F466503

General Info

Members Datasets Scaffolds Average Seq Length
585 296 1170 198

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_650826_c1|nmdc:mga05p37_650826_c1_155_937
Length 232
Sequence MEASARAQVPPRLKERYEQEIAPSLQKRFGYKSAMEIPRLEKITLNMGVGDAKQDSNVLDAASEQLATIAGQAPNVRRARKSIAAFKLRDGMPVGVTVTLRRARMWEFFDRLTAIAIPRIRDFRGLNARSFDGRGNYSMGVREQIIFPEIDYDAIDQVRGLDVTITTSAKTDEEAYILLRELGMPFSPEGAPGFEQLKEENPEAYEAPVREEDEGGEGDDAAPAEDGDRGQA

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
165 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
166 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
167 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
168 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
202 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
205 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
206 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
207 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
220 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
223 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
293 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 5.13
Rhizosphere 92.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_650826_c1 3300050507 Bacteria 1180
2 JGI25406J46586_10009512 3300003203 Bacteria 4350
3 JGI25407J50210_10011363 3300003373 Bacteria 2275
4 Ga0065715_10147379 3300005293 Bacteria 1771
5 Ga0070658_10253392 3300005327 Bacteria 1493
6 Ga0070676_10037090 3300005328 Bacteria 2810
7 Ga0070683_100314250 3300005329 Bacteria 1491
8 Ga0070670_100002726 3300005331 Bacteria 14597
9 Ga0070670_100702187 3300005331 Bacteria 910
10 Ga0070677_10004529 3300005333 Bacteria 4536
11 Ga0068869_100165469 3300005334 Bacteria 1725
12 Ga0070666_10020483 3300005335 Bacteria 4275
13 Ga0070666_10042517 3300005335 Bacteria 3041
14 Ga0068868_100464117 3300005338 Bacteria 1103
15 Ga0070689_100018801 3300005340 Bacteria 5099
16 Ga0070689_100359837 3300005340 Bacteria 1222
17 Ga0070661_100114078 3300005344 Bacteria 2020
18 Ga0070668_100012868 3300005347 Bacteria 6228
19 Ga0070669_100102281 3300005353 Bacteria 2163
20 Ga0070675_100031032 3300005354 Bacteria 4318
21 Ga0070674_100014259 3300005356 Bacteria 4938
22 Ga0070674_100219712 3300005356 Bacteria 1477
23 Ga0070673_100066457 3300005364 Bacteria 2880
24 Ga0070673_100161776 3300005364 Bacteria 1904
25 Ga0070688_100062951 3300005365 Bacteria 2350
26 Ga0070688_100245927 3300005365 Bacteria 1272
27 Ga0070659_100097880 3300005366 Bacteria 2358
28 Ga0070667_100001611 3300005367 Bacteria 20202
29 Ga0070667_100048136 3300005367 Bacteria 3588
30 Ga0070667_100097551 3300005367 Bacteria 2535
31 Ga0070709_10015515 3300005434 Bacteria 4337
32 Ga0070714_100009500 3300005435 Bacteria 7649
33 Ga0070714_100039749 3300005435 Bacteria 3961
34 Ga0070714_100388700 3300005435 Bacteria 1316
35 Ga0070713_100001795 3300005436 Bacteria 13831
36 Ga0070713_100005685 3300005436 Bacteria 8558
37 Ga0070713_100163538 3300005436 Bacteria 1988
38 Ga0070713_100193708 3300005436 Bacteria 1833
39 Ga0070711_100380163 3300005439 Bacteria 1142
40 Ga0070700_100016206 3300005441 Bacteria 4243
41 Ga0070700_100088583 3300005441 Bacteria 2014
42 Ga0070694_100919813 3300005444 Bacteria 723
43 Ga0070708_100044414 3300005445 Bacteria 3907
44 Ga0070708_100270554 3300005445 Bacteria 1598
45 Ga0070678_100005141 3300005456 Bacteria 7516
46 Ga0070678_100006691 3300005456 Bacteria 6787
47 Ga0070678_100021374 3300005456 Bacteria 4266
48 Ga0070662_100031910 3300005457 Bacteria 3700
49 Ga0070681_10007099 3300005458 Bacteria 10907
50 Ga0070681_10010917 3300005458 Bacteria 8982
51 Ga0068867_100522388 3300005459 Bacteria 1024
52 Ga0070685_10036875 3300005466 Bacteria 2766
53 Ga0070685_10119525 3300005466 Bacteria 1634
54 Ga0070706_100004600 3300005467 Bacteria 13242
55 Ga0070707_100064367 3300005468 Bacteria 3521
56 Ga0070698_100129739 3300005471 Bacteria 2477
57 Ga0070698_100323539 3300005471 Bacteria 1473
58 Ga0070699_100057447 3300005518 Bacteria 3371
59 Ga0070699_100068029 3300005518 Bacteria 3093
60 Ga0070699_100146878 3300005518 Bacteria 2084
61 Ga0070699_100266738 3300005518 Bacteria 1532
62 Ga0070699_100866728 3300005518 Bacteria 827
63 Ga0070679_100085474 3300005530 Bacteria 3142
64 Ga0070684_100632454 3300005535 Bacteria 996
65 Ga0070697_100169968 3300005536 Bacteria 1844
66 Ga0068853_100031768 3300005539 Bacteria 4468
67 Ga0070672_100005015 3300005543 Bacteria 8727
68 Ga0070686_100067971 3300005544 Bacteria 2323
69 Ga0070693_100037693 3300005547 Bacteria 2697
70 Ga0070665_100009861 3300005548 Bacteria 9655
71 Ga0070665_100022127 3300005548 Bacteria 6394
72 Ga0070665_100243577 3300005548 Bacteria 1798
73 Ga0070704_100407482 3300005549 Bacteria 1162
74 Ga0068855_100056659 3300005563 Bacteria 4598
75 Ga0068855_100375706 3300005563 Bacteria 1561
76 Ga0068855_101123421 3300005563 Bacteria 820
77 Ga0068857_100012217 3300005577 Bacteria 7470
78 Ga0068854_100729252 3300005578 Bacteria 858
79 Ga0070702_100012107 3300005615 Bacteria 4310
80 Ga0068852_100428745 3300005616 Bacteria 1305
81 Ga0068859_100046188 3300005617 Bacteria 4374
82 Ga0068859_100130549 3300005617 Bacteria 2584
83 Ga0068859_100647831 3300005617 Bacteria 1148
84 Ga0068864_100116524 3300005618 Bacteria 2384
85 Ga0068864_100898083 3300005618 Bacteria 875
86 Ga0068861_100208882 3300005719 Bacteria 1643
87 Ga0068861_100230782 3300005719 Bacteria 1569
88 Ga0068861_100334365 3300005719 Bacteria 1323
89 Ga0068861_100336057 3300005719 Bacteria 1321
90 Ga0068861_100985067 3300005719 Bacteria 804
91 Ga0068851_10031533 3300005834 Bacteria 2633
92 Ga0068851_10176404 3300005834 Bacteria 1182
93 Ga0068870_10209898 3300005840 Bacteria 1185
94 Ga0068863_100514679 3300005841 Bacteria 1179
95 Ga0068858_100447954 3300005842 Bacteria 1244
96 Ga0068858_100744003 3300005842 Bacteria 955
97 Ga0068860_100071954 3300005843 Bacteria 3285
98 Ga0068860_100170761 3300005843 Bacteria 2100
99 Ga0068862_100001247 3300005844 Bacteria 23931
100 Ga0081455_10006416 3300005937 Bacteria 12613
101 Ga0081455_10011092 3300005937 Bacteria 9072
102 Ga0081455_10017464 3300005937 Bacteria 6876
103 Ga0081455_10019985 3300005937 Bacteria 6322
104 Ga0081455_10093962 3300005937 Bacteria 2423
105 Ga0081455_10165120 3300005937 Bacteria 1693
106 Ga0081538_10001246 3300005981 Bacteria 26599
107 Ga0081538_10008306 3300005981 Bacteria 8839
108 Ga0081538_10022726 3300005981 Bacteria 4534
109 Ga0081538_10026960 3300005981 Bacteria 3999
110 Ga0081538_10076379 3300005981 Bacteria 1811
111 Ga0081539_10014550 3300005985 Bacteria 5808
112 Ga0070717_10062172 3300006028 Bacteria 3096
113 Ga0070717_10075652 3300006028 Bacteria 2816
114 Ga0075432_10034224 3300006058 Bacteria 1764
115 Ga0070716_100003910 3300006173 Bacteria 7076
116 Ga0070716_100272621 3300006173 Bacteria 1163
117 Ga0070712_100044366 3300006175 Bacteria 3065
118 Ga0070712_100078635 3300006175 Bacteria 2381
119 Ga0075366_10007118 3300006195 Bacteria 6159
120 Ga0075366_10016904 3300006195 Bacteria 4193
121 Ga0097621_100180965 3300006237 Bacteria 1821
122 Ga0097621_100204046 3300006237 Bacteria 1717
123 Ga0068871_100066382 3300006358 Bacteria 2957
124 Ga0068871_100092374 3300006358 Bacteria 2524
125 Ga0068871_100111438 3300006358 Bacteria 2302
126 Ga0068871_100340751 3300006358 Bacteria 1324
127 Ga0075428_100132743 3300006844 Bacteria 2708
128 Ga0075428_100236127 3300006844 Bacteria 1973
129 Ga0075430_100049708 3300006846 Bacteria 3539
130 Ga0075431_100075040 3300006847 Bacteria 3489
131 Ga0075431_100348704 3300006847 Bacteria 1489
132 Ga0075434_100036821 3300006871 Bacteria 4840
133 Ga0075434_100239451 3300006871 Bacteria 1835
134 Ga0075434_100279007 3300006871 Bacteria 1690
135 Ga0075434_100716553 3300006871 Bacteria 1018
136 Ga0068865_100285339 3300006881 Bacteria 1316
137 Ga0075436_100000862 3300006914 Bacteria 20155
138 Ga0075436_100018705 3300006914 Bacteria 4743
139 Ga0097620_100046188 3300006931 Bacteria 4374
140 Ga0097620_100130553 3300006931 Bacteria 2584
141 Ga0097620_100253646 3300006931 Bacteria 1850
142 Ga0097620_100647835 3300006931 Bacteria 1148
143 Ga0075435_100120900 3300007076 Bacteria 2185
144 Ga0105240_10152833 3300009093 Bacteria 2747
145 Ga0105240_10252783 3300009093 Bacteria 2037
146 Ga0111539_10019077 3300009094 Bacteria 8474
147 Ga0111539_10021781 3300009094 Bacteria 7879
148 Ga0111539_10342356 3300009094 Bacteria 1741
149 Ga0111539_10404617 3300009094 Bacteria 1590
150 Ga0111539_10690104 3300009094 Bacteria 1189
151 Ga0105245_10040665 3300009098 Bacteria 4143
152 Ga0105243_10035000 3300009148 Bacteria 3892
153 Ga0105243_10245165 3300009148 Bacteria 1596
154 Ga0105242_10009166 3300009176 Bacteria 7598
155 Ga0105242_10046503 3300009176 Bacteria 3521
156 Ga0105242_10716019 3300009176 Bacteria 981
157 Ga0105248_10118027 3300009177 Bacteria 2992
158 Ga0105248_10123110 3300009177 Bacteria 2926
159 Ga0105248_10627912 3300009177 Bacteria 1212
160 Ga0105238_10087095 3300009551 Bacteria 3110
161 Ga0105249_10003640 3300009553 Bacteria 13325
162 Ga0105249_10363778 3300009553 Bacteria 1469
163 Ga0099796_10005277 3300010159 Bacteria 3211
164 Ga0105239_10270107 3300010375 Bacteria 1913
165 Ga0105246_10260205 3300011119 Bacteria 1382
166 Ga0157370_10090984 3300013104 Bacteria 2865
167 Ga0157369_10006334 3300013105 Bacteria 13736
168 Ga0157374_10054005 3300013296 Bacteria 3747
169 Ga0157374_10138530 3300013296 Bacteria 2361
170 Ga0157374_10610582 3300013296 Bacteria 1101
171 Ga0157378_10043237 3300013297 Bacteria 4000
172 Ga0157378_10059479 3300013297 Bacteria 3409
173 Ga0157378_10096241 3300013297 Bacteria 2698
174 Ga0157378_10124450 3300013297 Bacteria 2381
175 Ga0157378_10153148 3300013297 Bacteria 2149
176 Ga0157378_10694815 3300013297 Bacteria 1036
177 Ga0163162_10086874 3300013306 Bacteria 3205
178 Ga0163162_10278343 3300013306 Bacteria 1805
179 Ga0163162_10446724 3300013306 Bacteria 1425
180 Ga0157372_10202803 3300013307 Bacteria 2298
181 Ga0157375_10173624 3300013308 Bacteria 2304
182 Ga0157375_11155259 3300013308 Bacteria 907
183 Ga0157375_11753018 3300013308 Bacteria 736
184 Ga0163163_10278391 3300014325 Bacteria 1724
185 Ga0163163_10377128 3300014325 Bacteria 1476
186 Ga0157380_10026469 3300014326 Bacteria 4403
187 Ga0157377_10014255 3300014745 Bacteria 4041
188 Ga0157377_10172095 3300014745 Bacteria 1355
189 Ga0157379_10035775 3300014968 Bacteria 4428
190 Ga0157379_10079870 3300014968 Bacteria 2930
191 Ga0157376_10501861 3300014969 Bacteria 1193
192 Ga0163161_10045011 3300017792 Bacteria 3181
193 Ga0207697_10001157 3300025315 Bacteria 14504
194 Ga0207656_10001578 3300025321 Bacteria 7582
195 Ga0207656_10019865 3300025321 Bacteria 2662
196 Ga0207682_10006357 3300025893 Bacteria 4766
197 Ga0207682_10055309 3300025893 Bacteria 1650
198 Ga0207692_10395199 3300025898 Bacteria 861
199 Ga0207688_10002803 3300025901 Bacteria 9458
200 Ga0207688_10040537 3300025901 Bacteria 2588
201 Ga0207680_10054402 3300025903 Bacteria 2407
202 Ga0207680_10067863 3300025903 Bacteria 2198
203 Ga0207680_10118155 3300025903 Bacteria 1730
204 Ga0207647_10089936 3300025904 Bacteria 1832
205 Ga0207699_10069854 3300025906 Bacteria 2143
206 Ga0207645_10004332 3300025907 Bacteria 10510
207 Ga0207645_10250537 3300025907 Bacteria 1171
208 Ga0207643_10001343 3300025908 Bacteria 14235
209 Ga0207705_10172434 3300025909 Bacteria 1629
210 Ga0207705_10230349 3300025909 Bacteria 1409
211 Ga0207684_10011106 3300025910 Bacteria 7885
212 Ga0207654_10015846 3300025911 Bacteria 3918
213 Ga0207707_10005674 3300025912 Bacteria 10922
214 Ga0207707_10015921 3300025912 Bacteria 6559
215 Ga0207707_10192474 3300025912 Bacteria 1779
216 Ga0207695_10045231 3300025913 Bacteria 4675
217 Ga0207695_10725986 3300025913 Bacteria 874
218 Ga0207693_10043512 3300025915 Bacteria 3533
219 Ga0207693_10096919 3300025915 Bacteria 2313
220 Ga0207693_10304066 3300025915 Bacteria 1249
221 Ga0207693_10509639 3300025915 Bacteria 939
222 Ga0207663_10045973 3300025916 Bacteria 2688
223 Ga0207663_10050037 3300025916 Bacteria 2595
224 Ga0207662_10050088 3300025918 Bacteria 2480
225 Ga0207662_10073771 3300025918 Bacteria 2070
226 Ga0207657_10109580 3300025919 Bacteria 2282
227 Ga0207649_10101163 3300025920 Bacteria 1908
228 Ga0207652_10155677 3300025921 Bacteria 2047
229 Ga0207652_10258193 3300025921 Bacteria 1572
230 Ga0207652_10287808 3300025921 Bacteria 1483
231 Ga0207646_10027133 3300025922 Bacteria 5222
232 Ga0207646_10363419 3300025922 Bacteria 1307
233 Ga0207694_10007098 3300025924 Bacteria 8511
234 Ga0207659_10001704 3300025926 Bacteria 13045
235 Ga0207687_10165671 3300025927 Bacteria 1700
236 Ga0207687_10194600 3300025927 Bacteria 1581
237 Ga0207700_10000001 3300025928 Bacteria 1122509
238 Ga0207700_10003066 3300025928 Bacteria 9646
239 Ga0207700_10445848 3300025928 Bacteria 1140
240 Ga0207664_10007010 3300025929 Bacteria 7803
241 Ga0207664_10110540 3300025929 Bacteria 2285
242 Ga0207664_10426798 3300025929 Bacteria 1181
243 Ga0207644_10136885 3300025931 Bacteria 1881
244 Ga0207706_10006693 3300025933 Bacteria 10657
245 Ga0207686_10018577 3300025934 Bacteria 3939
246 Ga0207686_10237938 3300025934 Bacteria 1323
247 Ga0207670_10146182 3300025936 Bacteria 1748
248 Ga0207669_10065481 3300025937 Bacteria 2254
249 Ga0207669_10077737 3300025937 Bacteria 2112
250 Ga0207704_10108464 3300025938 Bacteria 1870
251 Ga0207704_10270843 3300025938 Bacteria 1286
252 Ga0207704_10370622 3300025938 Bacteria 1121
253 Ga0207665_10088164 3300025939 Bacteria 2146
254 Ga0207665_10088305 3300025939 Bacteria 2145
255 Ga0207691_10008862 3300025940 Bacteria 9656
256 Ga0207691_10010153 3300025940 Bacteria 9035
257 Ga0207691_10035592 3300025940 Bacteria 4620
258 Ga0207711_10084852 3300025941 Bacteria 2773
259 Ga0207711_10091045 3300025941 Bacteria 2682
260 Ga0207711_10122120 3300025941 Bacteria 2327
261 Ga0207689_10008334 3300025942 Bacteria 9029
262 Ga0207689_10046684 3300025942 Bacteria 3579
263 Ga0207689_10181155 3300025942 Bacteria 1737
264 Ga0207661_10260052 3300025944 Bacteria 1546
265 Ga0207661_10426537 3300025944 Bacteria 1205
266 Ga0207679_10513844 3300025945 Bacteria 1070
267 Ga0207667_10019150 3300025949 Bacteria 7654
268 Ga0207667_10223167 3300025949 Bacteria 1931
269 Ga0207651_10184977 3300025960 Bacteria 1656
270 Ga0207651_10251978 3300025960 Bacteria 1445
271 Ga0207651_10367236 3300025960 Bacteria 1216
272 Ga0207712_10003459 3300025961 Bacteria 9970
273 Ga0207712_10104420 3300025961 Bacteria 2113
274 Ga0207668_10002563 3300025972 Bacteria 10620
275 Ga0207668_10073886 3300025972 Bacteria 2445
276 Ga0207668_10122678 3300025972 Bacteria 1970
277 Ga0207640_10618427 3300025981 Bacteria 919
278 Ga0207658_10000840 3300025986 Bacteria 25652
279 Ga0207658_10030611 3300025986 Bacteria 3813
280 Ga0207703_10586810 3300026035 Bacteria 1053
281 Ga0207639_10323530 3300026041 Bacteria 1370
282 Ga0207708_10005800 3300026075 Bacteria 9127
283 Ga0207702_10140039 3300026078 Bacteria 2188
284 Ga0207641_10078861 3300026088 Bacteria 2853
285 Ga0207648_10008905 3300026089 Bacteria 9661
286 Ga0207676_10018878 3300026095 Bacteria 5020
287 Ga0207676_10527716 3300026095 Bacteria 1125
288 Ga0207676_10759764 3300026095 Bacteria 943
289 Ga0207674_10022377 3300026116 Bacteria 6788
290 Ga0207674_10058297 3300026116 Bacteria 3912
291 Ga0207675_100006269 3300026118 Bacteria 11287
292 Ga0207675_100125589 3300026118 Bacteria 2430
293 Ga0207683_10007403 3300026121 Bacteria 9411
294 Ga0207683_10008690 3300026121 Bacteria 8684
295 Ga0207698_10025800 3300026142 Bacteria 4147
296 Ga0207698_10214366 3300026142 Bacteria 1735
297 Ga0207698_10767346 3300026142 Bacteria 964
298 Ga0207428_10007467 3300027907 Bacteria 9965
299 Ga0207428_10145127 3300027907 Bacteria 1809
300 Ga0207428_10236826 3300027907 Bacteria 1365
301 Ga0268266_10001628 3300028379 Bacteria 26120
302 Ga0268266_10006169 3300028379 Bacteria 11019
303 Ga0268266_10380414 3300028379 Bacteria 1331
304 Ga0268265_10000667 3300028380 Bacteria 34047
305 Ga0268265_10247238 3300028380 Bacteria 1577
306 Ga0268264_10431947 3300028381 Bacteria 1272
307 Ga0265337_1037670 3300028556 Bacteria 1406
308 Ga0265319_1000030 3300028563 Bacteria 129742
309 Ga0265319_1001800 3300028563 Bacteria 12257
310 Ga0265334_10015907 3300028573 Bacteria 3119
311 Ga0265318_10002940 3300028577 Bacteria 8845
312 Ga0265318_10004027 3300028577 Bacteria 7219
313 Ga0265318_10030930 3300028577 Bacteria 2079
314 Ga0265322_10015941 3300028654 Bacteria 2169
315 Ga0265338_10000156 3300028800 Bacteria 125065
316 Ga0265338_10006510 3300028800 Bacteria 14847
317 Ga0265338_10017394 3300028800 Bacteria 7751
318 Ga0265338_10154817 3300028800 Bacteria 1777
319 Ga0265324_10039877 3300029957 Bacteria 1628
320 Ga0265332_10002675 3300031238 Bacteria 8936
321 Ga0265328_10035883 3300031239 Bacteria 1833
322 Ga0265320_10033040 3300031240 Bacteria 2644
323 Ga0265320_10046676 3300031240 Bacteria 2121
324 Ga0265325_10024792 3300031241 Bacteria 3259
325 Ga0265325_10074450 3300031241 Bacteria 1698
326 Ga0265329_10005644 3300031242 Bacteria 5034
327 Ga0265329_10023036 3300031242 Bacteria 2078
328 Ga0265340_10018011 3300031247 Bacteria 3651
329 Ga0265339_10118988 3300031249 Bacteria 1359
330 Ga0265331_10004043 3300031250 Bacteria 9240
331 Ga0265331_10044959 3300031250 Bacteria 2133
332 Ga0265327_10001971 3300031251 Bacteria 23393
333 Ga0265327_10006243 3300031251 Bacteria 9601
334 Ga0265327_10060671 3300031251 Bacteria 1932
335 Ga0265327_10210607 3300031251 Bacteria 877
336 Ga0265316_10009161 3300031344 Bacteria 9121
337 Ga0265316_10029265 3300031344 Bacteria 4531
338 Ga0265313_10055372 3300031595 Bacteria 1879
339 Ga0265314_10000765 3300031711 Bacteria 38412
340 Ga0265314_10006724 3300031711 Bacteria 10096
341 Ga0265342_10011897 3300031712 Bacteria 5920
342 Ga0265342_10065682 3300031712 Bacteria 2125
343 Ga0265342_10074519 3300031712 Bacteria 1972
344 Ga0307405_10005729 3300031731 Bacteria 6033
345 Ga0307405_10039831 3300031731 Bacteria 2843
346 Ga0307406_10125836 3300031901 Bacteria 1790
347 Ga0307406_10351973 3300031901 Bacteria 1151
348 Ga0307407_10926402 3300031903 Bacteria 670
349 Ga0307409_100077068 3300031995 Bacteria 2676
350 Ga0307416_100279359 3300032002 Bacteria 1645
351 Ga0307414_10277386 3300032004 Bacteria 1407
352 Ga0307415_100036284 3300032126 Bacteria 3228
353 Ga0316586_1026237 3300033527 Bacteria 983
354 Ga0373951_0151774 3300035091 Bacteria 650
355 Ga0373943_0110785 3300035170 Bacteria 1448
356 Ga0373931_0079776 3300035691 Bacteria 1804
357 Ga0373935_0450985 3300035692 Bacteria 929
358 Ga0373935_0479284 3300035692 Bacteria 901
359 Ga0395899_0013274 3300037312 Bacteria 6304
360 Ga0395899_0054068 3300037312 Bacteria 2972
361 Ga0395899_0182217 3300037312 Bacteria 1474
362 Ga0395900_0005930 3300037418 Bacteria 12755
363 Ga0395900_0008939 3300037418 Bacteria 10272
364 Ga0395900_0013779 3300037418 Bacteria 8252
365 Ga0395900_0026290 3300037418 Bacteria 5960
366 Ga0395900_0034072 3300037418 Bacteria 5242
367 Ga0395900_0358545 3300037418 Bacteria 1430
368 Ga0395898_0016565 3300037466 Bacteria 7535
369 Ga0395898_0025218 3300037466 Bacteria 5994
370 Ga0395898_0026248 3300037466 Bacteria 5864
371 Ga0395898_0104333 3300037466 Bacteria 2719
372 Ga0395898_0119192 3300037466 Bacteria 2528
373 Ga0395905_0000698 3300037471 Bacteria 44490
374 Ga0395905_0012695 3300037471 Bacteria 8103
375 Ga0395905_0027635 3300037471 Bacteria 5350
376 Ga0395905_0045213 3300037471 Bacteria 4130
377 Ga0395905_0048048 3300037471 Bacteria 3999
378 Ga0395905_0323818 3300037471 Bacteria 1431
379 Ga0395905_0650156 3300037471 Bacteria 956
380 Ga0395901_0000608 3300038443 Bacteria 41717
381 Ga0395901_0005869 3300038443 Bacteria 12423
382 Ga0395901_0009856 3300038443 Bacteria 9683
383 Ga0395901_0033769 3300038443 Bacteria 5283
384 Ga0395901_0072850 3300038443 Bacteria 3581
385 Ga0395901_0513691 3300038443 Bacteria 1218
386 Ga0395901_0593873 3300038443 Bacteria 1117
387 Ga0436363_0498253 3300039450 Bacteria 9613
388 Ga0439439_0040867 3300041406 Bacteria 1201
389 Ga0451853_3403525 3300041512 Bacteria 1091
390 Ga0439441_043107 3300042001 Bacteria 910
391 Ga0439432_170637 3300042006 Bacteria 635
392 Ga0450907_016895 3300042146 Bacteria 1217
393 Ga0439446_0004585 3300042156 Bacteria 3505
394 Ga0466965_0080401 3300044683 Bacteria 1647
395 Ga0466963_0432990 3300044694 Bacteria 928
396 Ga0466964_0004587 3300044706 Bacteria 5108
397 Ga0466958_0014240 3300045836 Bacteria 4541
398 Ga0466967_0005405 3300045976 Bacteria 8847
399 Ga0495629_0297317 3300046459 Bacteria 1106
400 Ga0495641_0050391 3300046461 Bacteria 1903
401 Ga0495580_0178884 3300046472 Bacteria 1465
402 Ga0495582_0069503 3300046473 Bacteria 1947
403 Ga0495582_0249321 3300046473 Bacteria 1018
404 Ga0495608_0037016 3300046511 Bacteria 3282
405 Ga0495628_0000864 3300046516 Bacteria 28036
406 Ga0495631_0108437 3300046518 Bacteria 1194
407 Ga0495663_0058419 3300046525 Bacteria 1209
408 Ga0495652_0311155 3300046529 Bacteria 1141
409 Ga0495598_0011640 3300046537 Bacteria 2139
410 Ga0495598_0020881 3300046537 Bacteria 1735
411 Ga0495621_0003232 3300046539 Bacteria 4478
412 Ga0495621_0007620 3300046539 Bacteria 3213
413 Ga0495656_0236034 3300046615 Bacteria 919
414 Ga0495625_0000109 3300046660 Bacteria 125064
415 Ga0495647_0044024 3300046681 Bacteria 1710
416 Ga0495658_0253694 3300046683 Bacteria 1107
417 Ga0495613_0179845 3300046689 Bacteria 1498
418 Ga0495589_0405885 3300046794 Bacteria 625
419 Ga0495672_0103504 3300047320 Bacteria 1540
420 Ga0495676_0082052 3300047321 Bacteria 2441
421 Ga0495680_0433016 3300047322 Bacteria 903
422 Ga0495602_0003702 3300048088 Bacteria 15861
423 Ga0496101_0020085 3300048904 Bacteria 4568
424 Ga0496102_0113199 3300048905 Bacteria 2531
425 Ga0496103_0180619 3300048906 Bacteria 1356
426 Ga0496104_0004171 3300048907 Bacteria 12543
427 Ga0496104_0036479 3300048907 Bacteria 4597
428 Ga0496104_0144557 3300048907 Bacteria 2284
429 Ga0496104_0286930 3300048907 Bacteria 1558
430 Ga0496104_0313047 3300048907 Bacteria 1483
431 Ga0496105_0073103 3300048908 Bacteria 2833
432 Ga0496106_0203026 3300048909 Bacteria 1578
433 Ga0496106_0869023 3300048909 Bacteria 713
434 Ga0496107_0085981 3300048910 Bacteria 2295
435 Ga0496108_0030984 3300048911 Bacteria 4433
436 Ga0496109_0001046 3300048912 Bacteria 22890
437 Ga0496109_0409228 3300048912 Bacteria 1282
438 Ga0496109_0478288 3300048912 Bacteria 1176
439 Ga0496109_0858826 3300048912 Bacteria 845
440 Ga0496109_0863305 3300048912 Bacteria 843
441 Ga0496110_0023971 3300048913 Bacteria 5197
442 Ga0496110_0044560 3300048913 Bacteria 3874
443 Ga0496110_0289792 3300048913 Bacteria 1491
444 Ga0496110_0807903 3300048913 Bacteria 842
445 Ga0496111_0013650 3300048914 Bacteria 5534
446 Ga0496111_0033779 3300048914 Bacteria 3649
447 Ga0496111_0116205 3300048914 Bacteria 1973
448 Ga0496112_0020180 3300048915 Bacteria 6311
449 Ga0496113_0070012 3300048916 Bacteria 2665
450 Ga0496113_0558675 3300048916 Bacteria 918
451 Ga0496114_0124403 3300048917 Bacteria 2221
452 Ga0496115_0066743 3300048918 Bacteria 2908
453 Ga0496118_0123676 3300048921 Bacteria 1680
454 Ga0496126_0128675 3300048929 Bacteria 2190
455 Ga0501031_0088981 3300049568 Bacteria 2013
456 Ga0501032_0078142 3300049569 Bacteria 2203
457 Ga0501033_0239283 3300049570 Bacteria 1288
458 Ga0501036_0030174 3300049572 Bacteria 4581
459 Ga0501036_0261058 3300049572 Bacteria 1451
460 Ga0501036_0370468 3300049572 Bacteria 1195
461 Ga0501037_0195276 3300049573 Bacteria 1432
462 Ga0501038_0064358 3300049574 Bacteria 3127
463 Ga0501039_0074777 3300049575 Bacteria 2633
464 Ga0501039_0099046 3300049575 Bacteria 2275
465 Ga0501040_0273674 3300049576 Bacteria 1206
466 Ga0501041_0165312 3300049577 Bacteria 1384
467 Ga0501041_0239829 3300049577 Bacteria 1139
468 Ga0501041_0347148 3300049577 Bacteria 937
469 Ga0501042_0035728 3300049578 Bacteria 3525
470 Ga0501042_0080578 3300049578 Bacteria 2332
471 Ga0501047_0040997 3300049581 Bacteria 4475
472 Ga0501047_0229954 3300049581 Bacteria 1708
473 Ga0501048_0045135 3300049582 Bacteria 3149
474 Ga0501048_0114451 3300049582 Bacteria 1905
475 Ga0501048_0681164 3300049582 Bacteria 738
476 Ga0501067_0007685 3300049583 Bacteria 5996
477 Ga0501069_0001064 3300049585 Bacteria 13167
478 Ga0501069_0135705 3300049585 Bacteria 1410
479 Ga0501069_0163824 3300049585 Bacteria 1281
480 Ga0501070_0001356 3300049586 Bacteria 21938
481 Ga0501070_0262614 3300049586 Bacteria 1411
482 Ga0501071_0005936 3300049587 Bacteria 7901
483 Ga0501071_0113761 3300049587 Bacteria 2001
484 Ga0501071_0225069 3300049587 Bacteria 1412
485 Ga0501071_0268774 3300049587 Bacteria 1289
486 Ga0501071_0295470 3300049587 Bacteria 1227
487 Ga0501071_0552800 3300049587 Bacteria 884
488 Ga0501071_0568526 3300049587 Bacteria 871
489 Ga0501072_0028773 3300049588 Bacteria 4338
490 Ga0501072_0131588 3300049588 Bacteria 1994
491 Ga0501072_0176075 3300049588 Bacteria 1706
492 Ga0501073_0000321 3300049589 Bacteria 32033
493 Ga0501073_0008056 3300049589 Bacteria 7819
494 Ga0501073_0234408 3300049589 Bacteria 1268
495 Ga0501074_0000097 3300049590 Bacteria 42311
496 Ga0501074_0486723 3300049590 Bacteria 874
497 Ga0501075_0024398 3300049591 Bacteria 4434
498 Ga0501075_0050657 3300049591 Bacteria 3121
499 Ga0501075_0059923 3300049591 Bacteria 2868
500 Ga0501075_0177394 3300049591 Bacteria 1626
501 Ga0501076_0044620 3300049592 Bacteria 3496
502 Ga0501076_0045816 3300049592 Bacteria 3453
503 Ga0501076_0047645 3300049592 Bacteria 3389
504 Ga0501076_0201287 3300049592 Bacteria 1626
505 Ga0501076_0243582 3300049592 Bacteria 1471
506 Ga0501076_0409028 3300049592 Bacteria 1116
507 Ga0501077_0082333 3300049593 Bacteria 2039
508 Ga0501077_0224189 3300049593 Bacteria 1195
509 Ga0501079_0009081 3300049741 Bacteria 7529
510 Ga0501079_0033610 3300049741 Bacteria 3945
511 Ga0501079_0039713 3300049741 Bacteria 3630
512 Ga0501079_0062866 3300049741 Bacteria 2863
513 Ga0501079_0090710 3300049741 Bacteria 2368
514 Ga0501079_0241649 3300049741 Bacteria 1411
515 Ga0501079_0291398 3300049741 Bacteria 1276
516 Ga0501080_0001428 3300049742 Bacteria 20060
517 Ga0501080_0011166 3300049742 Bacteria 8223
518 Ga0501080_0145010 3300049742 Bacteria 2195
519 Ga0501080_0192882 3300049742 Bacteria 1872
520 Ga0501080_0386668 3300049742 Bacteria 1260
521 Ga0501080_0733350 3300049742 Bacteria 870
522 Ga0501081_0017769 3300049743 Bacteria 4713
523 Ga0501081_0031168 3300049743 Bacteria 3613
524 Ga0501081_0222270 3300049743 Bacteria 1373
525 Ga0501081_0405089 3300049743 Bacteria 1010
526 Ga0501083_0004051 3300049744 Bacteria 10308
527 Ga0501035_0123252 3300049822 Bacteria 2264
528 Ga0501035_0157565 3300049822 Bacteria 1967
529 Ga0501035_0219973 3300049822 Bacteria 1622
530 Ga0501035_0854993 3300049822 Bacteria 723
531 Ga0501044_0217134 3300049823 Bacteria 1864
532 Ga0501044_1064687 3300049823 Bacteria 679
533 Ga0501045_0077628 3300049824 Bacteria 2447
534 Ga0501045_0236958 3300049824 Bacteria 1358
535 Ga0501045_0257870 3300049824 Bacteria 1298
536 Ga0501045_0363386 3300049824 Bacteria 1077
537 nmdc:mga03683_93487_c1 3300050489 Bacteria 1313
538 nmdc:mga00v17_5329_c1 3300050491 Bacteria 6775
539 nmdc:mga0yw44_157392_c1 3300050492 Bacteria 1485
540 nmdc:mga0yw44_3077_c1 3300050492 Bacteria 7306
541 nmdc:mga0yw44_36915_c1 3300050492 Bacteria 2882
542 nmdc:mga0k408_13809_c1 3300050493 Bacteria 4436
543 nmdc:mga0k408_1928_c1 3300050493 Bacteria 11118
544 nmdc:mga05p37_19710_c1 3300050507 Bacteria 8160
545 nmdc:mga05p37_27608_c1 3300050507 Bacteria 6913
546 nmdc:mga05p37_393889_c1 3300050507 Bacteria 1619
547 nmdc:mga05p37_788941_c1 3300050507 Bacteria 1041
548 nmdc:mga09592_133603_c1 3300050508 Bacteria 2136
549 nmdc:mga0qj67_83118_c1 3300050509 Bacteria 2567
550 nmdc:mga06r32_198902_c1 3300050510 Bacteria 1992
551 nmdc:mga08y16_11064_c1 3300050511 Bacteria 9474
552 nmdc:mga08y16_170967_c1 3300050511 Bacteria 2257
553 nmdc:mga08y16_17581_c1 3300050511 Bacteria 7532
554 nmdc:mga08y16_374461_c1 3300050511 Bacteria 1460
555 nmdc:mga08y16_378054_c1 3300050511 Bacteria 1452
556 nmdc:mga08y16_81215_c1 3300050511 Bacteria 3380
557 nmdc:mga0n895_149141_c1 3300050512 Bacteria 2368
558 nmdc:mga0n895_158049_c1 3300050512 Bacteria 2298
559 nmdc:mga0n895_386018_c1 3300050512 Bacteria 1417
560 nmdc:mga0n895_40300_c1 3300050512 Bacteria 4537
561 nmdc:mga0n895_45630_c1 3300050512 Bacteria 4277
562 nmdc:mga0n895_512190_c1 3300050512 Bacteria 1208
563 nmdc:mga0rr50_111313_c1 3300050513 Bacteria 2167
564 nmdc:mga0rr50_1901_c1 3300050513 Bacteria 11593
565 nmdc:mga08x19_14562_c1 3300050514 Bacteria 4771
566 nmdc:mga08x19_2026_c1 3300050514 Bacteria 12425
567 nmdc:mga08x19_285719_c1 3300050514 Bacteria 1144
568 nmdc:mga0a205_146054_c1 3300050515 Bacteria 2265
569 nmdc:mga0a205_7331_c1 3300050515 Bacteria 9985
570 nmdc:mga0sz30_1133_c1 3300050516 Bacteria 9551
571 Ga0500641_0008546 3300053096 Bacteria 3658
572 Ga0501084_0021259 3300054114 Bacteria 5410
573 Ga0501084_0129594 3300054114 Bacteria 2123
574 Ga0501084_0220205 3300054114 Bacteria 1601
575 Ga0501084_0401447 3300054114 Bacteria 1158
576 Ga0501082_0070390 3300060353 Bacteria 3012
577 Ga0501082_0072001 3300060353 Bacteria 2977
578 Ga0501082_0073915 3300060353 Bacteria 2935
579 Ga0501082_0846532 3300060353 Bacteria 800
580 Ga0501082_0865579 3300060353 Bacteria 790
581 Ga0530510_0006651 3300061734 Bacteria 8063
582 Ga0530510_0018622 3300061734 Bacteria 4923
583 Ga0530510_0056671 3300061734 Bacteria 2831
584 Ga0530510_0070582 3300061734 Bacteria 2535
585 Ga0530510_0330134 3300061734 Bacteria 1144
586 nmdc:mga05p37_650826_c1
587 JGI25406J46586_10009512
588 JGI25407J50210_10011363
589 Ga0065715_10147379
590 Ga0070658_10253392
591 Ga0070676_10037090
592 Ga0070683_100314250
593 Ga0070670_100002726
594 Ga0070670_100702187
595 Ga0070677_10004529
596 Ga0068869_100165469
597 Ga0070666_10020483
598 Ga0070666_10042517
599 Ga0068868_100464117
600 Ga0070689_100018801
601 Ga0070689_100359837
602 Ga0070661_100114078
603 Ga0070668_100012868
604 Ga0070669_100102281
605 Ga0070675_100031032
606 Ga0070674_100014259
607 Ga0070674_100219712
608 Ga0070673_100066457
609 Ga0070673_100161776
610 Ga0070688_100062951
611 Ga0070688_100245927
612 Ga0070659_100097880
613 Ga0070667_100001611
614 Ga0070667_100048136
615 Ga0070667_100097551
616 Ga0070709_10015515
617 Ga0070714_100009500
618 Ga0070714_100039749
619 Ga0070714_100388700
620 Ga0070713_100001795
621 Ga0070713_100005685
622 Ga0070713_100163538
623 Ga0070713_100193708
624 Ga0070711_100380163
625 Ga0070700_100016206
626 Ga0070700_100088583
627 Ga0070694_100919813
628 Ga0070708_100044414
629 Ga0070708_100270554
630 Ga0070678_100005141
631 Ga0070678_100006691
632 Ga0070678_100021374
633 Ga0070662_100031910
634 Ga0070681_10007099
635 Ga0070681_10010917
636 Ga0068867_100522388
637 Ga0070685_10036875
638 Ga0070685_10119525
639 Ga0070706_100004600
640 Ga0070707_100064367
641 Ga0070698_100129739
642 Ga0070698_100323539
643 Ga0070699_100057447
644 Ga0070699_100068029
645 Ga0070699_100146878
646 Ga0070699_100266738
647 Ga0070699_100866728
648 Ga0070679_100085474
649 Ga0070684_100632454
650 Ga0070697_100169968
651 Ga0068853_100031768
652 Ga0070672_100005015
653 Ga0070686_100067971
654 Ga0070693_100037693
655 Ga0070665_100009861
656 Ga0070665_100022127
657 Ga0070665_100243577
658 Ga0070704_100407482
659 Ga0068855_100056659
660 Ga0068855_100375706
661 Ga0068855_101123421
662 Ga0068857_100012217
663 Ga0068854_100729252
664 Ga0070702_100012107
665 Ga0068852_100428745
666 Ga0068859_100046188
667 Ga0068859_100130549
668 Ga0068859_100647831
669 Ga0068864_100116524
670 Ga0068864_100898083
671 Ga0068861_100208882
672 Ga0068861_100230782
673 Ga0068861_100334365
674 Ga0068861_100336057
675 Ga0068861_100985067
676 Ga0068851_10031533
677 Ga0068851_10176404
678 Ga0068870_10209898
679 Ga0068863_100514679
680 Ga0068858_100447954
681 Ga0068858_100744003
682 Ga0068860_100071954
683 Ga0068860_100170761
684 Ga0068862_100001247
685 Ga0081455_10006416
686 Ga0081455_10011092
687 Ga0081455_10017464
688 Ga0081455_10019985
689 Ga0081455_10093962
690 Ga0081455_10165120
691 Ga0081538_10001246
692 Ga0081538_10008306
693 Ga0081538_10022726
694 Ga0081538_10026960
695 Ga0081538_10076379
696 Ga0081539_10014550
697 Ga0070717_10062172
698 Ga0070717_10075652
699 Ga0075432_10034224
700 Ga0070716_100003910
701 Ga0070716_100272621
702 Ga0070712_100044366
703 Ga0070712_100078635
704 Ga0075366_10007118
705 Ga0075366_10016904
706 Ga0097621_100180965
707 Ga0097621_100204046
708 Ga0068871_100066382
709 Ga0068871_100092374
710 Ga0068871_100111438
711 Ga0068871_100340751
712 Ga0075428_100132743
713 Ga0075428_100236127
714 Ga0075430_100049708
715 Ga0075431_100075040
716 Ga0075431_100348704
717 Ga0075434_100036821
718 Ga0075434_100239451
719 Ga0075434_100279007
720 Ga0075434_100716553
721 Ga0068865_100285339
722 Ga0075436_100000862
723 Ga0075436_100018705
724 Ga0097620_100046188
725 Ga0097620_100130553
726 Ga0097620_100253646
727 Ga0097620_100647835
728 Ga0075435_100120900
729 Ga0105240_10152833
730 Ga0105240_10252783
731 Ga0111539_10019077
732 Ga0111539_10021781
733 Ga0111539_10342356
734 Ga0111539_10404617
735 Ga0111539_10690104
736 Ga0105245_10040665
737 Ga0105243_10035000
738 Ga0105243_10245165
739 Ga0105242_10009166
740 Ga0105242_10046503
741 Ga0105242_10716019
742 Ga0105248_10118027
743 Ga0105248_10123110
744 Ga0105248_10627912
745 Ga0105238_10087095
746 Ga0105249_10003640
747 Ga0105249_10363778
748 Ga0099796_10005277
749 Ga0105239_10270107
750 Ga0105246_10260205
751 Ga0157370_10090984
752 Ga0157369_10006334
753 Ga0157374_10054005
754 Ga0157374_10138530
755 Ga0157374_10610582
756 Ga0157378_10043237
757 Ga0157378_10059479
758 Ga0157378_10096241
759 Ga0157378_10124450
760 Ga0157378_10153148
761 Ga0157378_10694815
762 Ga0163162_10086874
763 Ga0163162_10278343
764 Ga0163162_10446724
765 Ga0157372_10202803
766 Ga0157375_10173624
767 Ga0157375_11155259
768 Ga0157375_11753018
769 Ga0163163_10278391
770 Ga0163163_10377128
771 Ga0157380_10026469
772 Ga0157377_10014255
773 Ga0157377_10172095
774 Ga0157379_10035775
775 Ga0157379_10079870
776 Ga0157376_10501861
777 Ga0163161_10045011
778 Ga0207697_10001157
779 Ga0207656_10001578
780 Ga0207656_10019865
781 Ga0207682_10006357
782 Ga0207682_10055309
783 Ga0207692_10395199
784 Ga0207688_10002803
785 Ga0207688_10040537
786 Ga0207680_10054402
787 Ga0207680_10067863
788 Ga0207680_10118155
789 Ga0207647_10089936
790 Ga0207699_10069854
791 Ga0207645_10004332
792 Ga0207645_10250537
793 Ga0207643_10001343
794 Ga0207705_10172434
795 Ga0207705_10230349
796 Ga0207684_10011106
797 Ga0207654_10015846
798 Ga0207707_10005674
799 Ga0207707_10015921
800 Ga0207707_10192474
801 Ga0207695_10045231
802 Ga0207695_10725986
803 Ga0207693_10043512
804 Ga0207693_10096919
805 Ga0207693_10304066
806 Ga0207693_10509639
807 Ga0207663_10045973
808 Ga0207663_10050037
809 Ga0207662_10050088
810 Ga0207662_10073771
811 Ga0207657_10109580
812 Ga0207649_10101163
813 Ga0207652_10155677
814 Ga0207652_10258193
815 Ga0207652_10287808
816 Ga0207646_10027133
817 Ga0207646_10363419
818 Ga0207694_10007098
819 Ga0207659_10001704
820 Ga0207687_10165671
821 Ga0207687_10194600
822 Ga0207700_10000001
823 Ga0207700_10003066
824 Ga0207700_10445848
825 Ga0207664_10007010
826 Ga0207664_10110540
827 Ga0207664_10426798
828 Ga0207644_10136885
829 Ga0207706_10006693
830 Ga0207686_10018577
831 Ga0207686_10237938
832 Ga0207670_10146182
833 Ga0207669_10065481
834 Ga0207669_10077737
835 Ga0207704_10108464
836 Ga0207704_10270843
837 Ga0207704_10370622
838 Ga0207665_10088164
839 Ga0207665_10088305
840 Ga0207691_10008862
841 Ga0207691_10010153
842 Ga0207691_10035592
843 Ga0207711_10084852
844 Ga0207711_10091045
845 Ga0207711_10122120
846 Ga0207689_10008334
847 Ga0207689_10046684
848 Ga0207689_10181155
849 Ga0207661_10260052
850 Ga0207661_10426537
851 Ga0207679_10513844
852 Ga0207667_10019150
853 Ga0207667_10223167
854 Ga0207651_10184977
855 Ga0207651_10251978
856 Ga0207651_10367236
857 Ga0207712_10003459
858 Ga0207712_10104420
859 Ga0207668_10002563
860 Ga0207668_10073886
861 Ga0207668_10122678
862 Ga0207640_10618427
863 Ga0207658_10000840
864 Ga0207658_10030611
865 Ga0207703_10586810
866 Ga0207639_10323530
867 Ga0207708_10005800
868 Ga0207702_10140039
869 Ga0207641_10078861
870 Ga0207648_10008905
871 Ga0207676_10018878
872 Ga0207676_10527716
873 Ga0207676_10759764
874 Ga0207674_10022377
875 Ga0207674_10058297
876 Ga0207675_100006269
877 Ga0207675_100125589
878 Ga0207683_10007403
879 Ga0207683_10008690
880 Ga0207698_10025800
881 Ga0207698_10214366
882 Ga0207698_10767346
883 Ga0207428_10007467
884 Ga0207428_10145127
885 Ga0207428_10236826
886 Ga0268266_10001628
887 Ga0268266_10006169
888 Ga0268266_10380414
889 Ga0268265_10000667
890 Ga0268265_10247238
891 Ga0268264_10431947
892 Ga0265337_1037670
893 Ga0265319_1000030
894 Ga0265319_1001800
895 Ga0265334_10015907
896 Ga0265318_10002940
897 Ga0265318_10004027
898 Ga0265318_10030930
899 Ga0265322_10015941
900 Ga0265338_10000156
901 Ga0265338_10006510
902 Ga0265338_10017394
903 Ga0265338_10154817
904 Ga0265324_10039877
905 Ga0265332_10002675
906 Ga0265328_10035883
907 Ga0265320_10033040
908 Ga0265320_10046676
909 Ga0265325_10024792
910 Ga0265325_10074450
911 Ga0265329_10005644
912 Ga0265329_10023036
913 Ga0265340_10018011
914 Ga0265339_10118988
915 Ga0265331_10004043
916 Ga0265331_10044959
917 Ga0265327_10001971
918 Ga0265327_10006243
919 Ga0265327_10060671
920 Ga0265327_10210607
921 Ga0265316_10009161
922 Ga0265316_10029265
923 Ga0265313_10055372
924 Ga0265314_10000765
925 Ga0265314_10006724
926 Ga0265342_10011897
927 Ga0265342_10065682
928 Ga0265342_10074519
929 Ga0307405_10005729
930 Ga0307405_10039831
931 Ga0307406_10125836
932 Ga0307406_10351973
933 Ga0307407_10926402
934 Ga0307409_100077068
935 Ga0307416_100279359
936 Ga0307414_10277386
937 Ga0307415_100036284
938 Ga0316586_1026237
939 Ga0373951_0151774
940 Ga0373943_0110785
941 Ga0373931_0079776
942 Ga0373935_0450985
943 Ga0373935_0479284
944 Ga0395899_0013274
945 Ga0395899_0054068
946 Ga0395899_0182217
947 Ga0395900_0005930
948 Ga0395900_0008939
949 Ga0395900_0013779
950 Ga0395900_0026290
951 Ga0395900_0034072
952 Ga0395900_0358545
953 Ga0395898_0016565
954 Ga0395898_0025218
955 Ga0395898_0026248
956 Ga0395898_0104333
957 Ga0395898_0119192
958 Ga0395905_0000698
959 Ga0395905_0012695
960 Ga0395905_0027635
961 Ga0395905_0045213
962 Ga0395905_0048048
963 Ga0395905_0323818
964 Ga0395905_0650156
965 Ga0395901_0000608
966 Ga0395901_0005869
967 Ga0395901_0009856
968 Ga0395901_0033769
969 Ga0395901_0072850
970 Ga0395901_0513691
971 Ga0395901_0593873
972 Ga0436363_0498253
973 Ga0439439_0040867
974 Ga0451853_3403525
975 Ga0439441_043107
976 Ga0439432_170637
977 Ga0450907_016895
978 Ga0439446_0004585
979 Ga0466965_0080401
980 Ga0466963_0432990
981 Ga0466964_0004587
982 Ga0466958_0014240
983 Ga0466967_0005405
984 Ga0495629_0297317
985 Ga0495641_0050391
986 Ga0495580_0178884
987 Ga0495582_0069503
988 Ga0495582_0249321
989 Ga0495608_0037016
990 Ga0495628_0000864
991 Ga0495631_0108437
992 Ga0495663_0058419
993 Ga0495652_0311155
994 Ga0495598_0011640
995 Ga0495598_0020881
996 Ga0495621_0003232
997 Ga0495621_0007620
998 Ga0495656_0236034
999 Ga0495625_0000109
1000 Ga0495647_0044024
1001 Ga0495658_0253694
1002 Ga0495613_0179845
1003 Ga0495589_0405885
1004 Ga0495672_0103504
1005 Ga0495676_0082052
1006 Ga0495680_0433016
1007 Ga0495602_0003702
1008 Ga0496101_0020085
1009 Ga0496102_0113199
1010 Ga0496103_0180619
1011 Ga0496104_0004171
1012 Ga0496104_0036479
1013 Ga0496104_0144557
1014 Ga0496104_0286930
1015 Ga0496104_0313047
1016 Ga0496105_0073103
1017 Ga0496106_0203026
1018 Ga0496106_0869023
1019 Ga0496107_0085981
1020 Ga0496108_0030984
1021 Ga0496109_0001046
1022 Ga0496109_0409228
1023 Ga0496109_0478288
1024 Ga0496109_0858826
1025 Ga0496109_0863305
1026 Ga0496110_0023971
1027 Ga0496110_0044560
1028 Ga0496110_0289792
1029 Ga0496110_0807903
1030 Ga0496111_0013650
1031 Ga0496111_0033779
1032 Ga0496111_0116205
1033 Ga0496112_0020180
1034 Ga0496113_0070012
1035 Ga0496113_0558675
1036 Ga0496114_0124403
1037 Ga0496115_0066743
1038 Ga0496118_0123676
1039 Ga0496126_0128675
1040 Ga0501031_0088981
1041 Ga0501032_0078142
1042 Ga0501033_0239283
1043 Ga0501036_0030174
1044 Ga0501036_0261058
1045 Ga0501036_0370468
1046 Ga0501037_0195276
1047 Ga0501038_0064358
1048 Ga0501039_0074777
1049 Ga0501039_0099046
1050 Ga0501040_0273674
1051 Ga0501041_0165312
1052 Ga0501041_0239829
1053 Ga0501041_0347148
1054 Ga0501042_0035728
1055 Ga0501042_0080578
1056 Ga0501047_0040997
1057 Ga0501047_0229954
1058 Ga0501048_0045135
1059 Ga0501048_0114451
1060 Ga0501048_0681164
1061 Ga0501067_0007685
1062 Ga0501069_0001064
1063 Ga0501069_0135705
1064 Ga0501069_0163824
1065 Ga0501070_0001356
1066 Ga0501070_0262614
1067 Ga0501071_0005936
1068 Ga0501071_0113761
1069 Ga0501071_0225069
1070 Ga0501071_0268774
1071 Ga0501071_0295470
1072 Ga0501071_0552800
1073 Ga0501071_0568526
1074 Ga0501072_0028773
1075 Ga0501072_0131588
1076 Ga0501072_0176075
1077 Ga0501073_0000321
1078 Ga0501073_0008056
1079 Ga0501073_0234408
1080 Ga0501074_0000097
1081 Ga0501074_0486723
1082 Ga0501075_0024398
1083 Ga0501075_0050657
1084 Ga0501075_0059923
1085 Ga0501075_0177394
1086 Ga0501076_0044620
1087 Ga0501076_0045816
1088 Ga0501076_0047645
1089 Ga0501076_0201287
1090 Ga0501076_0243582
1091 Ga0501076_0409028
1092 Ga0501077_0082333
1093 Ga0501077_0224189
1094 Ga0501079_0009081
1095 Ga0501079_0033610
1096 Ga0501079_0039713
1097 Ga0501079_0062866
1098 Ga0501079_0090710
1099 Ga0501079_0241649
1100 Ga0501079_0291398
1101 Ga0501080_0001428
1102 Ga0501080_0011166
1103 Ga0501080_0145010
1104 Ga0501080_0192882
1105 Ga0501080_0386668
1106 Ga0501080_0733350
1107 Ga0501081_0017769
1108 Ga0501081_0031168
1109 Ga0501081_0222270
1110 Ga0501081_0405089
1111 Ga0501083_0004051
1112 Ga0501035_0123252
1113 Ga0501035_0157565
1114 Ga0501035_0219973
1115 Ga0501035_0854993
1116 Ga0501044_0217134
1117 Ga0501044_1064687
1118 Ga0501045_0077628
1119 Ga0501045_0236958
1120 Ga0501045_0257870
1121 Ga0501045_0363386
1122 nmdc:mga03683_93487_c1
1123 nmdc:mga00v17_5329_c1
1124 nmdc:mga0yw44_157392_c1
1125 nmdc:mga0yw44_3077_c1
1126 nmdc:mga0yw44_36915_c1
1127 nmdc:mga0k408_13809_c1
1128 nmdc:mga0k408_1928_c1
1129 nmdc:mga05p37_19710_c1
1130 nmdc:mga05p37_27608_c1
1131 nmdc:mga05p37_393889_c1
1132 nmdc:mga05p37_788941_c1
1133 nmdc:mga09592_133603_c1
1134 nmdc:mga0qj67_83118_c1
1135 nmdc:mga06r32_198902_c1
1136 nmdc:mga08y16_11064_c1
1137 nmdc:mga08y16_170967_c1
1138 nmdc:mga08y16_17581_c1
1139 nmdc:mga08y16_374461_c1
1140 nmdc:mga08y16_378054_c1
1141 nmdc:mga08y16_81215_c1
1142 nmdc:mga0n895_149141_c1
1143 nmdc:mga0n895_158049_c1
1144 nmdc:mga0n895_386018_c1
1145 nmdc:mga0n895_40300_c1
1146 nmdc:mga0n895_45630_c1
1147 nmdc:mga0n895_512190_c1
1148 nmdc:mga0rr50_111313_c1
1149 nmdc:mga0rr50_1901_c1
1150 nmdc:mga08x19_14562_c1
1151 nmdc:mga08x19_2026_c1
1152 nmdc:mga08x19_285719_c1
1153 nmdc:mga0a205_146054_c1
1154 nmdc:mga0a205_7331_c1
1155 nmdc:mga0sz30_1133_c1
1156 Ga0500641_0008546
1157 Ga0501084_0021259
1158 Ga0501084_0129594
1159 Ga0501084_0220205
1160 Ga0501084_0401447
1161 Ga0501082_0070390
1162 Ga0501082_0072001
1163 Ga0501082_0073915
1164 Ga0501082_0846532
1165 Ga0501082_0865579
1166 Ga0530510_0006651
1167 Ga0530510_0018622
1168 Ga0530510_0056671
1169 Ga0530510_0070582
1170 Ga0530510_0330134

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

93

186

0.99

PF00281

Ribosomal_L5

Ribosomal protein L5

33

89

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ns3-assembly1.cif.gz_B crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9801 10 184
5ns3-assembly1.cif.gz_A crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9735 10 184
5ns4-assembly2.cif.gz_B crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9733 10 184
5ns4-assembly1.cif.gz_A crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9731 10 184
5ns3-assembly1.cif.gz_B crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9593 10 184
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9146 11 184 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8951 11 184 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8777 33 184 3.30.1440.10
1jj2D00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8769 33 165 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8727 29 186 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A3N5Q500-F1-model_v4 50S ribosomal protein L5 0.9605 9 129 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-F8KQ75-F1-model_v4 50S ribosomal protein L5 0.9566 11 129 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A0N0I4K0-F1-model_v4 deleted 0.9554 10 165
AF-A0A3B9SJT6-F1-model_v4 50S ribosomal protein L5 0.952 7 123 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7X4AP54-F1-model_v4 50S ribosomal protein L5 0.9514 9 138 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map