mga05p37_12334_c1 nmdc:mga05p37_12334_c1_6397_7236 279
507 3300050507 nmdc:mga05p37_1316_c1 nmdc:mga05p37_1316_c1_9416_10258 279
508 3300050507 nmdc:mga05p37_157286_c1 nmdc:mga05p37_157286_c1_1332_2174 279
509 3300050507 nmdc:mga05p37_166852_c1 nmdc:mga05p37_166852_c1_1681_2520 279
510 3300050507 nmdc:mga05p37_1819_c1 nmdc:mga05p37_1819_c1_13232_14074 279
511 3300050507 nmdc:mga05p37_202854_c1 nmdc:mga05p37_202854_c1_1454_2293 279
512 3300050507 nmdc:mga05p37_2113_c1 nmdc:mga05p37_2113_c1_10203_11042 279
513 3300050507 nmdc:mga05p37_263652_c1 nmdc:mga05p37_263652_c1_371_1216 279
514 3300050507 nmdc:mga05p37_2942_c1 nmdc:mga05p37_2942_c1_606_1451 279
515 3300050507 nmdc:mga05p37_323810_c1 nmdc:mga05p37_323810_c1_917_1756 279
516 3300050507 nmdc:mga05p37_326212_c1 nmdc:mga05p37_326212_c1_784_1623 279
517 3300050507 nmdc:mga05p37_359102_c1 nmdc:mga05p37_359102_c1_215_1072 279
518 3300050507 nmdc:mga05p37_39095_c1 nmdc:mga05p37_39095_c1_2933_3781 279
519 3300050507 nmdc:mga05p37_57800_c1 nmdc:mga05p37_57800_c1_1942_2787 279
520 3300050507 nmdc:mga05p37_65063_c1 nmdc:mga05p37_65063_c1_1184_2023 279
521 3300050508 nmdc:mga09592_26622_c1 nmdc:mga09592_26622_c1_2585_3427 279
522 3300050508 nmdc:mga09592_321770_c1 nmdc:mga09592_321770_c1_272_1117 279
523 3300050508 nmdc:mga09592_445_c1 nmdc:mga09592_445_c1_29288_30127 279
524 3300050508 nmdc:mga09592_47270_c1 nmdc:mga09592_47270_c1_1070_1918 279
525 3300050508 nmdc:mga09592_57122_c1 nmdc:mga09592_57122_c1_274_1119 279
526 3300050508 nmdc:mga09592_68296_c1 nmdc:mga09592_68296_c1_580_1425 279
527 3300050509 nmdc:mga0qj67_226562_c1 nmdc:mga0qj67_226562_c1_171_1016 279
528 3300050509 nmdc:mga0qj67_2851_c1 nmdc:mga0qj67_2851_c1_10191_11030 279
529 3300050509 nmdc:mga0qj67_421_c1 nmdc:mga0qj67_421_c1_1359_2198 279
530 3300050510 nmdc:mga06r32_1003_c1 nmdc:mga06r32_1003_c1_9934_10779 279
531 3300050510 nmdc:mga06r32_114585_c1 nmdc:mga06r32_114585_c1_1505_2344 279
532 3300050510 nmdc:mga06r32_1509_c1 nmdc:mga06r32_1509_c1_6470_7309 279
533 3300050510 nmdc:mga06r32_15708_c1 nmdc:mga06r32_15708_c1_3317_4156 279
534 3300050510 nmdc:mga06r32_19194_c1 nmdc:mga06r32_19194_c1_3534_4382 279
535 3300050510 nmdc:mga06r32_26091_c1 nmdc:mga06r32_26091_c1_1040_1885 279
536 3300050510 nmdc:mga06r32_3250_c1 nmdc:mga06r32_3250_c1_13677_14516 279
537 3300050510 nmdc:mga06r32_541946_c1 nmdc:mga06r32_541946_c1_13_858 279
538 3300050510 nmdc:mga06r32_5805_c1 nmdc:mga06r32_5805_c1_1149_1991 279
539 3300050511 nmdc:mga08y16_121152_c1 nmdc:mga08y16_121152_c1_1194_2039 279
540 3300050511 nmdc:mga08y16_4347_c1 nmdc:mga08y16_4347_c1_11466_12311 279
541 3300050511 nmdc:mga08y16_54210_c1 nmdc:mga08y16_54210_c1_1265_2110 279
542 3300050511 nmdc:mga08y16_60331_c1 nmdc:mga08y16_60331_c1_2547_3389 279
543 3300050511 nmdc:mga08y16_63096_c1 nmdc:mga08y16_63096_c1_2879_3718 279
544 3300050511 nmdc:mga08y16_7638_c1 nmdc:mga08y16_7638_c1_7515_8372 279
545 3300050512 nmdc:mga0n895_1185_c1 nmdc:mga0n895_1185_c1_8586_9428 279
546 3300050512 nmdc:mga0n895_134553_c1 nmdc:mga0n895_134553_c1_769_1611 279
547 3300050512 nmdc:mga0n895_21841_c1 nmdc:mga0n895_21841_c1_3687_4526 279
548 3300050512 nmdc:mga0n895_222693_c1 nmdc:mga0n895_222693_c1_157_996 279
549 3300050512 nmdc:mga0n895_286269_c1 nmdc:mga0n895_286269_c1_721_1560 279
550 3300050512 nmdc:mga0n895_30687_c1 nmdc:mga0n895_30687_c1_885_1724 279
551 3300050512 nmdc:mga0n895_33153_c1 nmdc:mga0n895_33153_c1_3458_4297 279
552 3300050512 nmdc:mga0n895_43046_c1 nmdc:mga0n895_43046_c1_494_1333 279
553 3300050512 nmdc:mga0n895_44545_c1 nmdc:mga0n895_44545_c1_3290_4132 279
554 3300050512 nmdc:mga0n895_55177_c1 nmdc:mga0n895_55177_c1_706_1548 279
555 3300050512 nmdc:mga0n895_66999_c1 nmdc:mga0n895_66999_c1_1488_2333 279
556 3300050512 nmdc:mga0n895_736561_c1 nmdc:mga0n895_736561_c1_105_944 279
557 3300050513 nmdc:mga0rr50_102393_c1 nmdc:mga0rr50_102393_c1_363_1205 279
558 3300050513 nmdc:mga0rr50_221737_c1 nmdc:mga0rr50_221737_c1_575_1414 279
559 3300050513 nmdc:mga0rr50_4128_c1 nmdc:mga0rr50_4128_c1_7606_8445 279
560 3300050513 nmdc:mga0rr50_48289_c1 nmdc:mga0rr50_48289_c1_196_1038 279
561 3300050515 nmdc:mga0a205_110300_c1 nmdc:mga0a205_110300_c1_1268_2113 279
562 3300050515 nmdc:mga0a205_137776_c1 nmdc:mga0a205_137776_c1_210_1049 279
563 3300050515 nmdc:mga0a205_15565_c1 nmdc:mga0a205_15565_c1_3673_4512 279
564 3300050515 nmdc:mga0a205_176647_c1 nmdc:mga0a205_176647_c1_750_1592 279
565 3300050515 nmdc:mga0a205_184531_c1 nmdc:mga0a205_184531_c1_26_865 279
566 3300050515 nmdc:mga0a205_24902_c1 nmdc:mga0a205_24902_c1_89_931 279
567 3300050515 nmdc:mga0a205_33930_c1 nmdc:mga0a205_33930_c1_856_1695 279
568 3300050515 nmdc:mga0a205_4127_c1 nmdc:mga0a205_4127_c1_2290_3132 279
569 3300050515 nmdc:mga0a205_71069_c1 nmdc:mga0a205_71069_c1_592_1434 279
570 3300050515 nmdc:mga0a205_82419_c1 nmdc:mga0a205_82419_c1_1589_2434 279
571 3300050515 nmdc:mga0a205_8887_c1 nmdc:mga0a205_8887_c1_469_1308 279
572 3300054114 Ga0501084_0003242 Ga0501084_0003242_10415_11257 279
573 3300054114 Ga0501084_0004703 Ga0501084_0004703_3335_4174 279
574 3300054114 Ga0501084_0038164 Ga0501084_0038164_2112_2951 279
575 3300054114 Ga0501084_0080133 Ga0501084_0080133_789_1628 279
576 3300054114 Ga0501084_0398482 Ga0501084_0398482_142_981 279
577 3300054114 Ga0501084_0590734 Ga0501084_0590734_44_883 279
578 3300060353 Ga0501082_0000407 Ga0501082_0000407_7733_8572 279
579 3300060353 Ga0501082_0022243 Ga0501082_0022243_1931_2770 279
580 3300061734 Ga0530510_0000024 Ga0530510_0000024_22617_23459 279
581 3300061734 Ga0530510_0000913 Ga0530510_0000913_13052_13897 279
582 3300061734 Ga0530510_0019693 Ga0530510_0019693_2823_3662 279
583 3300061734 Ga0530510_0055748 Ga0530510_0055748_1724_2563 279
584 3300061734 Ga0530510_0197904 Ga0530510_0197904_249_1091 279
585 3300061734 Ga0530510_0510891 Ga0530510_0510891_52_891 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13354

Beta-lactamase2

Beta-lactamase enzyme family

20

245

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ewf-assembly2.cif.gz_B the crystal structure of beta-lactamase from sphaerobacter thermophilus dsm 20745 0.9093 4 278
4ewf-assembly4.cif.gz_D the crystal structure of beta-lactamase from sphaerobacter thermophilus dsm 20745 0.9064 4 278
4ewf-assembly3.cif.gz_C the crystal structure of beta-lactamase from sphaerobacter thermophilus dsm 20745 0.905 2 277
2j8y-assembly2.cif.gz_B structure of pbp-a acyl-enzyme complex with penicillin-g 0.9019 1 276
2jbf-assembly3.cif.gz_C structure of pbp-a, l158e mutant. acyl-enzyme complex with penicillin- g. 0.8989 1 276
ID Description Score Start End Superfamily
2j7vB01 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9116 1 276 3.40.710.10
4ewfA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.9084 4 278 3.40.710.10
2j7vB01 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8816 1 276 3.40.710.10
1mfoA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8745 3 277 3.40.710.10
1mfoA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8652 3 277 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A2V6Q4E1-F1-model_v4 Serine hydrolase 0.9918 40 279 GO:0008800
GO:0030655
GO:0046677
AF-A0A1H1JV97-F1-model_v4 beta-lactamase (EC 3.5.2.6) 0.9864 1 277 GO:0008800
GO:0030655
GO:0046677
AF-A0A3B9C4H0-F1-model_v4 deleted 0.9834 186 276
AF-A0A7V3BGX4-F1-model_v4 Serine hydrolase 0.9811 2 205 GO:0008800
GO:0030655
GO:0046677
AF-A0A3D1RW74-F1-model_v4 beta-lactamase (EC 3.5.2.6) 0.98 2 279 GO:0008800
GO:0030655
GO:0046677

Feature Viewer

pLDDT pTM Quality
96.12 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map