F466501
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 585 | 225 | 585 | 279 |
Family's Representative Sequence
| Representative Sequence | 3300049591|Ga0501075_0082426|Ga0501075_0082426_1112_2044 |
| Length | 310 |
| Sequence | MQDLAHRLHELCDPLPFDTSWFLKDWRTGATADRRGDVPVPSASTRKISILMATLAAVHAGKLALDQTVTIEARYQDNDSGTFQHLTPGFAITLRDALVMMIIVSDNTCTGMVVDLVGLGPLQRYCESIGLKRTIHRFGIPPRLGPDHALDQVTTTTPADQGLLLELIQRGTADAAVATRLGCTGALCRLAIDILSWQKLKTRLPSLLPAGTKIAHKTGTGSRGYMDAGIVFKDDRPLFILTAYTDHVPAALPDGTPGFAAANLLIGRLARACWDALAERDRHGRRPGTAHGQADRRLVSMNPVHEGRPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 2 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 157 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 158 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 159 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 171 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 172 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 173 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 174 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 175 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 176 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 177 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 178 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 179 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 180 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 181 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 182 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 185 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 186 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 188 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.03 |
| Rhizosphere | 98.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI26141J51220_1000549 | 3300003503 | Bacteria | 2112 |
| 2 | Ga0058859_10715401 | 3300004798 | Bacteria | 1313 |
| 3 | Ga0058860_11434841 | 3300004801 | Bacteria | 1507 |
| 4 | Ga0065715_10310122 | 3300005293 | Bacteria | 1020 |
| 5 | Ga0070676_10004841 | 3300005328 | Bacteria | 7123 |
| 6 | Ga0070683_100346544 | 3300005329 | Bacteria | 1415 |
| 7 | Ga0070690_100012799 | 3300005330 | Bacteria | 4942 |
| 8 | Ga0070670_100010918 | 3300005331 | Bacteria | 7757 |
| 9 | Ga0070677_10032626 | 3300005333 | Bacteria | 1999 |
| 10 | Ga0068869_100004848 | 3300005334 | Bacteria | 8406 |
| 11 | Ga0068869_100007099 | 3300005334 | Bacteria | 7136 |
| 12 | Ga0068869_100109819 | 3300005334 | Bacteria | 2097 |
| 13 | Ga0070680_100049024 | 3300005336 | Bacteria | 3442 |
| 14 | Ga0070682_100000416 | 3300005337 | Bacteria | 27786 |
| 15 | Ga0070660_100000083 | 3300005339 | Bacteria | 56648 |
| 16 | Ga0070691_10006575 | 3300005341 | Bacteria | 5319 |
| 17 | Ga0070691_10012905 | 3300005341 | Bacteria | 3826 |
| 18 | Ga0070691_10020985 | 3300005341 | Unclassified | 3021 |
| 19 | Ga0070691_10140875 | 3300005341 | Bacteria | 1229 |
| 20 | Ga0070661_100000403 | 3300005344 | Bacteria | 33584 |
| 21 | Ga0070692_10265290 | 3300005345 | Unclassified | 1034 |
| 22 | Ga0070669_100062878 | 3300005353 | Unclassified | 2731 |
| 23 | Ga0070673_100004405 | 3300005364 | Bacteria | 8904 |
| 24 | Ga0070688_100166189 | 3300005365 | Unclassified | 1519 |
| 25 | Ga0070659_100005267 | 3300005366 | Bacteria | 9282 |
| 26 | Ga0070667_100097355 | 3300005367 | Bacteria | 2538 |
| 27 | Ga0070703_10035063 | 3300005406 | Bacteria | 1535 |
| 28 | Ga0070703_10055642 | 3300005406 | Bacteria | 1279 |
| 29 | Ga0070701_10062815 | 3300005438 | Unclassified | 1963 |
| 30 | Ga0070705_100001037 | 3300005440 | Bacteria | 15457 |
| 31 | Ga0070705_100050177 | 3300005440 | Bacteria | 2426 |
| 32 | Ga0070705_100068458 | 3300005440 | Bacteria | 2136 |
| 33 | Ga0070705_100089873 | 3300005440 | Bacteria | 1910 |
| 34 | Ga0070700_100012818 | 3300005441 | Bacteria | 4696 |
| 35 | Ga0070700_100034282 | 3300005441 | Bacteria | 3065 |
| 36 | Ga0070700_100347217 | 3300005441 | Unclassified | 1099 |
| 37 | Ga0070694_100000219 | 3300005444 | Bacteria | 30020 |
| 38 | Ga0070694_100001050 | 3300005444 | Bacteria | 15776 |
| 39 | Ga0070694_100011718 | 3300005444 | Bacteria | 5433 |
| 40 | Ga0070694_100015160 | 3300005444 | Bacteria | 4834 |
| 41 | Ga0070708_100004339 | 3300005445 | Bacteria | 11140 |
| 42 | Ga0070708_100013850 | 3300005445 | Bacteria | 6622 |
| 43 | Ga0070708_100054517 | 3300005445 | Bacteria | 3551 |
| 44 | Ga0070708_100088101 | 3300005445 | Bacteria | 2821 |
| 45 | Ga0070663_100022346 | 3300005455 | Unclassified | 4228 |
| 46 | Ga0070662_100046425 | 3300005457 | Bacteria | 3121 |
| 47 | Ga0070681_10001393 | 3300005458 | Bacteria | 21189 |
| 48 | Ga0070681_10091070 | 3300005458 | Bacteria | 3000 |
| 49 | Ga0068867_100006130 | 3300005459 | Bacteria | 8513 |
| 50 | Ga0068867_100053167 | 3300005459 | Bacteria | 2991 |
| 51 | Ga0070706_100019070 | 3300005467 | Bacteria | 6328 |
| 52 | Ga0070706_100210470 | 3300005467 | Bacteria | 1816 |
| 53 | Ga0070706_100211962 | 3300005467 | Bacteria | 1809 |
| 54 | Ga0070706_100263742 | 3300005467 | Bacteria | 1608 |
| 55 | Ga0070706_100299887 | 3300005467 | Unclassified | 1499 |
| 56 | Ga0070706_100527273 | 3300005467 | Bacteria | 1099 |
| 57 | Ga0070707_100010295 | 3300005468 | Bacteria | 8705 |
| 58 | Ga0070707_100014099 | 3300005468 | Bacteria | 7489 |
| 59 | Ga0070707_100014511 | 3300005468 | Bacteria | 7384 |
| 60 | Ga0070707_100045690 | 3300005468 | Bacteria | 4191 |
| 61 | Ga0070707_100249720 | 3300005468 | Bacteria | 1726 |
| 62 | Ga0070707_100296322 | 3300005468 | Bacteria | 1572 |
| 63 | Ga0070698_100004982 | 3300005471 | Bacteria | 14550 |
| 64 | Ga0070698_100012986 | 3300005471 | Bacteria | 8816 |
| 65 | Ga0070698_100024328 | 3300005471 | Bacteria | 6319 |
| 66 | Ga0070698_100155188 | 3300005471 | Bacteria | 2235 |
| 67 | Ga0070698_100343214 | 3300005471 | Unclassified | 1425 |
| 68 | Ga0070698_100494652 | 3300005471 | Unclassified | 1161 |
| 69 | Ga0070699_100000839 | 3300005518 | Bacteria | 28508 |
| 70 | Ga0070699_100004885 | 3300005518 | Bacteria | 11825 |
| 71 | Ga0070699_100017315 | 3300005518 | Bacteria | 6189 |
| 72 | Ga0070699_100077723 | 3300005518 | Unclassified | 2889 |
| 73 | Ga0070699_100170093 | 3300005518 | Unclassified | 1931 |
| 74 | Ga0070699_100308803 | 3300005518 | Unclassified | 1420 |
| 75 | Ga0070699_100630721 | 3300005518 | Unclassified | 978 |
| 76 | Ga0070679_100005008 | 3300005530 | Bacteria | 12225 |
| 77 | Ga0070684_100230965 | 3300005535 | Bacteria | 1689 |
| 78 | Ga0070697_100000775 | 3300005536 | Bacteria | 23943 |
| 79 | Ga0070697_100062418 | 3300005536 | Bacteria | 3041 |
| 80 | Ga0070697_100140799 | 3300005536 | Unclassified | 2029 |
| 81 | Ga0070697_100229080 | 3300005536 | Bacteria | 1585 |
| 82 | Ga0070697_100261161 | 3300005536 | Bacteria | 1483 |
| 83 | Ga0068853_100000111 | 3300005539 | Bacteria | 55607 |
| 84 | Ga0070672_100032643 | 3300005543 | Bacteria | 3932 |
| 85 | Ga0070686_100073578 | 3300005544 | Bacteria | 2244 |
| 86 | Ga0070695_100002386 | 3300005545 | Bacteria | 10791 |
| 87 | Ga0070695_100003048 | 3300005545 | Bacteria | 9749 |
| 88 | Ga0070695_100006201 | 3300005545 | Bacteria | 7061 |
| 89 | Ga0070695_100006878 | 3300005545 | Bacteria | 6736 |
| 90 | Ga0070695_100054611 | 3300005545 | Bacteria | 2572 |
| 91 | Ga0070695_100106111 | 3300005545 | Unclassified | 1899 |
| 92 | Ga0070695_100183636 | 3300005545 | Bacteria | 1484 |
| 93 | Ga0070696_100000218 | 3300005546 | Bacteria | 34544 |
| 94 | Ga0070696_100016744 | 3300005546 | Bacteria | 4944 |
| 95 | Ga0070696_100040370 | 3300005546 | Bacteria | 3222 |
| 96 | Ga0070696_100047398 | 3300005546 | Bacteria | 2982 |
| 97 | Ga0070696_100147022 | 3300005546 | Bacteria | 1727 |
| 98 | Ga0070696_100358820 | 3300005546 | Unclassified | 1130 |
| 99 | Ga0070693_100003071 | 3300005547 | Bacteria | 7748 |
| 100 | Ga0070704_100001454 | 3300005549 | Bacteria | 12701 |
| 101 | Ga0070704_100019155 | 3300005549 | Bacteria | 4393 |
| 102 | Ga0070704_100062208 | 3300005549 | Bacteria | 2674 |
| 103 | Ga0070704_100228557 | 3300005549 | Bacteria | 1516 |
| 104 | Ga0070704_100574394 | 3300005549 | Unclassified | 988 |
| 105 | Ga0068855_100000219 | 3300005563 | Bacteria | 72993 |
| 106 | Ga0070664_100004538 | 3300005564 | Bacteria | 11141 |
| 107 | Ga0068857_100009753 | 3300005577 | Bacteria | 8339 |
| 108 | Ga0068857_100039223 | 3300005577 | Bacteria | 4195 |
| 109 | Ga0068857_100065527 | 3300005577 | Bacteria | 3231 |
| 110 | Ga0068857_100143126 | 3300005577 | Unclassified | 2162 |
| 111 | Ga0068856_100013237 | 3300005614 | Bacteria | 7989 |
| 112 | Ga0070702_100002994 | 3300005615 | Bacteria | 7467 |
| 113 | Ga0068852_100074561 | 3300005616 | Bacteria | 2989 |
| 114 | Ga0068859_100024393 | 3300005617 | Bacteria | 6067 |
| 115 | Ga0068859_100093863 | 3300005617 | Bacteria | 3052 |
| 116 | Ga0068859_100226705 | 3300005617 | Unclassified | 1957 |
| 117 | Ga0068864_100006889 | 3300005618 | Bacteria | 9315 |
| 118 | Ga0068864_100234578 | 3300005618 | Bacteria | 1698 |
| 119 | Ga0068861_100046293 | 3300005719 | Bacteria | 3279 |
| 120 | Ga0068861_100293103 | 3300005719 | Unclassified | 1406 |
| 121 | Ga0068870_10001517 | 3300005840 | Bacteria | 9423 |
| 122 | Ga0068863_100017502 | 3300005841 | Bacteria | 6870 |
| 123 | Ga0068863_100662496 | 3300005841 | Unclassified | 1036 |
| 124 | Ga0068858_100009138 | 3300005842 | Bacteria | 9477 |
| 125 | Ga0068860_100005840 | 3300005843 | Bacteria | 12388 |
| 126 | Ga0068860_100067011 | 3300005843 | Bacteria | 3411 |
| 127 | Ga0068860_100097865 | 3300005843 | Bacteria | 2798 |
| 128 | Ga0068862_100001733 | 3300005844 | Bacteria | 19717 |
| 129 | Ga0068862_100086443 | 3300005844 | Bacteria | 2726 |
| 130 | Ga0068862_100299460 | 3300005844 | Bacteria | 1479 |
| 131 | Ga0068862_100387043 | 3300005844 | Bacteria | 1305 |
| 132 | Ga0081455_10000135 | 3300005937 | Bacteria | 87177 |
| 133 | Ga0081455_10002839 | 3300005937 | Bacteria | 20393 |
| 134 | Ga0081538_10015472 | 3300005981 | Bacteria | 5900 |
| 135 | Ga0081538_10052752 | 3300005981 | Bacteria | 2426 |
| 136 | Ga0081540_1017263 | 3300005983 | Bacteria | 4475 |
| 137 | Ga0081540_1025218 | 3300005983 | Bacteria | 3428 |
| 138 | Ga0081539_10000009 | 3300005985 | Bacteria | 509286 |
| 139 | Ga0075432_10031285 | 3300006058 | Bacteria | 1842 |
| 140 | Ga0075432_10039878 | 3300006058 | Bacteria | 1638 |
| 141 | Ga0070716_100273114 | 3300006173 | Bacteria | 1163 |
| 142 | Ga0075427_10007499 | 3300006194 | Bacteria | 1604 |
| 143 | Ga0075428_100000622 | 3300006844 | Bacteria | 36242 |
| 144 | Ga0075428_100008622 | 3300006844 | Bacteria | 11312 |
| 145 | Ga0075428_100010752 | 3300006844 | Bacteria | 10172 |
| 146 | Ga0075428_100019591 | 3300006844 | Bacteria | 7487 |
| 147 | Ga0075428_100032165 | 3300006844 | Bacteria | 5795 |
| 148 | Ga0075428_100052879 | 3300006844 | Bacteria | 4450 |
| 149 | Ga0075428_100124425 | 3300006844 | Bacteria | 2806 |
| 150 | Ga0075428_100170226 | 3300006844 | Bacteria | 2361 |
| 151 | Ga0075430_100000084 | 3300006846 | Bacteria | 53212 |
| 152 | Ga0075430_100000413 | 3300006846 | Bacteria | 31753 |
| 153 | Ga0075430_100023643 | 3300006846 | Bacteria | 5232 |
| 154 | Ga0075430_100185911 | 3300006846 | Unclassified | 1728 |
| 155 | Ga0075430_100514569 | 3300006846 | Unclassified | 988 |
| 156 | Ga0075431_100000186 | 3300006847 | Bacteria | 45028 |
| 157 | Ga0075431_100001279 | 3300006847 | Bacteria | 22945 |
| 158 | Ga0075431_100003814 | 3300006847 | Bacteria | 14657 |
| 159 | Ga0075431_100004150 | 3300006847 | Bacteria | 14149 |
| 160 | Ga0075431_100022898 | 3300006847 | Bacteria | 6386 |
| 161 | Ga0075431_100119363 | 3300006847 | Bacteria | 2721 |
| 162 | Ga0075431_100209782 | 3300006847 | Bacteria | 1990 |
| 163 | Ga0075431_100579467 | 3300006847 | Unclassified | 1107 |
| 164 | Ga0075431_100643973 | 3300006847 | Bacteria | 1041 |
| 165 | Ga0075433_10000798 | 3300006852 | Bacteria | 21838 |
| 166 | Ga0075433_10003625 | 3300006852 | Bacteria | 11929 |
| 167 | Ga0075433_10007973 | 3300006852 | Bacteria | 8432 |
| 168 | Ga0075433_10022248 | 3300006852 | Bacteria | 5320 |
| 169 | Ga0075433_10092238 | 3300006852 | Bacteria | 2679 |
| 170 | Ga0075433_10116927 | 3300006852 | Bacteria | 2366 |
| 171 | Ga0075433_10400686 | 3300006852 | Unclassified | 1211 |
| 172 | Ga0075433_10457400 | 3300006852 | Bacteria | 1125 |
| 173 | Ga0075434_100038742 | 3300006871 | Bacteria | 4722 |
| 174 | Ga0075434_100068184 | 3300006871 | Bacteria | 3543 |
| 175 | Ga0075434_100079248 | 3300006871 | Unclassified | 3281 |
| 176 | Ga0075434_100081663 | 3300006871 | Bacteria | 3230 |
| 177 | Ga0075434_100094006 | 3300006871 | Bacteria | 3002 |
| 178 | Ga0075434_100104411 | 3300006871 | Bacteria | 2843 |
| 179 | Ga0075434_100109398 | 3300006871 | Unclassified | 2774 |
| 180 | Ga0075434_100201599 | 3300006871 | Bacteria | 2010 |
| 181 | Ga0075434_100364165 | 3300006871 | Unclassified | 1467 |
| 182 | Ga0075434_100720127 | 3300006871 | Unclassified | 1015 |
| 183 | Ga0075434_100786849 | 3300006871 | Bacteria | 968 |
| 184 | Ga0075429_100000177 | 3300006880 | Bacteria | 41340 |
| 185 | Ga0075429_100002426 | 3300006880 | Bacteria | 15697 |
| 186 | Ga0075429_100007382 | 3300006880 | Bacteria | 9542 |
| 187 | Ga0075429_100011909 | 3300006880 | Bacteria | 7541 |
| 188 | Ga0075429_100038316 | 3300006880 | Bacteria | 4173 |
| 189 | Ga0075429_100081015 | 3300006880 | Bacteria | 2830 |
| 190 | Ga0075429_100087742 | 3300006880 | Bacteria | 2711 |
| 191 | Ga0075429_100335838 | 3300006880 | Unclassified | 1322 |
| 192 | Ga0075436_100004858 | 3300006914 | Bacteria | 9234 |
| 193 | Ga0075436_100083119 | 3300006914 | Bacteria | 2222 |
| 194 | Ga0097620_100024393 | 3300006931 | Bacteria | 6067 |
| 195 | Ga0097620_100093860 | 3300006931 | Bacteria | 3052 |
| 196 | Ga0097620_100226707 | 3300006931 | Unclassified | 1957 |
| 197 | Ga0075435_100032631 | 3300007076 | Bacteria | 4114 |
| 198 | Ga0075435_100060885 | 3300007076 | Unclassified | 3061 |
| 199 | Ga0075435_100108409 | 3300007076 | Unclassified | 2307 |
| 200 | Ga0075435_100364191 | 3300007076 | Unclassified | 1240 |
| 201 | Ga0099794_10026488 | 3300007265 | Bacteria | 2681 |
| 202 | Ga0105240_10342221 | 3300009093 | Bacteria | 1699 |
| 203 | Ga0111539_10006868 | 3300009094 | Bacteria | 14621 |
| 204 | Ga0111539_10032553 | 3300009094 | Bacteria | 6330 |
| 205 | Ga0111539_10065254 | 3300009094 | Bacteria | 4303 |
| 206 | Ga0105245_10343620 | 3300009098 | Unclassified | 1476 |
| 207 | Ga0105247_10423834 | 3300009101 | Unclassified | 953 |
| 208 | Ga0114129_10001251 | 3300009147 | Bacteria | 33869 |
| 209 | Ga0114129_10001591 | 3300009147 | Bacteria | 30832 |
| 210 | Ga0114129_10002356 | 3300009147 | Bacteria | 26214 |
| 211 | Ga0114129_10004666 | 3300009147 | Bacteria | 19349 |
| 212 | Ga0114129_10008480 | 3300009147 | Bacteria | 14644 |
| 213 | Ga0114129_10011734 | 3300009147 | Bacteria | 12468 |
| 214 | Ga0114129_10027822 | 3300009147 | Bacteria | 8007 |
| 215 | Ga0114129_10051151 | 3300009147 | Bacteria | 5802 |
| 216 | Ga0114129_10053512 | 3300009147 | Bacteria | 5661 |
| 217 | Ga0114129_10073705 | 3300009147 | Bacteria | 4756 |
| 218 | Ga0114129_10087073 | 3300009147 | Bacteria | 4332 |
| 219 | Ga0114129_10098999 | 3300009147 | Unclassified | 4036 |
| 220 | Ga0114129_10127803 | 3300009147 | Bacteria | 3493 |
| 221 | Ga0114129_10146544 | 3300009147 | Bacteria | 3234 |
| 222 | Ga0114129_10210627 | 3300009147 | Bacteria | 2628 |
| 223 | Ga0114129_10339557 | 3300009147 | Bacteria | 1992 |
| 224 | Ga0114129_10367601 | 3300009147 | Bacteria | 1902 |
| 225 | Ga0114129_10413606 | 3300009147 | Bacteria | 1775 |
| 226 | Ga0114129_10429290 | 3300009147 | Bacteria | 1736 |
| 227 | Ga0114129_10495692 | 3300009147 | Bacteria | 1596 |
| 228 | Ga0114129_10781564 | 3300009147 | Bacteria | 1220 |
| 229 | Ga0105243_10066059 | 3300009148 | Bacteria | 2908 |
| 230 | Ga0105243_10164784 | 3300009148 | Bacteria | 1914 |
| 231 | Ga0105243_10215301 | 3300009148 | Bacteria | 1694 |
| 232 | Ga0105241_10000389 | 3300009174 | Bacteria | 33246 |
| 233 | Ga0105241_10110350 | 3300009174 | Bacteria | 2201 |
| 234 | Ga0105242_10054429 | 3300009176 | Bacteria | 3270 |
| 235 | Ga0105242_10099335 | 3300009176 | Bacteria | 2464 |
| 236 | Ga0105242_10330497 | 3300009176 | Unclassified | 1401 |
| 237 | Ga0105248_10384784 | 3300009177 | Bacteria | 1580 |
| 238 | Ga0105249_10010302 | 3300009553 | Bacteria | 8212 |
| 239 | Ga0105249_10072424 | 3300009553 | Bacteria | 3185 |
| 240 | Ga0105249_10097311 | 3300009553 | Bacteria | 2762 |
| 241 | Ga0105249_10208998 | 3300009553 | Bacteria | 1914 |
| 242 | Ga0099796_10159475 | 3300010159 | Bacteria | 893 |
| 243 | Ga0105239_10141195 | 3300010375 | Unclassified | 2684 |
| 244 | Ga0157373_10002416 | 3300013100 | Bacteria | 14205 |
| 245 | Ga0157371_10296128 | 3300013102 | Bacteria | 1171 |
| 246 | Ga0157369_10007011 | 3300013105 | Bacteria | 13005 |
| 247 | Ga0157378_10613481 | 3300013297 | Bacteria | 1100 |
| 248 | Ga0157372_10001597 | 3300013307 | Bacteria | 24655 |
| 249 | Ga0157372_10410316 | 3300013307 | Unclassified | 1578 |
| 250 | Ga0157372_10462824 | 3300013307 | Bacteria | 1478 |
| 251 | Ga0157375_10127156 | 3300013308 | Bacteria | 2665 |
| 252 | Ga0157375_10153294 | 3300013308 | Bacteria | 2441 |
| 253 | Ga0157380_10221167 | 3300014326 | Bacteria | 1694 |
| 254 | Ga0182008_10048443 | 3300014497 | Bacteria | 2110 |
| 255 | Ga0157379_10107006 | 3300014968 | Unclassified | 2510 |
| 256 | Ga0182007_10033746 | 3300015262 | Bacteria | 1733 |
| 257 | Ga0207653_10041079 | 3300025885 | Bacteria | 1518 |
| 258 | Ga0207653_10054887 | 3300025885 | Bacteria | 1333 |
| 259 | Ga0207653_10090966 | 3300025885 | Unclassified | 1069 |
| 260 | Ga0207645_10004040 | 3300025907 | Bacteria | 10933 |
| 261 | Ga0207643_10001853 | 3300025908 | Bacteria | 11690 |
| 262 | Ga0207684_10000142 | 3300025910 | Bacteria | 127367 |
| 263 | Ga0207684_10008680 | 3300025910 | Bacteria | 9020 |
| 264 | Ga0207684_10029623 | 3300025910 | Bacteria | 4659 |
| 265 | Ga0207684_10044882 | 3300025910 | Bacteria | 3748 |
| 266 | Ga0207684_10060379 | 3300025910 | Bacteria | 3220 |
| 267 | Ga0207684_10249490 | 3300025910 | Unclassified | 1531 |
| 268 | Ga0207684_10253809 | 3300025910 | Bacteria | 1517 |
| 269 | Ga0207684_10510742 | 3300025910 | Bacteria | 1030 |
| 270 | Ga0207654_10001908 | 3300025911 | Bacteria | 10823 |
| 271 | Ga0207707_10000047 | 3300025912 | Bacteria | 118016 |
| 272 | Ga0207707_10080180 | 3300025912 | Bacteria | 2850 |
| 273 | Ga0207671_10325265 | 3300025914 | Bacteria | 1217 |
| 274 | Ga0207660_10002017 | 3300025917 | Bacteria | 13506 |
| 275 | Ga0207657_10000021 | 3300025919 | Bacteria | 155900 |
| 276 | Ga0207649_10001184 | 3300025920 | Bacteria | 15709 |
| 277 | Ga0207652_10000582 | 3300025921 | Bacteria | 36770 |
| 278 | Ga0207646_10000707 | 3300025922 | Bacteria | 43305 |
| 279 | Ga0207646_10005687 | 3300025922 | Bacteria | 13076 |
| 280 | Ga0207646_10012582 | 3300025922 | Bacteria | 8123 |
| 281 | Ga0207646_10013130 | 3300025922 | Bacteria | 7928 |
| 282 | Ga0207646_10087156 | 3300025922 | Bacteria | 2794 |
| 283 | Ga0207646_10169430 | 3300025922 | Unclassified | 1972 |
| 284 | Ga0207681_10033443 | 3300025923 | Bacteria | 3371 |
| 285 | Ga0207681_10037895 | 3300025923 | Bacteria | 3190 |
| 286 | Ga0207650_10066223 | 3300025925 | Bacteria | 2708 |
| 287 | Ga0207690_10002230 | 3300025932 | Bacteria | 11821 |
| 288 | Ga0207706_10001025 | 3300025933 | Bacteria | 28421 |
| 289 | Ga0207706_10066645 | 3300025933 | Bacteria | 3169 |
| 290 | Ga0207709_10058997 | 3300025935 | Bacteria | 2387 |
| 291 | Ga0207709_10172530 | 3300025935 | Unclassified | 1519 |
| 292 | Ga0207709_10181160 | 3300025935 | Bacteria | 1488 |
| 293 | Ga0207709_10447294 | 3300025935 | Bacteria | 998 |
| 294 | Ga0207670_10014933 | 3300025936 | Bacteria | 4625 |
| 295 | Ga0207704_10355646 | 3300025938 | Unclassified | 1142 |
| 296 | Ga0207665_10000411 | 3300025939 | Bacteria | 29470 |
| 297 | Ga0207691_10036803 | 3300025940 | Bacteria | 4534 |
| 298 | Ga0207691_10091900 | 3300025940 | Bacteria | 2718 |
| 299 | Ga0207711_10252582 | 3300025941 | Bacteria | 1619 |
| 300 | Ga0207711_10397573 | 3300025941 | Bacteria | 1280 |
| 301 | Ga0207711_10462085 | 3300025941 | Bacteria | 1182 |
| 302 | Ga0207689_10000616 | 3300025942 | Bacteria | 34010 |
| 303 | Ga0207689_10002819 | 3300025942 | Bacteria | 16059 |
| 304 | Ga0207689_10112492 | 3300025942 | Bacteria | 2238 |
| 305 | Ga0207661_10023923 | 3300025944 | Bacteria | 4622 |
| 306 | Ga0207679_10000824 | 3300025945 | Bacteria | 19931 |
| 307 | Ga0207667_10016902 | 3300025949 | Bacteria | 8231 |
| 308 | Ga0207651_10007271 | 3300025960 | Bacteria | 5887 |
| 309 | Ga0207712_10021224 | 3300025961 | Bacteria | 4262 |
| 310 | Ga0207668_10189932 | 3300025972 | Bacteria | 1627 |
| 311 | Ga0207658_10054437 | 3300025986 | Bacteria | 2961 |
| 312 | Ga0207677_10080291 | 3300026023 | Bacteria | 2336 |
| 313 | Ga0207703_10013453 | 3300026035 | Bacteria | 6374 |
| 314 | Ga0207678_10001854 | 3300026067 | Bacteria | 19324 |
| 315 | Ga0207708_10021974 | 3300026075 | Bacteria | 4816 |
| 316 | Ga0207708_10059379 | 3300026075 | Bacteria | 2919 |
| 317 | Ga0207702_10001000 | 3300026078 | Bacteria | 28999 |
| 318 | Ga0207641_10076652 | 3300026088 | Bacteria | 2891 |
| 319 | Ga0207641_10141481 | 3300026088 | Bacteria | 2171 |
| 320 | Ga0207641_10486144 | 3300026088 | Unclassified | 1197 |
| 321 | Ga0207641_10641025 | 3300026088 | Bacteria | 1043 |
| 322 | Ga0207648_10000527 | 3300026089 | Bacteria | 42832 |
| 323 | Ga0207648_10055585 | 3300026089 | Bacteria | 3455 |
| 324 | Ga0207648_10056805 | 3300026089 | Bacteria | 3415 |
| 325 | Ga0207674_10000137 | 3300026116 | Bacteria | 84955 |
| 326 | Ga0207674_10031104 | 3300026116 | Bacteria | 5608 |
| 327 | Ga0207674_10228024 | 3300026116 | Bacteria | 1811 |
| 328 | Ga0207675_100011157 | 3300026118 | Bacteria | 8416 |
| 329 | Ga0207675_100061062 | 3300026118 | Bacteria | 3519 |
| 330 | Ga0207675_100336727 | 3300026118 | Unclassified | 1476 |
| 331 | Ga0209967_1001962 | 3300027364 | Bacteria | 2651 |
| 332 | Ga0209995_1004026 | 3300027471 | Bacteria | 2347 |
| 333 | Ga0209968_1000700 | 3300027526 | Bacteria | 5164 |
| 334 | Ga0209999_1001286 | 3300027543 | Bacteria | 4302 |
| 335 | Ga0209983_1000027 | 3300027665 | Bacteria | 19821 |
| 336 | Ga0209983_1023019 | 3300027665 | Bacteria | 1308 |
| 337 | Ga0209588_1032028 | 3300027671 | Bacteria | 1683 |
| 338 | Ga0209971_1000018 | 3300027682 | Bacteria | 65254 |
| 339 | Ga0209966_1000065 | 3300027695 | Bacteria | 47123 |
| 340 | Ga0209998_10000062 | 3300027717 | Bacteria | 43841 |
| 341 | Ga0209974_10001726 | 3300027876 | Bacteria | 7930 |
| 342 | Ga0207428_10000063 | 3300027907 | Bacteria | 151868 |
| 343 | Ga0207428_10000091 | 3300027907 | Bacteria | 125388 |
| 344 | Ga0207428_10003665 | 3300027907 | Bacteria | 14806 |
| 345 | Ga0207428_10045574 | 3300027907 | Bacteria | 3531 |
| 346 | Ga0268265_10002646 | 3300028380 | Bacteria | 13295 |
| 347 | Ga0268265_10016987 | 3300028380 | Bacteria | 5011 |
| 348 | Ga0268265_10205035 | 3300028380 | Bacteria | 1713 |
| 349 | Ga0268264_10026943 | 3300028381 | Bacteria | 4695 |
| 350 | Ga0268264_10221724 | 3300028381 | Unclassified | 1741 |
| 351 | Ga0268264_10315107 | 3300028381 | Bacteria | 1477 |
| 352 | Ga0268264_10324915 | 3300028381 | Bacteria | 1456 |
| 353 | Ga0307408_100013810 | 3300031548 | Bacteria | 5362 |
| 354 | Ga0307408_100036511 | 3300031548 | Bacteria | 3455 |
| 355 | Ga0307408_100101178 | 3300031548 | Bacteria | 2196 |
| 356 | Ga0307408_100219922 | 3300031548 | Bacteria | 1549 |
| 357 | Ga0307410_10322965 | 3300031852 | Bacteria | 1225 |
| 358 | Ga0307412_10241231 | 3300031911 | Bacteria | 1398 |
| 359 | Ga0307412_10494883 | 3300031911 | Bacteria | 1017 |
| 360 | Ga0307409_100011687 | 3300031995 | Bacteria | 5551 |
| 361 | Ga0307416_100081288 | 3300032002 | Bacteria | 2739 |
| 362 | Ga0307416_100118413 | 3300032002 | Bacteria | 2353 |
| 363 | Ga0307416_100255626 | 3300032002 | Bacteria | 1708 |
| 364 | Ga0307411_10072930 | 3300032005 | Unclassified | 2333 |
| 365 | Ga0307415_100102638 | 3300032126 | Bacteria | 2102 |
| 366 | Ga0373948_0028014 | 3300034817 | Bacteria | 1119 |
| 367 | Ga0373928_0026731 | 3300035084 | Bacteria | 1252 |
| 368 | Ga0373940_0005357 | 3300035088 | Bacteria | 2773 |
| 369 | Ga0373940_0015849 | 3300035088 | Bacteria | 1859 |
| 370 | Ga0373949_0012267 | 3300035090 | Bacteria | 1894 |
| 371 | Ga0373951_0003891 | 3300035091 | Unclassified | 3591 |
| 372 | Ga0373941_0086623 | 3300035115 | Bacteria | 1067 |
| 373 | Ga0373960_0005528 | 3300035121 | Bacteria | 2933 |
| 374 | Ga0373961_0029397 | 3300035241 | Bacteria | 1522 |
| 375 | Ga0373931_0010670 | 3300035691 | Bacteria | 4420 |
| 376 | Ga0373931_0022659 | 3300035691 | Bacteria | 3163 |
| 377 | Ga0395899_0012934 | 3300037312 | Bacteria | 6388 |
| 378 | Ga0395900_0578402 | 3300037418 | Bacteria | 1065 |
| 379 | Ga0395900_0937371 | 3300037418 | Unclassified | 788 |
| 380 | Ga0395901_0004330 | 3300038443 | Bacteria | 14322 |
| 381 | Ga0439448_0000780 | 3300042005 | Bacteria | 7719 |
| 382 | Ga0439450_009005 | 3300042008 | Bacteria | 1881 |
| 383 | Ga0439458_0006551 | 3300042157 | Bacteria | 2596 |
| 384 | Ga0439435_0041144 | 3300042436 | Unclassified | 1294 |
| 385 | Ga0439459_0002895 | 3300042438 | Unclassified | 2684 |
| 386 | Ga0439464_0002668 | 3300042439 | Bacteria | 4419 |
| 387 | Ga0439460_0001847 | 3300042461 | Bacteria | 5050 |
| 388 | Ga0451577_0003104 | 3300042876 | Bacteria | 18729 |
| 389 | Ga0451577_0007817 | 3300042876 | Bacteria | 10462 |
| 390 | Ga0451577_0058541 | 3300042876 | Bacteria | 3435 |
| 391 | Ga0453683_0043823 | 3300044673 | Bacteria | 2808 |
| 392 | Ga0453683_0049017 | 3300044673 | Unclassified | 2648 |
| 393 | Ga0466963_0329001 | 3300044694 | Bacteria | 1076 |
| 394 | Ga0453684_0008557 | 3300044712 | Bacteria | 18260 |
| 395 | Ga0453684_0608707 | 3300044712 | Bacteria | 1196 |
| 396 | Ga0451576_0002399 | 3300045051 | Bacteria | 28145 |
| 397 | Ga0451576_0021495 | 3300045051 | Bacteria | 7013 |
| 398 | Ga0451576_0339585 | 3300045051 | Bacteria | 1572 |
| 399 | Ga0495580_0001249 | 3300046472 | Bacteria | 22435 |
| 400 | Ga0495580_0105796 | 3300046472 | Bacteria | 1955 |
| 401 | Ga0495621_0106510 | 3300046539 | Unclassified | 1072 |
| 402 | Ga0496102_0022019 | 3300048905 | Bacteria | 5645 |
| 403 | Ga0496102_0060756 | 3300048905 | Bacteria | 3457 |
| 404 | Ga0496102_0344222 | 3300048905 | Unclassified | 1404 |
| 405 | Ga0496106_0295288 | 3300048909 | Bacteria | 1299 |
| 406 | Ga0496109_0535772 | 3300048912 | Archaea | 1105 |
| 407 | Ga0496112_0459056 | 3300048915 | Bacteria | 1211 |
| 408 | Ga0501033_0135872 | 3300049570 | Bacteria | 1779 |
| 409 | Ga0501033_0203817 | 3300049570 | Bacteria | 1412 |
| 410 | Ga0501034_0416699 | 3300049571 | Bacteria | 1265 |
| 411 | Ga0501036_0021990 | 3300049572 | Bacteria | 5363 |
| 412 | Ga0501037_0016149 | 3300049573 | Bacteria | 5495 |
| 413 | Ga0501038_0009653 | 3300049574 | Bacteria | 8852 |
| 414 | Ga0501038_0192388 | 3300049574 | Bacteria | 1641 |
| 415 | Ga0501038_0209605 | 3300049574 | Unclassified | 1560 |
| 416 | Ga0501038_0340697 | 3300049574 | Bacteria | 1169 |
| 417 | Ga0501039_0034041 | 3300049575 | Bacteria | 3931 |
| 418 | Ga0501039_0036902 | 3300049575 | Bacteria | 3771 |
| 419 | Ga0501039_0477218 | 3300049575 | Unclassified | 979 |
| 420 | Ga0501040_0003584 | 3300049576 | Bacteria | 10044 |
| 421 | Ga0501040_0012409 | 3300049576 | Bacteria | 5582 |
| 422 | Ga0501040_0032102 | 3300049576 | Bacteria | 3552 |
| 423 | Ga0501040_0032963 | 3300049576 | Bacteria | 3507 |
| 424 | Ga0501040_0082439 | 3300049576 | Bacteria | 2230 |
| 425 | Ga0501040_0276422 | 3300049576 | Unclassified | 1199 |
| 426 | Ga0501041_0085073 | 3300049577 | Bacteria | 1949 |
| 427 | Ga0501041_0095569 | 3300049577 | Unclassified | 1837 |
| 428 | Ga0501041_0199745 | 3300049577 | Bacteria | 1253 |
| 429 | Ga0501042_0010230 | 3300049578 | Bacteria | 6279 |
| 430 | Ga0501046_0000473 | 3300049580 | Bacteria | 40255 |
| 431 | Ga0501047_0072889 | 3300049581 | Bacteria | 3306 |
| 432 | Ga0501048_0006631 | 3300049582 | Bacteria | 8798 |
| 433 | Ga0501048_0031393 | 3300049582 | Bacteria | 3842 |
| 434 | Ga0501048_0087546 | 3300049582 | Bacteria | 2197 |
| 435 | Ga0501048_0181442 | 3300049582 | Bacteria | 1492 |
| 436 | Ga0501068_0168278 | 3300049584 | Bacteria | 1382 |
| 437 | Ga0501068_0299872 | 3300049584 | Bacteria | 1029 |
| 438 | Ga0501069_0007526 | 3300049585 | Bacteria | 5718 |
| 439 | Ga0501071_0038579 | 3300049587 | Bacteria | 3414 |
| 440 | Ga0501071_0062831 | 3300049587 | Bacteria | 2691 |
| 441 | Ga0501071_0101948 | 3300049587 | Bacteria | 2116 |
| 442 | Ga0501072_0003706 | 3300049588 | Bacteria | 11527 |
| 443 | Ga0501072_0003793 | 3300049588 | Bacteria | 11409 |
| 444 | Ga0501072_0012712 | 3300049588 | Bacteria | 6437 |
| 445 | Ga0501072_0062699 | 3300049588 | Bacteria | 2932 |
| 446 | Ga0501072_0128431 | 3300049588 | Bacteria | 2020 |
| 447 | Ga0501072_0156886 | 3300049588 | Bacteria | 1815 |
| 448 | Ga0501072_0228955 | 3300049588 | Unclassified | 1481 |
| 449 | Ga0501072_0232956 | 3300049588 | Bacteria | 1467 |
| 450 | Ga0501073_0091786 | 3300049589 | Bacteria | 2111 |
| 451 | Ga0501074_0012067 | 3300049590 | Bacteria | 6278 |
| 452 | Ga0501074_0113450 | 3300049590 | Bacteria | 1939 |
| 453 | Ga0501074_0116245 | 3300049590 | Bacteria | 1914 |
| 454 | Ga0501075_0000078 | 3300049591 | Bacteria | 43796 |
| 455 | Ga0501075_0020298 | 3300049591 | Bacteria | 4831 |
| 456 | Ga0501075_0036012 | 3300049591 | Bacteria | 3692 |
| 457 | Ga0501075_0067008 | 3300049591 | Bacteria | 2710 |
| 458 | Ga0501075_0082426 | 3300049591 | Bacteria | 2436 |
| 459 | Ga0501075_0131730 | 3300049591 | Unclassified | 1905 |
| 460 | Ga0501075_0181966 | 3300049591 | Unclassified | 1603 |
| 461 | Ga0501076_0000002 | 3300049592 | Bacteria | 165396 |
| 462 | Ga0501076_0033398 | 3300049592 | Bacteria | 4017 |
| 463 | Ga0501076_0043538 | 3300049592 | Bacteria | 3538 |
| 464 | Ga0501076_0191628 | 3300049592 | Bacteria | 1668 |
| 465 | Ga0501076_0206903 | 3300049592 | Bacteria | 1603 |
| 466 | Ga0501077_0003957 | 3300049593 | Bacteria | 8933 |
| 467 | Ga0501077_0004194 | 3300049593 | Bacteria | 8711 |
| 468 | Ga0501077_0084628 | 3300049593 | Bacteria | 2010 |
| 469 | Ga0501077_0139250 | 3300049593 | Bacteria | 1539 |
| 470 | Ga0501079_0001001 | 3300049741 | Bacteria | 19537 |
| 471 | Ga0501079_0009405 | 3300049741 | Bacteria | 7408 |
| 472 | Ga0501079_0009589 | 3300049741 | Bacteria | 7342 |
| 473 | Ga0501079_0011736 | 3300049741 | Bacteria | 6692 |
| 474 | Ga0501079_0065232 | 3300049741 | Bacteria | 2809 |
| 475 | Ga0501079_0076743 | 3300049741 | Bacteria | 2584 |
| 476 | Ga0501079_0120103 | 3300049741 | Bacteria | 2044 |
| 477 | Ga0501080_0128698 | 3300049742 | Bacteria | 2344 |
| 478 | Ga0501080_0174192 | 3300049742 | Bacteria | 1983 |
| 479 | Ga0501080_0211510 | 3300049742 | Unclassified | 1777 |
| 480 | Ga0501081_0002207 | 3300049743 | Bacteria | 12249 |
| 481 | Ga0501081_0002835 | 3300049743 | Bacteria | 11003 |
| 482 | Ga0501081_0010886 | 3300049743 | Bacteria | 5945 |
| 483 | Ga0501081_0019617 | 3300049743 | Bacteria | 4504 |
| 484 | Ga0501081_0094918 | 3300049743 | Unclassified | 2102 |
| 485 | Ga0501081_0133071 | 3300049743 | Bacteria | 1778 |
| 486 | Ga0501081_0135820 | 3300049743 | Bacteria | 1760 |
| 487 | Ga0501083_0355428 | 3300049744 | Bacteria | 952 |
| 488 | Ga0501035_0099556 | 3300049822 | Unclassified | 2552 |
| 489 | Ga0501035_0255056 | 3300049822 | Bacteria | 1488 |
| 490 | Ga0501045_0044535 | 3300049824 | Bacteria | 3233 |
| 491 | Ga0501045_0055251 | 3300049824 | Bacteria | 2904 |
| 492 | Ga0501045_0058952 | 3300049824 | Bacteria | 2812 |
| 493 | Ga0501045_0189016 | 3300049824 | Unclassified | 1535 |
| 494 | nmdc:mga05p37_10791_c1 | 3300050507 | Bacteria | 10845 |
| 495 | nmdc:mga05p37_12334_c1 | 3300050507 | Bacteria | 10207 |
| 496 | nmdc:mga05p37_1316_c1 | 3300050507 | Bacteria | 28895 |
| 497 | nmdc:mga05p37_157286_c1 | 3300050507 | Bacteria | 2777 |
| 498 | nmdc:mga05p37_166852_c1 | 3300050507 | Unclassified | 2687 |
| 499 | nmdc:mga05p37_1819_c1 | 3300050507 | Bacteria | 24861 |
| 500 | nmdc:mga05p37_202854_c1 | 3300050507 | Bacteria | 2400 |
| 501 | nmdc:mga05p37_2113_c1 | 3300050507 | Bacteria | 23219 |
| 502 | nmdc:mga05p37_263652_c1 | 3300050507 | Bacteria | 2061 |
| 503 | nmdc:mga05p37_2942_c1 | 3300050507 | Bacteria | 19772 |
| 504 | nmdc:mga05p37_323810_c1 | 3300050507 | Bacteria | 1823 |
| 505 | nmdc:mga05p37_326212_c1 | 3300050507 | Bacteria | 1815 |
| 506 | nmdc:mga05p37_359102_c1 | 3300050507 | Unclassified | 1713 |
| 507 | nmdc:mga05p37_39095_c1 | 3300050507 | Bacteria | 5821 |
| 508 | nmdc:mga05p37_466472_c1 | 3300050507 | Bacteria | 1458 |
| 509 | nmdc:mga05p37_57800_c1 | 3300050507 | Bacteria | 4777 |
| 510 | nmdc:mga05p37_65063_c1 | 3300050507 | Bacteria | 4487 |
| 511 | nmdc:mga05p37_732208_c1 | 3300050507 | Bacteria | 1093 |
| 512 | nmdc:mga09592_26622_c1 | 3300050508 | Bacteria | 4793 |
| 513 | nmdc:mga09592_321770_c1 | 3300050508 | Unclassified | 1340 |
| 514 | nmdc:mga09592_445_c1 | 3300050508 | Bacteria | 30603 |
| 515 | nmdc:mga09592_47270_c1 | 3300050508 | Bacteria | 3627 |
| 516 | nmdc:mga09592_57122_c1 | 3300050508 | Bacteria | 3298 |
| 517 | nmdc:mga09592_68296_c1 | 3300050508 | Bacteria | 3015 |
| 518 | nmdc:mga0qj67_226562_c1 | 3300050509 | Bacteria | 1517 |
| 519 | nmdc:mga0qj67_2851_c1 | 3300050509 | Bacteria | 12395 |
| 520 | nmdc:mga0qj67_421_c1 | 3300050509 | Bacteria | 28998 |
| 521 | nmdc:mga06r32_1003_c1 | 3300050510 | Bacteria | 25310 |
| 522 | nmdc:mga06r32_114585_c1 | 3300050510 | Bacteria | 2654 |
| 523 | nmdc:mga06r32_12854_c1 | 3300050510 | Bacteria | 7568 |
| 524 | nmdc:mga06r32_1509_c1 | 3300050510 | Bacteria | 20920 |
| 525 | nmdc:mga06r32_15708_c1 | 3300050510 | Bacteria | 6880 |
| 526 | nmdc:mga06r32_19194_c1 | 3300050510 | Bacteria | 6274 |
| 527 | nmdc:mga06r32_26091_c1 | 3300050510 | Bacteria | 5444 |
| 528 | nmdc:mga06r32_288307_c1 | 3300050510 | Bacteria | 1628 |
| 529 | nmdc:mga06r32_3250_c1 | 3300050510 | Bacteria | 14539 |
| 530 | nmdc:mga06r32_541946_c1 | 3300050510 | Unclassified | 1138 |
| 531 | nmdc:mga06r32_5805_c1 | 3300050510 | Bacteria | 11124 |
| 532 | nmdc:mga08y16_121152_c1 | 3300050511 | Bacteria | 2722 |
| 533 | nmdc:mga08y16_24788_c1 | 3300050511 | Bacteria | 6330 |
| 534 | nmdc:mga08y16_4347_c1 | 3300050511 | Bacteria | 14805 |
| 535 | nmdc:mga08y16_54210_c1 | 3300050511 | Bacteria | 4190 |
| 536 | nmdc:mga08y16_60331_c1 | 3300050511 | Bacteria | 3962 |
| 537 | nmdc:mga08y16_63096_c1 | 3300050511 | Bacteria | 3869 |
| 538 | nmdc:mga08y16_7638_c1 | 3300050511 | Bacteria | 11316 |
| 539 | nmdc:mga0n895_1185_c1 | 3300050512 | Bacteria | 19167 |
| 540 | nmdc:mga0n895_134553_c1 | 3300050512 | Bacteria | 2498 |
| 541 | nmdc:mga0n895_21841_c1 | 3300050512 | Bacteria | 5992 |
| 542 | nmdc:mga0n895_222693_c1 | 3300050512 | Bacteria | 1915 |
| 543 | nmdc:mga0n895_286269_c1 | 3300050512 | Bacteria | 1671 |
| 544 | nmdc:mga0n895_30687_c1 | 3300050512 | Bacteria | 5140 |
| 545 | nmdc:mga0n895_33153_c1 | 3300050512 | Bacteria | 4962 |
| 546 | nmdc:mga0n895_43046_c1 | 3300050512 | Bacteria | 4398 |
| 547 | nmdc:mga0n895_44545_c1 | 3300050512 | Bacteria | 4327 |
| 548 | nmdc:mga0n895_55177_c1 | 3300050512 | Bacteria | 3910 |
| 549 | nmdc:mga0n895_66999_c1 | 3300050512 | Bacteria | 3555 |
| 550 | nmdc:mga0n895_736561_c1 | 3300050512 | Unclassified | 980 |
| 551 | nmdc:mga0rr50_102393_c1 | 3300050513 | Unclassified | 2253 |
| 552 | nmdc:mga0rr50_221737_c1 | 3300050513 | Bacteria | 1562 |
| 553 | nmdc:mga0rr50_4128_c1 | 3300050513 | Bacteria | 8491 |
| 554 | nmdc:mga0rr50_48289_c1 | 3300050513 | Bacteria | 3146 |
| 555 | nmdc:mga0a205_110300_c1 | 3300050515 | Bacteria | 2650 |
| 556 | nmdc:mga0a205_137776_c1 | 3300050515 | Unclassified | 2341 |
| 557 | nmdc:mga0a205_15565_c1 | 3300050515 | Bacteria | 7108 |
| 558 | nmdc:mga0a205_176647_c1 | 3300050515 | Bacteria | 2031 |
| 559 | nmdc:mga0a205_184531_c1 | 3300050515 | Unclassified | 1980 |
| 560 | nmdc:mga0a205_24902_c1 | 3300050515 | Bacteria | 5696 |
| 561 | nmdc:mga0a205_33930_c1 | 3300050515 | Bacteria | 4895 |
| 562 | nmdc:mga0a205_4127_c1 | 3300050515 | Bacteria | 12999 |
| 563 | nmdc:mga0a205_71069_c1 | 3300050515 | Bacteria | 3361 |
| 564 | nmdc:mga0a205_82419_c1 | 3300050515 | Bacteria | 3107 |
| 565 | nmdc:mga0a205_8887_c1 | 3300050515 | Bacteria | 9155 |
| 566 | Ga0501084_0003242 | 3300054114 | Bacteria | 13175 |
| 567 | Ga0501084_0004703 | 3300054114 | Bacteria | 11151 |
| 568 | Ga0501084_0038164 | 3300054114 | Bacteria | 4015 |
| 569 | Ga0501084_0046600 | 3300054114 | Bacteria | 3632 |
| 570 | Ga0501084_0055603 | 3300054114 | Bacteria | 3311 |
| 571 | Ga0501084_0080133 | 3300054114 | Unclassified | 2738 |
| 572 | Ga0501084_0398482 | 3300054114 | Bacteria | 1163 |
| 573 | Ga0501084_0590734 | 3300054114 | Bacteria | 938 |
| 574 | Ga0501082_0000407 | 3300060353 | Bacteria | 38099 |
| 575 | Ga0501082_0022243 | 3300060353 | Bacteria | 5464 |
| 576 | Ga0501082_0026311 | 3300060353 | Bacteria | 5013 |
| 577 | Ga0501082_0063909 | 3300060353 | Bacteria | 3169 |
| 578 | Ga0501082_0214454 | 3300060353 | Bacteria | 1675 |
| 579 | Ga0530510_0000024 | 3300061734 | Bacteria | 68684 |
| 580 | Ga0530510_0000913 | 3300061734 | Bacteria | 19483 |
| 581 | Ga0530510_0019693 | 3300061734 | Bacteria | 4792 |
| 582 | Ga0530510_0055748 | 3300061734 | Bacteria | 2855 |
| 583 | Ga0530510_0081553 | 3300061734 | Bacteria | 2355 |
| 584 | Ga0530510_0197904 | 3300061734 | Bacteria | 1492 |
| 585 | Ga0530510_0510891 | 3300061734 | Bacteria | 911 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0937371 | Ga0395900_0937371_88_777 | 228 |
| 2 | 3300006871 | Ga0075434_100786849 | Ga0075434_1007868492 | 254 |
| 3 | 3300026088 | Ga0207641_10641025 | Ga0207641_106410251 | 263 |
| 4 | 3300005577 | Ga0068857_100143126 | Ga0068857_1001431262 | 265 |
| 5 | 3300026116 | Ga0207674_10228024 | Ga0207674_102280241 | 265 |
| 6 | 3300031548 | Ga0307408_100036511 | Ga0307408_1000365113 | 268 |
| 7 | 3300032002 | Ga0307416_100081288 | Ga0307416_1000812883 | 268 |
| 8 | 3300032005 | Ga0307411_10072930 | Ga0307411_100729302 | 268 |
| 9 | 3300006871 | Ga0075434_100720127 | Ga0075434_1007201271 | 269 |
| 10 | 3300049585 | Ga0501069_0007526 | Ga0501069_0007526_975_1790 | 269 |
| 11 | 3300006871 | Ga0075434_100079248 | Ga0075434_1000792482 | 275 |
| 12 | 3300005445 | Ga0070708_100088101 | Ga0070708_1000881011 | 278 |
| 13 | 3300005467 | Ga0070706_100299887 | Ga0070706_1002998872 | 278 |
| 14 | 3300005468 | Ga0070707_100045690 | Ga0070707_1000456904 | 278 |
| 15 | 3300005518 | Ga0070699_100077723 | Ga0070699_1000777233 | 278 |
| 16 | 3300005518 | Ga0070699_100630721 | Ga0070699_1006307211 | 278 |
| 17 | 3300005543 | Ga0070672_100032643 | Ga0070672_1000326432 | 278 |
| 18 | 3300005546 | Ga0070696_100016744 | Ga0070696_1000167445 | 278 |
| 19 | 3300005546 | Ga0070696_100047398 | Ga0070696_1000473983 | 278 |
| 20 | 3300005546 | Ga0070696_100147022 | Ga0070696_1001470222 | 278 |
| 21 | 3300005549 | Ga0070704_100019155 | Ga0070704_1000191554 | 278 |
| 22 | 3300005549 | Ga0070704_100574394 | Ga0070704_1005743941 | 278 |
| 23 | 3300005719 | Ga0068861_100046293 | Ga0068861_1000462932 | 278 |
| 24 | 3300005719 | Ga0068861_100293103 | Ga0068861_1002931031 | 278 |
| 25 | 3300005843 | Ga0068860_100097865 | Ga0068860_1000978654 | 278 |
| 26 | 3300006844 | Ga0075428_100008622 | Ga0075428_1000086228 | 278 |
| 27 | 3300006846 | Ga0075430_100023643 | Ga0075430_1000236431 | 278 |
| 28 | 3300006847 | Ga0075431_100209782 | Ga0075431_1002097823 | 278 |
| 29 | 3300006847 | Ga0075431_100643973 | Ga0075431_1006439732 | 278 |
| 30 | 3300006880 | Ga0075429_100081015 | Ga0075429_1000810154 | 278 |
| 31 | 3300009094 | Ga0111539_10032553 | Ga0111539_100325534 | 278 |
| 32 | 3300009147 | Ga0114129_10781564 | Ga0114129_107815641 | 278 |
| 33 | 3300009177 | Ga0105248_10384784 | Ga0105248_103847842 | 278 |
| 34 | 3300013308 | Ga0157375_10153294 | Ga0157375_101532943 | 278 |
| 35 | 3300025923 | Ga0207681_10033443 | Ga0207681_100334432 | 278 |
| 36 | 3300025935 | Ga0207709_10172530 | Ga0207709_101725302 | 278 |
| 37 | 3300025940 | Ga0207691_10091900 | Ga0207691_100919002 | 278 |
| 38 | 3300025941 | Ga0207711_10462085 | Ga0207711_104620851 | 278 |
| 39 | 3300025972 | Ga0207668_10189932 | Ga0207668_101899322 | 278 |
| 40 | 3300026118 | Ga0207675_100061062 | Ga0207675_1000610622 | 278 |
| 41 | 3300026118 | Ga0207675_100336727 | Ga0207675_1003367272 | 278 |
| 42 | 3300027907 | Ga0207428_10045574 | Ga0207428_100455743 | 278 |
| 43 | 3300028381 | Ga0268264_10324915 | Ga0268264_103249152 | 278 |
| 44 | 3300031548 | Ga0307408_100101178 | Ga0307408_1001011784 | 278 |
| 45 | 3300031548 | Ga0307408_100219922 | Ga0307408_1002199221 | 278 |
| 46 | 3300031995 | Ga0307409_100011687 | Ga0307409_1000116873 | 278 |
| 47 | 3300032002 | Ga0307416_100255626 | Ga0307416_1002556261 | 278 |
| 48 | 3300046472 | Ga0495580_0105796 | Ga0495580_0105796_1042_1878 | 278 |
| 49 | 3300046539 | Ga0495621_0106510 | Ga0495621_0106510_12_848 | 278 |
| 50 | 3300049571 | Ga0501034_0416699 | Ga0501034_0416699_83_937 | 278 |
| 51 | 3300049576 | Ga0501040_0012409 | Ga0501040_0012409_4075_4911 | 278 |
| 52 | 3300049576 | Ga0501040_0032963 | Ga0501040_0032963_2032_2868 | 278 |
| 53 | 3300049577 | Ga0501041_0199745 | Ga0501041_0199745_64_900 | 278 |
| 54 | 3300049582 | Ga0501048_0087546 | Ga0501048_0087546_176_1012 | 278 |
| 55 | 3300049587 | Ga0501071_0062831 | Ga0501071_0062831_182_1018 | 278 |
| 56 | 3300049588 | Ga0501072_0012712 | Ga0501072_0012712_3426_4262 | 278 |
| 57 | 3300049588 | Ga0501072_0156886 | Ga0501072_0156886_866_1702 | 278 |
| 58 | 3300049588 | Ga0501072_0232956 | Ga0501072_0232956_239_1075 | 278 |
| 59 | 3300049590 | Ga0501074_0116245 | Ga0501074_0116245_513_1349 | 278 |
| 60 | 3300049591 | Ga0501075_0020298 | Ga0501075_0020298_3665_4501 | 278 |
| 61 | 3300049591 | Ga0501075_0036012 | Ga0501075_0036012_1799_2635 | 278 |
| 62 | 3300049592 | Ga0501076_0033398 | Ga0501076_0033398_1565_2401 | 278 |
| 63 | 3300049592 | Ga0501076_0206903 | Ga0501076_0206903_279_1115 | 278 |
| 64 | 3300049593 | Ga0501077_0003957 | Ga0501077_0003957_4169_5005 | 278 |
| 65 | 3300049593 | Ga0501077_0139250 | Ga0501077_0139250_399_1235 | 278 |
| 66 | 3300049741 | Ga0501079_0009405 | Ga0501079_0009405_4787_5623 | 278 |
| 67 | 3300049741 | Ga0501079_0011736 | Ga0501079_0011736_5846_6682 | 278 |
| 68 | 3300049742 | Ga0501080_0174192 | Ga0501080_0174192_350_1186 | 278 |
| 69 | 3300049743 | Ga0501081_0010886 | Ga0501081_0010886_3362_4198 | 278 |
| 70 | 3300049743 | Ga0501081_0019617 | Ga0501081_0019617_100_936 | 278 |
| 71 | 3300049743 | Ga0501081_0133071 | Ga0501081_0133071_857_1693 | 278 |
| 72 | 3300049824 | Ga0501045_0189016 | Ga0501045_0189016_314_1150 | 278 |
| 73 | 3300050507 | nmdc:mga05p37_466472_c1 | nmdc:mga05p37_466472_c1_474_1316 | 278 |
| 74 | 3300050507 | nmdc:mga05p37_732208_c1 | nmdc:mga05p37_732208_c1_164_1000 | 278 |
| 75 | 3300050510 | nmdc:mga06r32_12854_c1 | nmdc:mga06r32_12854_c1_4828_5664 | 278 |
| 76 | 3300050510 | nmdc:mga06r32_288307_c1 | nmdc:mga06r32_288307_c1_615_1451 | 278 |
| 77 | 3300050511 | nmdc:mga08y16_24788_c1 | nmdc:mga08y16_24788_c1_3283_4119 | 278 |
| 78 | 3300054114 | Ga0501084_0046600 | Ga0501084_0046600_2156_2992 | 278 |
| 79 | 3300054114 | Ga0501084_0055603 | Ga0501084_0055603_996_1832 | 278 |
| 80 | 3300060353 | Ga0501082_0026311 | Ga0501082_0026311_2448_3284 | 278 |
| 81 | 3300060353 | Ga0501082_0063909 | Ga0501082_0063909_1956_2792 | 278 |
| 82 | 3300060353 | Ga0501082_0214454 | Ga0501082_0214454_306_1142 | 278 |
| 83 | 3300061734 | Ga0530510_0081553 | Ga0530510_0081553_152_988 | 278 |
| 84 | 3300003503 | JGI26141J51220_1000549 | JGI26141J51220_10005493 | 279 |
| 85 | 3300004798 | Ga0058859_10715401 | Ga0058859_107154011 | 279 |
| 86 | 3300004801 | Ga0058860_11434841 | Ga0058860_114348412 | 279 |
| 87 | 3300005293 | Ga0065715_10310122 | Ga0065715_103101221 | 279 |
| 88 | 3300005328 | Ga0070676_10004841 | Ga0070676_100048415 | 279 |
| 89 | 3300005329 | Ga0070683_100346544 | Ga0070683_1003465442 | 279 |
| 90 | 3300005330 | Ga0070690_100012799 | Ga0070690_1000127997 | 279 |
| 91 | 3300005331 | Ga0070670_100010918 | Ga0070670_1000109187 | 279 |
| 92 | 3300005333 | Ga0070677_10032626 | Ga0070677_100326262 | 279 |
| 93 | 3300005334 | Ga0068869_100004848 | Ga0068869_1000048488 | 279 |
| 94 | 3300005334 | Ga0068869_100007099 | Ga0068869_1000070992 | 279 |
| 95 | 3300005334 | Ga0068869_100109819 | Ga0068869_1001098192 | 279 |
| 96 | 3300005336 | Ga0070680_100049024 | Ga0070680_1000490244 | 279 |
| 97 | 3300005337 | Ga0070682_100000416 | Ga0070682_10000041624 | 279 |
| 98 | 3300005339 | Ga0070660_100000083 | Ga0070660_10000008337 | 279 |
| 99 | 3300005341 | Ga0070691_10006575 | Ga0070691_100065754 | 279 |
| 100 | 3300005341 | Ga0070691_10012905 | Ga0070691_100129052 | 279 |
| 101 | 3300005341 | Ga0070691_10020985 | Ga0070691_100209852 | 279 |
| 102 | 3300005341 | Ga0070691_10140875 | Ga0070691_101408752 | 279 |
| 103 | 3300005344 | Ga0070661_100000403 | Ga0070661_10000040329 | 279 |
| 104 | 3300005345 | Ga0070692_10265290 | Ga0070692_102652901 | 279 |
| 105 | 3300005353 | Ga0070669_100062878 | Ga0070669_1000628784 | 279 |
| 106 | 3300005364 | Ga0070673_100004405 | Ga0070673_1000044053 | 279 |
| 107 | 3300005365 | Ga0070688_100166189 | Ga0070688_1001661892 | 279 |
| 108 | 3300005366 | Ga0070659_100005267 | Ga0070659_1000052676 | 279 |
| 109 | 3300005367 | Ga0070667_100097355 | Ga0070667_1000973553 | 279 |
| 110 | 3300005406 | Ga0070703_10035063 | Ga0070703_100350632 | 279 |
| 111 | 3300005406 | Ga0070703_10055642 | Ga0070703_100556421 | 279 |
| 112 | 3300005438 | Ga0070701_10062815 | Ga0070701_100628152 | 279 |
| 113 | 3300005440 | Ga0070705_100001037 | Ga0070705_1000010376 | 279 |
| 114 | 3300005440 | Ga0070705_100050177 | Ga0070705_1000501772 | 279 |
| 115 | 3300005440 | Ga0070705_100068458 | Ga0070705_1000684582 | 279 |
| 116 | 3300005440 | Ga0070705_100089873 | Ga0070705_1000898732 | 279 |
| 117 | 3300005441 | Ga0070700_100012818 | Ga0070700_1000128182 | 279 |
| 118 | 3300005441 | Ga0070700_100034282 | Ga0070700_1000342824 | 279 |
| 119 | 3300005441 | Ga0070700_100347217 | Ga0070700_1003472171 | 279 |
| 120 | 3300005444 | Ga0070694_100000219 | Ga0070694_10000021918 | 279 |
| 121 | 3300005444 | Ga0070694_100001050 | Ga0070694_10000105013 | 279 |
| 122 | 3300005444 | Ga0070694_100011718 | Ga0070694_1000117182 | 279 |
| 123 | 3300005444 | Ga0070694_100015160 | Ga0070694_1000151606 | 279 |
| 124 | 3300005445 | Ga0070708_100004339 | Ga0070708_1000043393 | 279 |
| 125 | 3300005445 | Ga0070708_100013850 | Ga0070708_1000138507 | 279 |
| 126 | 3300005445 | Ga0070708_100054517 | Ga0070708_1000545171 | 279 |
| 127 | 3300005455 | Ga0070663_100022346 | Ga0070663_1000223465 | 279 |
| 128 | 3300005457 | Ga0070662_100046425 | Ga0070662_1000464254 | 279 |
| 129 | 3300005458 | Ga0070681_10001393 | Ga0070681_100013935 | 279 |
| 130 | 3300005458 | Ga0070681_10091070 | Ga0070681_100910701 | 279 |
| 131 | 3300005459 | Ga0068867_100006130 | Ga0068867_1000061302 | 279 |
| 132 | 3300005459 | Ga0068867_100053167 | Ga0068867_1000531674 | 279 |
| 133 | 3300005467 | Ga0070706_100019070 | Ga0070706_1000190702 | 279 |
| 134 | 3300005467 | Ga0070706_100210470 | Ga0070706_1002104701 | 279 |
| 135 | 3300005467 | Ga0070706_100211962 | Ga0070706_1002119622 | 279 |
| 136 | 3300005467 | Ga0070706_100263742 | Ga0070706_1002637422 | 279 |
| 137 | 3300005467 | Ga0070706_100527273 | Ga0070706_1005272732 | 279 |
| 138 | 3300005468 | Ga0070707_100010295 | Ga0070707_1000102953 | 279 |
| 139 | 3300005468 | Ga0070707_100014099 | Ga0070707_1000140998 | 279 |
| 140 | 3300005468 | Ga0070707_100014511 | Ga0070707_1000145112 | 279 |
| 141 | 3300005468 | Ga0070707_100249720 | Ga0070707_1002497203 | 279 |
| 142 | 3300005468 | Ga0070707_100296322 | Ga0070707_1002963221 | 279 |
| 143 | 3300005471 | Ga0070698_100004982 | Ga0070698_1000049822 | 279 |
| 144 | 3300005471 | Ga0070698_100012986 | Ga0070698_1000129866 | 279 |
| 145 | 3300005471 | Ga0070698_100024328 | Ga0070698_1000243282 | 279 |
| 146 | 3300005471 | Ga0070698_100155188 | Ga0070698_1001551881 | 279 |
| 147 | 3300005471 | Ga0070698_100343214 | Ga0070698_1003432141 | 279 |
| 148 | 3300005471 | Ga0070698_100494652 | Ga0070698_1004946521 | 279 |
| 149 | 3300005518 | Ga0070699_100000839 | Ga0070699_10000083942 | 279 |
| 150 | 3300005518 | Ga0070699_100004885 | Ga0070699_1000048856 | 279 |
| 151 | 3300005518 | Ga0070699_100017315 | Ga0070699_1000173154 | 279 |
| 152 | 3300005518 | Ga0070699_100170093 | Ga0070699_1001700932 | 279 |
| 153 | 3300005518 | Ga0070699_100308803 | Ga0070699_1003088032 | 279 |
| 154 | 3300005530 | Ga0070679_100005008 | Ga0070679_10000500811 | 279 |
| 155 | 3300005535 | Ga0070684_100230965 | Ga0070684_1002309652 | 279 |
| 156 | 3300005536 | Ga0070697_100000775 | Ga0070697_10000077518 | 279 |
| 157 | 3300005536 | Ga0070697_100062418 | Ga0070697_1000624182 | 279 |
| 158 | 3300005536 | Ga0070697_100140799 | Ga0070697_1001407993 | 279 |
| 159 | 3300005536 | Ga0070697_100229080 | Ga0070697_1002290801 | 279 |
| 160 | 3300005536 | Ga0070697_100261161 | Ga0070697_1002611612 | 279 |
| 161 | 3300005539 | Ga0068853_100000111 | Ga0068853_1000001116 | 279 |
| 162 | 3300005544 | Ga0070686_100073578 | Ga0070686_1000735782 | 279 |
| 163 | 3300005545 | Ga0070695_100002386 | Ga0070695_10000238611 | 279 |
| 164 | 3300005545 | Ga0070695_100003048 | Ga0070695_10000304815 | 279 |
| 165 | 3300005545 | Ga0070695_100006201 | Ga0070695_1000062013 | 279 |
| 166 | 3300005545 | Ga0070695_100006878 | Ga0070695_1000068782 | 279 |
| 167 | 3300005545 | Ga0070695_100054611 | Ga0070695_1000546112 | 279 |
| 168 | 3300005545 | Ga0070695_100106111 | Ga0070695_1001061112 | 279 |
| 169 | 3300005545 | Ga0070695_100183636 | Ga0070695_1001836361 | 279 |
| 170 | 3300005546 | Ga0070696_100000218 | Ga0070696_10000021814 | 279 |
| 171 | 3300005546 | Ga0070696_100040370 | Ga0070696_1000403704 | 279 |
| 172 | 3300005546 | Ga0070696_100358820 | Ga0070696_1003588201 | 279 |
| 173 | 3300005547 | Ga0070693_100003071 | Ga0070693_1000030717 | 279 |
| 174 | 3300005549 | Ga0070704_100001454 | Ga0070704_1000014546 | 279 |
| 175 | 3300005549 | Ga0070704_100062208 | Ga0070704_1000622083 | 279 |
| 176 | 3300005549 | Ga0070704_100228557 | Ga0070704_1002285572 | 279 |
| 177 | 3300005563 | Ga0068855_100000219 | Ga0068855_10000021925 | 279 |
| 178 | 3300005564 | Ga0070664_100004538 | Ga0070664_1000045389 | 279 |
| 179 | 3300005577 | Ga0068857_100009753 | Ga0068857_1000097534 | 279 |
| 180 | 3300005577 | Ga0068857_100039223 | Ga0068857_1000392232 | 279 |
| 181 | 3300005577 | Ga0068857_100065527 | Ga0068857_1000655272 | 279 |
| 182 | 3300005614 | Ga0068856_100013237 | Ga0068856_1000132377 | 279 |
| 183 | 3300005615 | Ga0070702_100002994 | Ga0070702_1000029948 | 279 |
| 184 | 3300005616 | Ga0068852_100074561 | Ga0068852_1000745613 | 279 |
| 185 | 3300005617 | Ga0068859_100024393 | Ga0068859_1000243937 | 279 |
| 186 | 3300005617 | Ga0068859_100093863 | Ga0068859_1000938632 | 279 |
| 187 | 3300005617 | Ga0068859_100226705 | Ga0068859_1002267052 | 279 |
| 188 | 3300005618 | Ga0068864_100006889 | Ga0068864_10000688915 | 279 |
| 189 | 3300005618 | Ga0068864_100234578 | Ga0068864_1002345783 | 279 |
| 190 | 3300005840 | Ga0068870_10001517 | Ga0068870_1000151714 | 279 |
| 191 | 3300005841 | Ga0068863_100017502 | Ga0068863_1000175023 | 279 |
| 192 | 3300005841 | Ga0068863_100662496 | Ga0068863_1006624961 | 279 |
| 193 | 3300005842 | Ga0068858_100009138 | Ga0068858_1000091384 | 279 |
| 194 | 3300005843 | Ga0068860_100005840 | Ga0068860_1000058405 | 279 |
| 195 | 3300005843 | Ga0068860_100067011 | Ga0068860_1000670113 | 279 |
| 196 | 3300005844 | Ga0068862_100001733 | Ga0068862_10000173320 | 279 |
| 197 | 3300005844 | Ga0068862_100086443 | Ga0068862_1000864432 | 279 |
| 198 | 3300005844 | Ga0068862_100299460 | Ga0068862_1002994602 | 279 |
| 199 | 3300005844 | Ga0068862_100387043 | Ga0068862_1003870432 | 279 |
| 200 | 3300005937 | Ga0081455_10000135 | Ga0081455_1000013544 | 279 |
| 201 | 3300005937 | Ga0081455_10002839 | Ga0081455_1000283919 | 279 |
| 202 | 3300005981 | Ga0081538_10015472 | Ga0081538_100154723 | 279 |
| 203 | 3300005981 | Ga0081538_10052752 | Ga0081538_100527522 | 279 |
| 204 | 3300005983 | Ga0081540_1017263 | Ga0081540_10172633 | 279 |
| 205 | 3300005983 | Ga0081540_1025218 | Ga0081540_10252183 | 279 |
| 206 | 3300005985 | Ga0081539_10000009 | Ga0081539_10000009343 | 279 |
| 207 | 3300006058 | Ga0075432_10031285 | Ga0075432_100312852 | 279 |
| 208 | 3300006058 | Ga0075432_10039878 | Ga0075432_100398782 | 279 |
| 209 | 3300006173 | Ga0070716_100273114 | Ga0070716_1002731142 | 279 |
| 210 | 3300006194 | Ga0075427_10007499 | Ga0075427_100074992 | 279 |
| 211 | 3300006844 | Ga0075428_100000622 | Ga0075428_10000062211 | 279 |
| 212 | 3300006844 | Ga0075428_100010752 | Ga0075428_10001075211 | 279 |
| 213 | 3300006844 | Ga0075428_100019591 | Ga0075428_1000195916 | 279 |
| 214 | 3300006844 | Ga0075428_100032165 | Ga0075428_1000321655 | 279 |
| 215 | 3300006844 | Ga0075428_100052879 | Ga0075428_1000528792 | 279 |
| 216 | 3300006844 | Ga0075428_100124425 | Ga0075428_1001244253 | 279 |
| 217 | 3300006844 | Ga0075428_100170226 | Ga0075428_1001702262 | 279 |
| 218 | 3300006846 | Ga0075430_100000084 | Ga0075430_10000008429 | 279 |
| 219 | 3300006846 | Ga0075430_100000413 | Ga0075430_10000041325 | 279 |
| 220 | 3300006846 | Ga0075430_100185911 | Ga0075430_1001859113 | 279 |
| 221 | 3300006846 | Ga0075430_100514569 | Ga0075430_1005145691 | 279 |
| 222 | 3300006847 | Ga0075431_100000186 | Ga0075431_10000018646 | 279 |
| 223 | 3300006847 | Ga0075431_100001279 | Ga0075431_10000127915 | 279 |
| 224 | 3300006847 | Ga0075431_100003814 | Ga0075431_10000381414 | 279 |
| 225 | 3300006847 | Ga0075431_100004150 | Ga0075431_1000041505 | 279 |
| 226 | 3300006847 | Ga0075431_100022898 | Ga0075431_1000228985 | 279 |
| 227 | 3300006847 | Ga0075431_100119363 | Ga0075431_1001193632 | 279 |
| 228 | 3300006847 | Ga0075431_100579467 | Ga0075431_1005794671 | 279 |
| 229 | 3300006852 | Ga0075433_10000798 | Ga0075433_100007984 | 279 |
| 230 | 3300006852 | Ga0075433_10003625 | Ga0075433_100036256 | 279 |
| 231 | 3300006852 | Ga0075433_10007973 | Ga0075433_100079732 | 279 |
| 232 | 3300006852 | Ga0075433_10022248 | Ga0075433_100222486 | 279 |
| 233 | 3300006852 | Ga0075433_10092238 | Ga0075433_100922382 | 279 |
| 234 | 3300006852 | Ga0075433_10116927 | Ga0075433_101169272 | 279 |
| 235 | 3300006852 | Ga0075433_10400686 | Ga0075433_104006862 | 279 |
| 236 | 3300006852 | Ga0075433_10457400 | Ga0075433_104574001 | 279 |
| 237 | 3300006871 | Ga0075434_100038742 | Ga0075434_1000387425 | 279 |
| 238 | 3300006871 | Ga0075434_100068184 | Ga0075434_1000681845 | 279 |
| 239 | 3300006871 | Ga0075434_100081663 | Ga0075434_1000816632 | 279 |
| 240 | 3300006871 | Ga0075434_100094006 | Ga0075434_1000940063 | 279 |
| 241 | 3300006871 | Ga0075434_100104411 | Ga0075434_1001044112 | 279 |
| 242 | 3300006871 | Ga0075434_100109398 | Ga0075434_1001093983 | 279 |
| 243 | 3300006871 | Ga0075434_100201599 | Ga0075434_1002015991 | 279 |
| 244 | 3300006871 | Ga0075434_100364165 | Ga0075434_1003641652 | 279 |
| 245 | 3300006880 | Ga0075429_100000177 | Ga0075429_10000017737 | 279 |
| 246 | 3300006880 | Ga0075429_100002426 | Ga0075429_1000024267 | 279 |
| 247 | 3300006880 | Ga0075429_100007382 | Ga0075429_1000073829 | 279 |
| 248 | 3300006880 | Ga0075429_100011909 | Ga0075429_1000119092 | 279 |
| 249 | 3300006880 | Ga0075429_100038316 | Ga0075429_1000383163 | 279 |
| 250 | 3300006880 | Ga0075429_100087742 | Ga0075429_1000877424 | 279 |
| 251 | 3300006880 | Ga0075429_100335838 | Ga0075429_1003358383 | 279 |
| 252 | 3300006914 | Ga0075436_100004858 | Ga0075436_1000048583 | 279 |
| 253 | 3300006914 | Ga0075436_100083119 | Ga0075436_1000831192 | 279 |
| 254 | 3300006931 | Ga0097620_100024393 | Ga0097620_1000243937 | 279 |
| 255 | 3300006931 | Ga0097620_100093860 | Ga0097620_1000938602 | 279 |
| 256 | 3300006931 | Ga0097620_100226707 | Ga0097620_1002267072 | 279 |
| 257 | 3300007076 | Ga0075435_100032631 | Ga0075435_1000326316 | 279 |
| 258 | 3300007076 | Ga0075435_100060885 | Ga0075435_1000608852 | 279 |
| 259 | 3300007076 | Ga0075435_100108409 | Ga0075435_1001084093 | 279 |
| 260 | 3300007076 | Ga0075435_100364191 | Ga0075435_1003641912 | 279 |
| 261 | 3300007265 | Ga0099794_10026488 | Ga0099794_100264882 | 279 |
| 262 | 3300009093 | Ga0105240_10342221 | Ga0105240_103422212 | 279 |
| 263 | 3300009094 | Ga0111539_10006868 | Ga0111539_100068683 | 279 |
| 264 | 3300009094 | Ga0111539_10065254 | Ga0111539_100652543 | 279 |
| 265 | 3300009098 | Ga0105245_10343620 | Ga0105245_103436202 | 279 |
| 266 | 3300009101 | Ga0105247_10423834 | Ga0105247_104238341 | 279 |
| 267 | 3300009147 | Ga0114129_10001251 | Ga0114129_100012515 | 279 |
| 268 | 3300009147 | Ga0114129_10001591 | Ga0114129_1000159113 | 279 |
| 269 | 3300009147 | Ga0114129_10002356 | Ga0114129_1000235615 | 279 |
| 270 | 3300009147 | Ga0114129_10004666 | Ga0114129_100046665 | 279 |
| 271 | 3300009147 | Ga0114129_10008480 | Ga0114129_100084805 | 279 |
| 272 | 3300009147 | Ga0114129_10011734 | Ga0114129_100117344 | 279 |
| 273 | 3300009147 | Ga0114129_10027822 | Ga0114129_100278222 | 279 |
| 274 | 3300009147 | Ga0114129_10051151 | Ga0114129_100511512 | 279 |
| 275 | 3300009147 | Ga0114129_10053512 | Ga0114129_100535125 | 279 |
| 276 | 3300009147 | Ga0114129_10073705 | Ga0114129_100737053 | 279 |
| 277 | 3300009147 | Ga0114129_10087073 | Ga0114129_100870733 | 279 |
| 278 | 3300009147 | Ga0114129_10098999 | Ga0114129_100989995 | 279 |
| 279 | 3300009147 | Ga0114129_10127803 | Ga0114129_101278034 | 279 |
| 280 | 3300009147 | Ga0114129_10146544 | Ga0114129_101465442 | 279 |
| 281 | 3300009147 | Ga0114129_10210627 | Ga0114129_102106274 | 279 |
| 282 | 3300009147 | Ga0114129_10339557 | Ga0114129_103395572 | 279 |
| 283 | 3300009147 | Ga0114129_10367601 | Ga0114129_103676012 | 279 |
| 284 | 3300009147 | Ga0114129_10413606 | Ga0114129_104136062 | 279 |
| 285 | 3300009147 | Ga0114129_10429290 | Ga0114129_104292902 | 279 |
| 286 | 3300009147 | Ga0114129_10495692 | Ga0114129_104956922 | 279 |
| 287 | 3300009148 | Ga0105243_10066059 | Ga0105243_100660593 | 279 |
| 288 | 3300009148 | Ga0105243_10164784 | Ga0105243_101647842 | 279 |
| 289 | 3300009148 | Ga0105243_10215301 | Ga0105243_102153012 | 279 |
| 290 | 3300009174 | Ga0105241_10000389 | Ga0105241_1000038930 | 279 |
| 291 | 3300009174 | Ga0105241_10110350 | Ga0105241_101103502 | 279 |
| 292 | 3300009176 | Ga0105242_10054429 | Ga0105242_100544292 | 279 |
| 293 | 3300009176 | Ga0105242_10099335 | Ga0105242_100993354 | 279 |
| 294 | 3300009176 | Ga0105242_10330497 | Ga0105242_103304972 | 279 |
| 295 | 3300009553 | Ga0105249_10010302 | Ga0105249_100103028 | 279 |
| 296 | 3300009553 | Ga0105249_10072424 | Ga0105249_100724241 | 279 |
| 297 | 3300009553 | Ga0105249_10097311 | Ga0105249_100973112 | 279 |
| 298 | 3300009553 | Ga0105249_10208998 | Ga0105249_102089981 | 279 |
| 299 | 3300010159 | Ga0099796_10159475 | Ga0099796_101594751 | 279 |
| 300 | 3300010375 | Ga0105239_10141195 | Ga0105239_101411953 | 279 |
| 301 | 3300013100 | Ga0157373_10002416 | Ga0157373_100024168 | 279 |
| 302 | 3300013102 | Ga0157371_10296128 | Ga0157371_102961281 | 279 |
| 303 | 3300013105 | Ga0157369_10007011 | Ga0157369_100070112 | 279 |
| 304 | 3300013297 | Ga0157378_10613481 | Ga0157378_106134811 | 279 |
| 305 | 3300013307 | Ga0157372_10001597 | Ga0157372_100015975 | 279 |
| 306 | 3300013307 | Ga0157372_10410316 | Ga0157372_104103161 | 279 |
| 307 | 3300013307 | Ga0157372_10462824 | Ga0157372_104628242 | 279 |
| 308 | 3300013308 | Ga0157375_10127156 | Ga0157375_101271563 | 279 |
| 309 | 3300014326 | Ga0157380_10221167 | Ga0157380_102211672 | 279 |
| 310 | 3300014497 | Ga0182008_10048443 | Ga0182008_100484432 | 279 |
| 311 | 3300014968 | Ga0157379_10107006 | Ga0157379_101070062 | 279 |
| 312 | 3300015262 | Ga0182007_10033746 | Ga0182007_100337462 | 279 |
| 313 | 3300025885 | Ga0207653_10041079 | Ga0207653_100410792 | 279 |
| 314 | 3300025885 | Ga0207653_10054887 | Ga0207653_100548872 | 279 |
| 315 | 3300025885 | Ga0207653_10090966 | Ga0207653_100909662 | 279 |
| 316 | 3300025907 | Ga0207645_10004040 | Ga0207645_100040407 | 279 |
| 317 | 3300025908 | Ga0207643_10001853 | Ga0207643_100018537 | 279 |
| 318 | 3300025910 | Ga0207684_10000142 | Ga0207684_1000014229 | 279 |
| 319 | 3300025910 | Ga0207684_10008680 | Ga0207684_100086801 | 279 |
| 320 | 3300025910 | Ga0207684_10029623 | Ga0207684_100296232 | 279 |
| 321 | 3300025910 | Ga0207684_10044882 | Ga0207684_100448823 | 279 |
| 322 | 3300025910 | Ga0207684_10060379 | Ga0207684_100603794 | 279 |
| 323 | 3300025910 | Ga0207684_10249490 | Ga0207684_102494902 | 279 |
| 324 | 3300025910 | Ga0207684_10253809 | Ga0207684_102538092 | 279 |
| 325 | 3300025910 | Ga0207684_10510742 | Ga0207684_105107421 | 279 |
| 326 | 3300025911 | Ga0207654_10001908 | Ga0207654_100019086 | 279 |
| 327 | 3300025912 | Ga0207707_10000047 | Ga0207707_1000004789 | 279 |
| 328 | 3300025912 | Ga0207707_10080180 | Ga0207707_100801802 | 279 |
| 329 | 3300025914 | Ga0207671_10325265 | Ga0207671_103252652 | 279 |
| 330 | 3300025917 | Ga0207660_10002017 | Ga0207660_100020174 | 279 |
| 331 | 3300025919 | Ga0207657_10000021 | Ga0207657_1000002143 | 279 |
| 332 | 3300025920 | Ga0207649_10001184 | Ga0207649_100011847 | 279 |
| 333 | 3300025921 | Ga0207652_10000582 | Ga0207652_1000058234 | 279 |
| 334 | 3300025922 | Ga0207646_10000707 | Ga0207646_1000070714 | 279 |
| 335 | 3300025922 | Ga0207646_10005687 | Ga0207646_100056879 | 279 |
| 336 | 3300025922 | Ga0207646_10012582 | Ga0207646_100125829 | 279 |
| 337 | 3300025922 | Ga0207646_10013130 | Ga0207646_100131306 | 279 |
| 338 | 3300025922 | Ga0207646_10087156 | Ga0207646_100871561 | 279 |
| 339 | 3300025922 | Ga0207646_10169430 | Ga0207646_101694303 | 279 |
| 340 | 3300025923 | Ga0207681_10037895 | Ga0207681_100378954 | 279 |
| 341 | 3300025925 | Ga0207650_10066223 | Ga0207650_100662233 | 279 |
| 342 | 3300025932 | Ga0207690_10002230 | Ga0207690_1000223013 | 279 |
| 343 | 3300025933 | Ga0207706_10001025 | Ga0207706_100010251 | 279 |
| 344 | 3300025933 | Ga0207706_10066645 | Ga0207706_100666452 | 279 |
| 345 | 3300025935 | Ga0207709_10058997 | Ga0207709_100589972 | 279 |
| 346 | 3300025935 | Ga0207709_10181160 | Ga0207709_101811602 | 279 |
| 347 | 3300025935 | Ga0207709_10447294 | Ga0207709_104472941 | 279 |
| 348 | 3300025936 | Ga0207670_10014933 | Ga0207670_100149333 | 279 |
| 349 | 3300025938 | Ga0207704_10355646 | Ga0207704_103556462 | 279 |
| 350 | 3300025939 | Ga0207665_10000411 | Ga0207665_100004117 | 279 |
| 351 | 3300025940 | Ga0207691_10036803 | Ga0207691_100368032 | 279 |
| 352 | 3300025941 | Ga0207711_10252582 | Ga0207711_102525821 | 279 |
| 353 | 3300025941 | Ga0207711_10397573 | Ga0207711_103975732 | 279 |
| 354 | 3300025942 | Ga0207689_10000616 | Ga0207689_1000061621 | 279 |
| 355 | 3300025942 | Ga0207689_10002819 | Ga0207689_1000281919 | 279 |
| 356 | 3300025942 | Ga0207689_10112492 | Ga0207689_101124922 | 279 |
| 357 | 3300025944 | Ga0207661_10023923 | Ga0207661_100239232 | 279 |
| 358 | 3300025945 | Ga0207679_10000824 | Ga0207679_1000082417 | 279 |
| 359 | 3300025949 | Ga0207667_10016902 | Ga0207667_100169023 | 279 |
| 360 | 3300025960 | Ga0207651_10007271 | Ga0207651_100072717 | 279 |
| 361 | 3300025961 | Ga0207712_10021224 | Ga0207712_100212245 | 279 |
| 362 | 3300025986 | Ga0207658_10054437 | Ga0207658_100544373 | 279 |
| 363 | 3300026023 | Ga0207677_10080291 | Ga0207677_100802913 | 279 |
| 364 | 3300026035 | Ga0207703_10013453 | Ga0207703_1001345310 | 279 |
| 365 | 3300026067 | Ga0207678_10001854 | Ga0207678_1000185416 | 279 |
| 366 | 3300026075 | Ga0207708_10021974 | Ga0207708_100219745 | 279 |
| 367 | 3300026075 | Ga0207708_10059379 | Ga0207708_100593792 | 279 |
| 368 | 3300026078 | Ga0207702_10001000 | Ga0207702_1000100032 | 279 |
| 369 | 3300026088 | Ga0207641_10076652 | Ga0207641_100766523 | 279 |
| 370 | 3300026088 | Ga0207641_10141481 | Ga0207641_101414811 | 279 |
| 371 | 3300026088 | Ga0207641_10486144 | Ga0207641_104861441 | 279 |
| 372 | 3300026089 | Ga0207648_10000527 | Ga0207648_1000052740 | 279 |
| 373 | 3300026089 | Ga0207648_10055585 | Ga0207648_100555853 | 279 |
| 374 | 3300026089 | Ga0207648_10056805 | Ga0207648_100568054 | 279 |
| 375 | 3300026116 | Ga0207674_10000137 | Ga0207674_1000013764 | 279 |
| 376 | 3300026116 | Ga0207674_10031104 | Ga0207674_100311046 | 279 |
| 377 | 3300026118 | Ga0207675_100011157 | Ga0207675_1000111575 | 279 |
| 378 | 3300027364 | Ga0209967_1001962 | Ga0209967_10019622 | 279 |
| 379 | 3300027471 | Ga0209995_1004026 | Ga0209995_10040262 | 279 |
| 380 | 3300027526 | Ga0209968_1000700 | Ga0209968_10007004 | 279 |
| 381 | 3300027543 | Ga0209999_1001286 | Ga0209999_10012862 | 279 |
| 382 | 3300027665 | Ga0209983_1000027 | Ga0209983_10000273 | 279 |
| 383 | 3300027665 | Ga0209983_1023019 | Ga0209983_10230192 | 279 |
| 384 | 3300027671 | Ga0209588_1032028 | Ga0209588_10320281 | 279 |
| 385 | 3300027682 | Ga0209971_1000018 | Ga0209971_100001822 | 279 |
| 386 | 3300027695 | Ga0209966_1000065 | Ga0209966_100006512 | 279 |
| 387 | 3300027717 | Ga0209998_10000062 | Ga0209998_1000006233 | 279 |
| 388 | 3300027876 | Ga0209974_10001726 | Ga0209974_100017267 | 279 |
| 389 | 3300027907 | Ga0207428_10000063 | Ga0207428_1000006348 | 279 |
| 390 | 3300027907 | Ga0207428_10000091 | Ga0207428_1000009126 | 279 |
| 391 | 3300027907 | Ga0207428_10003665 | Ga0207428_1000366515 | 279 |
| 392 | 3300028380 | Ga0268265_10002646 | Ga0268265_1000264616 | 279 |
| 393 | 3300028380 | Ga0268265_10016987 | Ga0268265_100169877 | 279 |
| 394 | 3300028380 | Ga0268265_10205035 | Ga0268265_102050352 | 279 |
| 395 | 3300028381 | Ga0268264_10026943 | Ga0268264_100269432 | 279 |
| 396 | 3300028381 | Ga0268264_10221724 | Ga0268264_102217243 | 279 |
| 397 | 3300028381 | Ga0268264_10315107 | Ga0268264_103151071 | 279 |
| 398 | 3300031548 | Ga0307408_100013810 | Ga0307408_1000138102 | 279 |
| 399 | 3300031852 | Ga0307410_10322965 | Ga0307410_103229652 | 279 |
| 400 | 3300031911 | Ga0307412_10241231 | Ga0307412_102412311 | 279 |
| 401 | 3300031911 | Ga0307412_10494883 | Ga0307412_104948832 | 279 |
| 402 | 3300032002 | Ga0307416_100118413 | Ga0307416_1001184134 | 279 |
| 403 | 3300032126 | Ga0307415_100102638 | Ga0307415_1001026381 | 279 |
| 404 | 3300034817 | Ga0373948_0028014 | Ga0373948_0028014_238_1077 | 279 |
| 405 | 3300035084 | Ga0373928_0026731 | Ga0373928_0026731_350_1189 | 279 |
| 406 | 3300035088 | Ga0373940_0005357 | Ga0373940_0005357_434_1279 | 279 |
| 407 | 3300035088 | Ga0373940_0015849 | Ga0373940_0015849_753_1592 | 279 |
| 408 | 3300035090 | Ga0373949_0012267 | Ga0373949_0012267_849_1694 | 279 |
| 409 | 3300035091 | Ga0373951_0003891 | Ga0373951_0003891_2669_3508 | 279 |
| 410 | 3300035115 | Ga0373941_0086623 | Ga0373941_0086623_111_950 | 279 |
| 411 | 3300035121 | Ga0373960_0005528 | Ga0373960_0005528_1072_1911 | 279 |
| 412 | 3300035241 | Ga0373961_0029397 | Ga0373961_0029397_12_857 | 279 |
| 413 | 3300035691 | Ga0373931_0010670 | Ga0373931_0010670_153_998 | 279 |
| 414 | 3300035691 | Ga0373931_0022659 | Ga0373931_0022659_415_1254 | 279 |
| 415 | 3300037312 | Ga0395899_0012934 | Ga0395899_0012934_3075_3914 | 279 |
| 416 | 3300037418 | Ga0395900_0578402 | Ga0395900_0578402_60_905 | 279 |
| 417 | 3300038443 | Ga0395901_0004330 | Ga0395901_0004330_13119_13958 | 279 |
| 418 | 3300042005 | Ga0439448_0000780 | Ga0439448_0000780_5001_5840 | 279 |
| 419 | 3300042008 | Ga0439450_009005 | Ga0439450_009005_428_1267 | 279 |
| 420 | 3300042157 | Ga0439458_0006551 | Ga0439458_0006551_1519_2358 | 279 |
| 421 | 3300042436 | Ga0439435_0041144 | Ga0439435_0041144_149_997 | 279 |
| 422 | 3300042438 | Ga0439459_0002895 | Ga0439459_0002895_52_891 | 279 |
| 423 | 3300042439 | Ga0439464_0002668 | Ga0439464_0002668_857_1696 | 279 |
| 424 | 3300042461 | Ga0439460_0001847 | Ga0439460_0001847_2130_2969 | 279 |
| 425 | 3300042876 | Ga0451577_0003104 | Ga0451577_0003104_10737_11594 | 279 |
| 426 | 3300042876 | Ga0451577_0007817 | Ga0451577_0007817_574_1413 | 279 |
| 427 | 3300042876 | Ga0451577_0058541 | Ga0451577_0058541_98_937 | 279 |
| 428 | 3300044673 | Ga0453683_0043823 | Ga0453683_0043823_817_1656 | 279 |
| 429 | 3300044673 | Ga0453683_0049017 | Ga0453683_0049017_1212_2069 | 279 |
| 430 | 3300044694 | Ga0466963_0329001 | Ga0466963_0329001_128_970 | 279 |
| 431 | 3300044712 | Ga0453684_0008557 | Ga0453684_0008557_12661_13518 | 279 |
| 432 | 3300044712 | Ga0453684_0608707 | Ga0453684_0608707_294_1133 | 279 |
| 433 | 3300045051 | Ga0451576_0002399 | Ga0451576_0002399_17824_18663 | 279 |
| 434 | 3300045051 | Ga0451576_0021495 | Ga0451576_0021495_1625_2464 | 279 |
| 435 | 3300045051 | Ga0451576_0339585 | Ga0451576_0339585_716_1555 | 279 |
| 436 | 3300046472 | Ga0495580_0001249 | Ga0495580_0001249_14083_14922 | 279 |
| 437 | 3300048905 | Ga0496102_0022019 | Ga0496102_0022019_3200_4039 | 279 |
| 438 | 3300048905 | Ga0496102_0060756 | Ga0496102_0060756_1653_2492 | 279 |
| 439 | 3300048905 | Ga0496102_0344222 | Ga0496102_0344222_400_1242 | 279 |
| 440 | 3300048909 | Ga0496106_0295288 | Ga0496106_0295288_20_859 | 279 |
| 441 | 3300048912 | Ga0496109_0535772 | Ga0496109_0535772_238_1080 | 279 |
| 442 | 3300048915 | Ga0496112_0459056 | Ga0496112_0459056_51_890 | 279 |
| 443 | 3300049570 | Ga0501033_0135872 | Ga0501033_0135872_111_950 | 279 |
| 444 | 3300049570 | Ga0501033_0203817 | Ga0501033_0203817_82_924 | 279 |
| 445 | 3300049572 | Ga0501036_0021990 | Ga0501036_0021990_2054_2896 | 279 |
| 446 | 3300049573 | Ga0501037_0016149 | Ga0501037_0016149_2264_3103 | 279 |
| 447 | 3300049574 | Ga0501038_0009653 | Ga0501038_0009653_2485_3327 | 279 |
| 448 | 3300049574 | Ga0501038_0192388 | Ga0501038_0192388_751_1590 | 279 |
| 449 | 3300049574 | Ga0501038_0209605 | Ga0501038_0209605_292_1137 | 279 |
| 450 | 3300049574 | Ga0501038_0340697 | Ga0501038_0340697_307_1146 | 279 |
| 451 | 3300049575 | Ga0501039_0034041 | Ga0501039_0034041_2245_3087 | 279 |
| 452 | 3300049575 | Ga0501039_0036902 | Ga0501039_0036902_2333_3172 | 279 |
| 453 | 3300049575 | Ga0501039_0477218 | Ga0501039_0477218_30_875 | 279 |
| 454 | 3300049576 | Ga0501040_0003584 | Ga0501040_0003584_1348_2190 | 279 |
| 455 | 3300049576 | Ga0501040_0032102 | Ga0501040_0032102_1043_1882 | 279 |
| 456 | 3300049576 | Ga0501040_0082439 | Ga0501040_0082439_1326_2165 | 279 |
| 457 | 3300049576 | Ga0501040_0276422 | Ga0501040_0276422_85_924 | 279 |
| 458 | 3300049577 | Ga0501041_0085073 | Ga0501041_0085073_863_1702 | 279 |
| 459 | 3300049577 | Ga0501041_0095569 | Ga0501041_0095569_775_1614 | 279 |
| 460 | 3300049578 | Ga0501042_0010230 | Ga0501042_0010230_3092_3931 | 279 |
| 461 | 3300049580 | Ga0501046_0000473 | Ga0501046_0000473_9209_10048 | 279 |
| 462 | 3300049581 | Ga0501047_0072889 | Ga0501047_0072889_2363_3202 | 279 |
| 463 | 3300049582 | Ga0501048_0006631 | Ga0501048_0006631_6788_7627 | 279 |
| 464 | 3300049582 | Ga0501048_0031393 | Ga0501048_0031393_1977_2819 | 279 |
| 465 | 3300049582 | Ga0501048_0181442 | Ga0501048_0181442_630_1472 | 279 |
| 466 | 3300049584 | Ga0501068_0168278 | Ga0501068_0168278_527_1366 | 279 |
| 467 | 3300049584 | Ga0501068_0299872 | Ga0501068_0299872_139_978 | 279 |
| 468 | 3300049587 | Ga0501071_0038579 | Ga0501071_0038579_2376_3215 | 279 |
| 469 | 3300049587 | Ga0501071_0101948 | Ga0501071_0101948_986_1828 | 279 |
| 470 | 3300049588 | Ga0501072_0003706 | Ga0501072_0003706_10292_11134 | 279 |
| 471 | 3300049588 | Ga0501072_0003793 | Ga0501072_0003793_682_1521 | 279 |
| 472 | 3300049588 | Ga0501072_0062699 | Ga0501072_0062699_480_1319 | 279 |
| 473 | 3300049588 | Ga0501072_0128431 | Ga0501072_0128431_342_1181 | 279 |
| 474 | 3300049588 | Ga0501072_0228955 | Ga0501072_0228955_490_1332 | 279 |
| 475 | 3300049589 | Ga0501073_0091786 | Ga0501073_0091786_101_943 | 279 |
| 476 | 3300049590 | Ga0501074_0012067 | Ga0501074_0012067_2932_3771 | 279 |
| 477 | 3300049590 | Ga0501074_0113450 | Ga0501074_0113450_57_896 | 279 |
| 478 | 3300049591 | Ga0501075_0000078 | Ga0501075_0000078_29940_30782 | 279 |
| 479 | 3300049591 | Ga0501075_0067008 | Ga0501075_0067008_1853_2692 | 279 |
| 480 | 3300049591 | Ga0501075_0082426 | Ga0501075_0082426_1112_2044 | 279 |
| 481 | 3300049591 | Ga0501075_0131730 | Ga0501075_0131730_940_1779 | 279 |
| 482 | 3300049591 | Ga0501075_0181966 | Ga0501075_0181966_483_1322 | 279 |
| 483 | 3300049592 | Ga0501076_0000002 | Ga0501076_0000002_153131_153973 | 279 |
| 484 | 3300049592 | Ga0501076_0043538 | Ga0501076_0043538_1329_2168 | 279 |
| 485 | 3300049592 | Ga0501076_0191628 | Ga0501076_0191628_27_866 | 279 |
| 486 | 3300049593 | Ga0501077_0004194 | Ga0501077_0004194_7733_8572 | 279 |
| 487 | 3300049593 | Ga0501077_0084628 | Ga0501077_0084628_151_990 | 279 |
| 488 | 3300049741 | Ga0501079_0001001 | Ga0501079_0001001_16935_17774 | 279 |
| 489 | 3300049741 | Ga0501079_0009589 | Ga0501079_0009589_2974_3813 | 279 |
| 490 | 3300049741 | Ga0501079_0065232 | Ga0501079_0065232_1110_1949 | 279 |
| 491 | 3300049741 | Ga0501079_0076743 | Ga0501079_0076743_565_1407 | 279 |
| 492 | 3300049741 | Ga0501079_0120103 | Ga0501079_0120103_362_1204 | 279 |
| 493 | 3300049742 | Ga0501080_0128698 | Ga0501080_0128698_349_1188 | 279 |
| 494 | 3300049742 | Ga0501080_0211510 | Ga0501080_0211510_794_1633 | 279 |
| 495 | 3300049743 | Ga0501081_0002207 | Ga0501081_0002207_1900_2742 | 279 |
| 496 | 3300049743 | Ga0501081_0002835 | Ga0501081_0002835_4085_4924 | 279 |
| 497 | 3300049743 | Ga0501081_0094918 | Ga0501081_0094918_706_1545 | 279 |
| 498 | 3300049743 | Ga0501081_0135820 | Ga0501081_0135820_78_917 | 279 |
| 499 | 3300049744 | Ga0501083_0355428 | Ga0501083_0355428_68_910 | 279 |
| 500 | 3300049822 | Ga0501035_0099556 | Ga0501035_0099556_1685_2524 | 279 |
| 501 | 3300049822 | Ga0501035_0255056 | Ga0501035_0255056_56_895 | 279 |
| 502 | 3300049824 | Ga0501045_0044535 | Ga0501045_0044535_1151_1990 | 279 |
| 503 | 3300049824 | Ga0501045_0055251 | Ga0501045_0055251_1283_2122 | 279 |
| 504 | 3300049824 | Ga0501045_0058952 | Ga0501045_0058952_1330_2172 | 279 |
| 505 | 3300050507 | nmdc:mga05p37_10791_c1 | nmdc:mga05p37_10791_c1_7150_7995 | 279 |
| 506 | 3300050507 | nmdc:mga05p37_12334_c1 | nmdc:mga05p37_12334_c1_6397_7236 | 279 |
| 507 | 3300050507 | nmdc:mga05p37_1316_c1 | nmdc:mga05p37_1316_c1_9416_10258 | 279 |
| 508 | 3300050507 | nmdc:mga05p37_157286_c1 | nmdc:mga05p37_157286_c1_1332_2174 | 279 |
| 509 | 3300050507 | nmdc:mga05p37_166852_c1 | nmdc:mga05p37_166852_c1_1681_2520 | 279 |
| 510 | 3300050507 | nmdc:mga05p37_1819_c1 | nmdc:mga05p37_1819_c1_13232_14074 | 279 |
| 511 | 3300050507 | nmdc:mga05p37_202854_c1 | nmdc:mga05p37_202854_c1_1454_2293 | 279 |
| 512 | 3300050507 | nmdc:mga05p37_2113_c1 | nmdc:mga05p37_2113_c1_10203_11042 | 279 |
| 513 | 3300050507 | nmdc:mga05p37_263652_c1 | nmdc:mga05p37_263652_c1_371_1216 | 279 |
| 514 | 3300050507 | nmdc:mga05p37_2942_c1 | nmdc:mga05p37_2942_c1_606_1451 | 279 |
| 515 | 3300050507 | nmdc:mga05p37_323810_c1 | nmdc:mga05p37_323810_c1_917_1756 | 279 |
| 516 | 3300050507 | nmdc:mga05p37_326212_c1 | nmdc:mga05p37_326212_c1_784_1623 | 279 |
| 517 | 3300050507 | nmdc:mga05p37_359102_c1 | nmdc:mga05p37_359102_c1_215_1072 | 279 |
| 518 | 3300050507 | nmdc:mga05p37_39095_c1 | nmdc:mga05p37_39095_c1_2933_3781 | 279 |
| 519 | 3300050507 | nmdc:mga05p37_57800_c1 | nmdc:mga05p37_57800_c1_1942_2787 | 279 |
| 520 | 3300050507 | nmdc:mga05p37_65063_c1 | nmdc:mga05p37_65063_c1_1184_2023 | 279 |
| 521 | 3300050508 | nmdc:mga09592_26622_c1 | nmdc:mga09592_26622_c1_2585_3427 | 279 |
| 522 | 3300050508 | nmdc:mga09592_321770_c1 | nmdc:mga09592_321770_c1_272_1117 | 279 |
| 523 | 3300050508 | nmdc:mga09592_445_c1 | nmdc:mga09592_445_c1_29288_30127 | 279 |
| 524 | 3300050508 | nmdc:mga09592_47270_c1 | nmdc:mga09592_47270_c1_1070_1918 | 279 |
| 525 | 3300050508 | nmdc:mga09592_57122_c1 | nmdc:mga09592_57122_c1_274_1119 | 279 |
| 526 | 3300050508 | nmdc:mga09592_68296_c1 | nmdc:mga09592_68296_c1_580_1425 | 279 |
| 527 | 3300050509 | nmdc:mga0qj67_226562_c1 | nmdc:mga0qj67_226562_c1_171_1016 | 279 |
| 528 | 3300050509 | nmdc:mga0qj67_2851_c1 | nmdc:mga0qj67_2851_c1_10191_11030 | 279 |
| 529 | 3300050509 | nmdc:mga0qj67_421_c1 | nmdc:mga0qj67_421_c1_1359_2198 | 279 |
| 530 | 3300050510 | nmdc:mga06r32_1003_c1 | nmdc:mga06r32_1003_c1_9934_10779 | 279 |
| 531 | 3300050510 | nmdc:mga06r32_114585_c1 | nmdc:mga06r32_114585_c1_1505_2344 | 279 |
| 532 | 3300050510 | nmdc:mga06r32_1509_c1 | nmdc:mga06r32_1509_c1_6470_7309 | 279 |
| 533 | 3300050510 | nmdc:mga06r32_15708_c1 | nmdc:mga06r32_15708_c1_3317_4156 | 279 |
| 534 | 3300050510 | nmdc:mga06r32_19194_c1 | nmdc:mga06r32_19194_c1_3534_4382 | 279 |
| 535 | 3300050510 | nmdc:mga06r32_26091_c1 | nmdc:mga06r32_26091_c1_1040_1885 | 279 |
| 536 | 3300050510 | nmdc:mga06r32_3250_c1 | nmdc:mga06r32_3250_c1_13677_14516 | 279 |
| 537 | 3300050510 | nmdc:mga06r32_541946_c1 | nmdc:mga06r32_541946_c1_13_858 | 279 |
| 538 | 3300050510 | nmdc:mga06r32_5805_c1 | nmdc:mga06r32_5805_c1_1149_1991 | 279 |
| 539 | 3300050511 | nmdc:mga08y16_121152_c1 | nmdc:mga08y16_121152_c1_1194_2039 | 279 |
| 540 | 3300050511 | nmdc:mga08y16_4347_c1 | nmdc:mga08y16_4347_c1_11466_12311 | 279 |
| 541 | 3300050511 | nmdc:mga08y16_54210_c1 | nmdc:mga08y16_54210_c1_1265_2110 | 279 |
| 542 | 3300050511 | nmdc:mga08y16_60331_c1 | nmdc:mga08y16_60331_c1_2547_3389 | 279 |
| 543 | 3300050511 | nmdc:mga08y16_63096_c1 | nmdc:mga08y16_63096_c1_2879_3718 | 279 |
| 544 | 3300050511 | nmdc:mga08y16_7638_c1 | nmdc:mga08y16_7638_c1_7515_8372 | 279 |
| 545 | 3300050512 | nmdc:mga0n895_1185_c1 | nmdc:mga0n895_1185_c1_8586_9428 | 279 |
| 546 | 3300050512 | nmdc:mga0n895_134553_c1 | nmdc:mga0n895_134553_c1_769_1611 | 279 |
| 547 | 3300050512 | nmdc:mga0n895_21841_c1 | nmdc:mga0n895_21841_c1_3687_4526 | 279 |
| 548 | 3300050512 | nmdc:mga0n895_222693_c1 | nmdc:mga0n895_222693_c1_157_996 | 279 |
| 549 | 3300050512 | nmdc:mga0n895_286269_c1 | nmdc:mga0n895_286269_c1_721_1560 | 279 |
| 550 | 3300050512 | nmdc:mga0n895_30687_c1 | nmdc:mga0n895_30687_c1_885_1724 | 279 |
| 551 | 3300050512 | nmdc:mga0n895_33153_c1 | nmdc:mga0n895_33153_c1_3458_4297 | 279 |
| 552 | 3300050512 | nmdc:mga0n895_43046_c1 | nmdc:mga0n895_43046_c1_494_1333 | 279 |
| 553 | 3300050512 | nmdc:mga0n895_44545_c1 | nmdc:mga0n895_44545_c1_3290_4132 | 279 |
| 554 | 3300050512 | nmdc:mga0n895_55177_c1 | nmdc:mga0n895_55177_c1_706_1548 | 279 |
| 555 | 3300050512 | nmdc:mga0n895_66999_c1 | nmdc:mga0n895_66999_c1_1488_2333 | 279 |
| 556 | 3300050512 | nmdc:mga0n895_736561_c1 | nmdc:mga0n895_736561_c1_105_944 | 279 |
| 557 | 3300050513 | nmdc:mga0rr50_102393_c1 | nmdc:mga0rr50_102393_c1_363_1205 | 279 |
| 558 | 3300050513 | nmdc:mga0rr50_221737_c1 | nmdc:mga0rr50_221737_c1_575_1414 | 279 |
| 559 | 3300050513 | nmdc:mga0rr50_4128_c1 | nmdc:mga0rr50_4128_c1_7606_8445 | 279 |
| 560 | 3300050513 | nmdc:mga0rr50_48289_c1 | nmdc:mga0rr50_48289_c1_196_1038 | 279 |
| 561 | 3300050515 | nmdc:mga0a205_110300_c1 | nmdc:mga0a205_110300_c1_1268_2113 | 279 |
| 562 | 3300050515 | nmdc:mga0a205_137776_c1 | nmdc:mga0a205_137776_c1_210_1049 | 279 |
| 563 | 3300050515 | nmdc:mga0a205_15565_c1 | nmdc:mga0a205_15565_c1_3673_4512 | 279 |
| 564 | 3300050515 | nmdc:mga0a205_176647_c1 | nmdc:mga0a205_176647_c1_750_1592 | 279 |
| 565 | 3300050515 | nmdc:mga0a205_184531_c1 | nmdc:mga0a205_184531_c1_26_865 | 279 |
| 566 | 3300050515 | nmdc:mga0a205_24902_c1 | nmdc:mga0a205_24902_c1_89_931 | 279 |
| 567 | 3300050515 | nmdc:mga0a205_33930_c1 | nmdc:mga0a205_33930_c1_856_1695 | 279 |
| 568 | 3300050515 | nmdc:mga0a205_4127_c1 | nmdc:mga0a205_4127_c1_2290_3132 | 279 |
| 569 | 3300050515 | nmdc:mga0a205_71069_c1 | nmdc:mga0a205_71069_c1_592_1434 | 279 |
| 570 | 3300050515 | nmdc:mga0a205_82419_c1 | nmdc:mga0a205_82419_c1_1589_2434 | 279 |
| 571 | 3300050515 | nmdc:mga0a205_8887_c1 | nmdc:mga0a205_8887_c1_469_1308 | 279 |
| 572 | 3300054114 | Ga0501084_0003242 | Ga0501084_0003242_10415_11257 | 279 |
| 573 | 3300054114 | Ga0501084_0004703 | Ga0501084_0004703_3335_4174 | 279 |
| 574 | 3300054114 | Ga0501084_0038164 | Ga0501084_0038164_2112_2951 | 279 |
| 575 | 3300054114 | Ga0501084_0080133 | Ga0501084_0080133_789_1628 | 279 |
| 576 | 3300054114 | Ga0501084_0398482 | Ga0501084_0398482_142_981 | 279 |
| 577 | 3300054114 | Ga0501084_0590734 | Ga0501084_0590734_44_883 | 279 |
| 578 | 3300060353 | Ga0501082_0000407 | Ga0501082_0000407_7733_8572 | 279 |
| 579 | 3300060353 | Ga0501082_0022243 | Ga0501082_0022243_1931_2770 | 279 |
| 580 | 3300061734 | Ga0530510_0000024 | Ga0530510_0000024_22617_23459 | 279 |
| 581 | 3300061734 | Ga0530510_0000913 | Ga0530510_0000913_13052_13897 | 279 |
| 582 | 3300061734 | Ga0530510_0019693 | Ga0530510_0019693_2823_3662 | 279 |
| 583 | 3300061734 | Ga0530510_0055748 | Ga0530510_0055748_1724_2563 | 279 |
| 584 | 3300061734 | Ga0530510_0197904 | Ga0530510_0197904_249_1091 | 279 |
| 585 | 3300061734 | Ga0530510_0510891 | Ga0530510_0510891_52_891 | 279 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ewf-assembly2.cif.gz_B | the crystal structure of beta-lactamase from sphaerobacter thermophilus dsm 20745 | 0.9093 | 4 | 278 |
| 4ewf-assembly4.cif.gz_D | the crystal structure of beta-lactamase from sphaerobacter thermophilus dsm 20745 | 0.9064 | 4 | 278 |
| 4ewf-assembly3.cif.gz_C | the crystal structure of beta-lactamase from sphaerobacter thermophilus dsm 20745 | 0.905 | 2 | 277 |
| 2j8y-assembly2.cif.gz_B | structure of pbp-a acyl-enzyme complex with penicillin-g | 0.9019 | 1 | 276 |
| 2jbf-assembly3.cif.gz_C | structure of pbp-a, l158e mutant. acyl-enzyme complex with penicillin- g. | 0.8989 | 1 | 276 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2j7vB01 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.9116 | 1 | 276 | 3.40.710.10 |
| 4ewfA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.9084 | 4 | 278 | 3.40.710.10 |
| 2j7vB01 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8816 | 1 | 276 | 3.40.710.10 |
| 1mfoA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8745 | 3 | 277 | 3.40.710.10 |
| 1mfoA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8652 | 3 | 277 | 3.40.710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6Q4E1-F1-model_v4 | Serine hydrolase | 0.9918 | 40 | 279 |
GO:0008800
GO:0030655 GO:0046677 |
| AF-A0A1H1JV97-F1-model_v4 | beta-lactamase (EC 3.5.2.6) | 0.9864 | 1 | 277 |
GO:0008800
GO:0030655 GO:0046677 |
| AF-A0A3B9C4H0-F1-model_v4 | deleted | 0.9834 | 186 | 276 |
|
| AF-A0A7V3BGX4-F1-model_v4 | Serine hydrolase | 0.9811 | 2 | 205 |
GO:0008800
GO:0030655 GO:0046677 |
| AF-A0A3D1RW74-F1-model_v4 | beta-lactamase (EC 3.5.2.6) | 0.98 | 2 | 279 |
GO:0008800
GO:0030655 GO:0046677 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar