F466505
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 585 | 231 | 585 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300050515|nmdc:mga0a205_66366_c1|nmdc:mga0a205_66366_c1_539_1504 |
| Length | 308 |
| Sequence | MLLSFLVFIFALFLVLGAYLAATHSTDSKRKKLQKRLSEALLHSAHTEDIDVILARNELMSEIPALNRLLVRVHTALQLKRMLDQADLHITPSRLIMFSAMASLPLIILGGVVAAMLPFLHVWWKRRQRFNQFLEHLPDALELMSRALSAGHAFSEALHMVAEEMPEPISGEFRKTYEEQNLGLSLKLALENLMERIPLLDLRMCVTAVLIQRETGGNLGEILEKVSYTIRERFRIMGDLKTLTTSSRLSAWLLCGLPIFVAIAVTFMNPDYMAVLWKDPRGHYLIAAALSMQITGMLIVRKILNIKI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 164 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 169 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 176 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 177 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 178 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 179 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 186 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 187 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 190 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 191 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 192 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 193 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 194 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 195 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 198 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 199 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 200 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 201 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 202 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 203 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 204 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 205 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 206 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 207 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 208 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 209 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 210 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 211 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 212 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 213 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 214 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 215 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 216 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 217 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 219 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 220 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 221 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 222 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 223 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 224 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.03 |
| Rhizosphere | 98.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1000248 | 3300000532 | Bacteria | 5117 |
| 2 | JGI24751J29686_10000016 | 3300002459 | Bacteria | 112162 |
| 3 | JGI24751J29686_10000049 | 3300002459 | Bacteria | 69226 |
| 4 | JGI25406J46586_10001054 | 3300003203 | Bacteria | 12938 |
| 5 | JGI25406J46586_10064679 | 3300003203 | Bacteria | 1168 |
| 6 | rootL2_10161821 | 3300003322 | Bacteria | 3726 |
| 7 | Ga0065704_10004321 | 3300005289 | Bacteria | 5595 |
| 8 | Ga0065704_10089428 | 3300005289 | Bacteria | 2846 |
| 9 | Ga0065712_10003404 | 3300005290 | Bacteria | 5240 |
| 10 | Ga0065712_10011796 | 3300005290 | Bacteria | 3591 |
| 11 | Ga0065715_10001666 | 3300005293 | Bacteria | 5800 |
| 12 | Ga0065715_10018816 | 3300005293 | Bacteria | 3373 |
| 13 | Ga0065715_10024130 | 3300005293 | Bacteria | 1581 |
| 14 | Ga0065715_10089743 | 3300005293 | Bacteria | 8643 |
| 15 | Ga0065715_10095439 | 3300005293 | Bacteria | 4080 |
| 16 | Ga0065715_10098517 | 3300005293 | Bacteria | 3536 |
| 17 | Ga0065715_10147560 | 3300005293 | Bacteria | 1761 |
| 18 | Ga0065707_10001657 | 3300005295 | Bacteria | 6678 |
| 19 | Ga0065707_10091765 | 3300005295 | Bacteria | 3882 |
| 20 | Ga0065707_10164701 | 3300005295 | Bacteria | 1527 |
| 21 | Ga0070676_10017855 | 3300005328 | Bacteria | 3928 |
| 22 | Ga0070676_10109582 | 3300005328 | Bacteria | 1718 |
| 23 | Ga0070690_100002689 | 3300005330 | Bacteria | 9586 |
| 24 | Ga0070690_100012650 | 3300005330 | Bacteria | 4968 |
| 25 | Ga0070690_100014555 | 3300005330 | Bacteria | 4669 |
| 26 | Ga0070690_100041559 | 3300005330 | Bacteria | 2911 |
| 27 | Ga0070670_100001702 | 3300005331 | Bacteria | 17907 |
| 28 | Ga0070670_100002456 | 3300005331 | Bacteria | 15283 |
| 29 | Ga0070670_100054997 | 3300005331 | Bacteria | 3416 |
| 30 | Ga0070670_100103903 | 3300005331 | Bacteria | 2447 |
| 31 | Ga0068869_100005586 | 3300005334 | Bacteria | 7914 |
| 32 | Ga0068869_100104809 | 3300005334 | Bacteria | 2144 |
| 33 | Ga0068869_100221231 | 3300005334 | Bacteria | 1501 |
| 34 | Ga0068869_100440135 | 3300005334 | Bacteria | 1079 |
| 35 | Ga0070666_10018711 | 3300005335 | Bacteria | 4459 |
| 36 | Ga0070680_100020042 | 3300005336 | Bacteria | 5302 |
| 37 | Ga0070682_100000088 | 3300005337 | Bacteria | 83442 |
| 38 | Ga0070682_100020603 | 3300005337 | Bacteria | 3883 |
| 39 | Ga0068868_100021324 | 3300005338 | Bacteria | 4879 |
| 40 | Ga0068868_100022838 | 3300005338 | Bacteria | 4728 |
| 41 | Ga0070660_100019722 | 3300005339 | Bacteria | 4945 |
| 42 | Ga0070689_100000707 | 3300005340 | Bacteria | 20291 |
| 43 | Ga0070689_100038467 | 3300005340 | Bacteria | 3660 |
| 44 | Ga0070689_100210778 | 3300005340 | Bacteria | 1590 |
| 45 | Ga0070689_100325994 | 3300005340 | Unclassified | 1284 |
| 46 | Ga0070687_100013620 | 3300005343 | Bacteria | 3629 |
| 47 | Ga0070692_10007499 | 3300005345 | Unclassified | 4806 |
| 48 | Ga0070692_10050172 | 3300005345 | Bacteria | 2166 |
| 49 | Ga0070668_100023596 | 3300005347 | Bacteria | 4654 |
| 50 | Ga0070669_100005009 | 3300005353 | Bacteria | 9569 |
| 51 | Ga0070669_100005360 | 3300005353 | Bacteria | 9253 |
| 52 | Ga0070669_100050656 | 3300005353 | Bacteria | 3034 |
| 53 | Ga0070669_100159549 | 3300005353 | Bacteria | 1751 |
| 54 | Ga0070675_100048607 | 3300005354 | Bacteria | 3479 |
| 55 | Ga0070675_100081208 | 3300005354 | Bacteria | 2703 |
| 56 | Ga0070671_100252731 | 3300005355 | Bacteria | 1497 |
| 57 | Ga0070673_100001840 | 3300005364 | Bacteria | 12678 |
| 58 | Ga0070673_100041566 | 3300005364 | Bacteria | 3537 |
| 59 | Ga0070673_100392882 | 3300005364 | Bacteria | 1239 |
| 60 | Ga0070688_100180868 | 3300005365 | Bacteria | 1462 |
| 61 | Ga0070659_100004894 | 3300005366 | Bacteria | 9573 |
| 62 | Ga0070701_10028279 | 3300005438 | Bacteria | 2755 |
| 63 | Ga0070701_10066848 | 3300005438 | Bacteria | 1911 |
| 64 | Ga0070701_10099823 | 3300005438 | Bacteria | 1606 |
| 65 | Ga0070701_10132937 | 3300005438 | Bacteria | 1415 |
| 66 | Ga0070705_100012146 | 3300005440 | Bacteria | 4369 |
| 67 | Ga0070705_100084455 | 3300005440 | Bacteria | 1959 |
| 68 | Ga0070700_100000005 | 3300005441 | Bacteria | 233160 |
| 69 | Ga0070700_100005202 | 3300005441 | Bacteria | 6877 |
| 70 | Ga0070700_100056026 | 3300005441 | Bacteria | 2470 |
| 71 | Ga0070700_100057362 | 3300005441 | Bacteria | 2444 |
| 72 | Ga0070700_100129297 | 3300005441 | Bacteria | 1702 |
| 73 | Ga0070700_100237035 | 3300005441 | Bacteria | 1302 |
| 74 | Ga0070694_100033130 | 3300005444 | Bacteria | 3397 |
| 75 | Ga0070694_100067981 | 3300005444 | Bacteria | 2447 |
| 76 | Ga0070694_100072084 | 3300005444 | Bacteria | 2382 |
| 77 | Ga0070694_100083466 | 3300005444 | Bacteria | 2227 |
| 78 | Ga0070694_100093984 | 3300005444 | Bacteria | 2109 |
| 79 | Ga0070694_100094917 | 3300005444 | Bacteria | 2099 |
| 80 | Ga0070694_100112576 | 3300005444 | Bacteria | 1941 |
| 81 | Ga0070694_100116843 | 3300005444 | Bacteria | 1908 |
| 82 | Ga0070694_100121614 | 3300005444 | Bacteria | 1874 |
| 83 | Ga0070694_100153350 | 3300005444 | Bacteria | 1684 |
| 84 | Ga0070694_100161701 | 3300005444 | Bacteria | 1643 |
| 85 | Ga0070708_100000147 | 3300005445 | Bacteria | 48675 |
| 86 | Ga0070708_100085454 | 3300005445 | Bacteria | 2863 |
| 87 | Ga0070708_100196576 | 3300005445 | Bacteria | 1887 |
| 88 | Ga0070678_100205433 | 3300005456 | Bacteria | 1628 |
| 89 | Ga0070662_100240709 | 3300005457 | Unclassified | 1451 |
| 90 | Ga0070681_10003280 | 3300005458 | Bacteria | 15110 |
| 91 | Ga0070681_10017543 | 3300005458 | Bacteria | 7154 |
| 92 | Ga0070681_10144463 | 3300005458 | Bacteria | 2309 |
| 93 | Ga0068867_100017874 | 3300005459 | Bacteria | 5037 |
| 94 | Ga0068867_100045417 | 3300005459 | Bacteria | 3222 |
| 95 | Ga0068867_100183472 | 3300005459 | Bacteria | 1665 |
| 96 | Ga0068867_100325581 | 3300005459 | Bacteria | 1274 |
| 97 | Ga0070685_10006707 | 3300005466 | Bacteria | 5876 |
| 98 | Ga0070706_100000085 | 3300005467 | Bacteria | 108868 |
| 99 | Ga0070706_100001794 | 3300005467 | Bacteria | 22223 |
| 100 | Ga0070706_100034202 | 3300005467 | Bacteria | 4693 |
| 101 | Ga0070707_100009346 | 3300005468 | Bacteria | 9100 |
| 102 | Ga0070707_100023548 | 3300005468 | Bacteria | 5823 |
| 103 | Ga0070707_100125538 | 3300005468 | Bacteria | 2493 |
| 104 | Ga0070698_100011920 | 3300005471 | Bacteria | 9224 |
| 105 | Ga0070698_100051202 | 3300005471 | Bacteria | 4207 |
| 106 | Ga0070699_100002774 | 3300005518 | Bacteria | 15628 |
| 107 | Ga0070699_100005204 | 3300005518 | Bacteria | 11434 |
| 108 | Ga0070699_100130238 | 3300005518 | Bacteria | 2218 |
| 109 | Ga0070699_100202158 | 3300005518 | Bacteria | 1767 |
| 110 | Ga0070699_100266586 | 3300005518 | Bacteria | 1532 |
| 111 | Ga0070697_100000185 | 3300005536 | Bacteria | 51425 |
| 112 | Ga0070697_100000205 | 3300005536 | Bacteria | 48600 |
| 113 | Ga0070697_100001795 | 3300005536 | Bacteria | 16382 |
| 114 | Ga0070697_100060250 | 3300005536 | Bacteria | 3093 |
| 115 | Ga0070697_100168950 | 3300005536 | Unclassified | 1850 |
| 116 | Ga0070697_100169394 | 3300005536 | Bacteria | 1848 |
| 117 | Ga0070697_100330745 | 3300005536 | Unclassified | 1313 |
| 118 | Ga0068853_100034440 | 3300005539 | Bacteria | 4298 |
| 119 | Ga0068853_100046864 | 3300005539 | Bacteria | 3708 |
| 120 | Ga0070672_100031586 | 3300005543 | Bacteria | 3987 |
| 121 | Ga0070672_100100828 | 3300005543 | Bacteria | 2342 |
| 122 | Ga0070672_100257069 | 3300005543 | Bacteria | 1472 |
| 123 | Ga0070686_100004398 | 3300005544 | Bacteria | 7772 |
| 124 | Ga0070686_100006843 | 3300005544 | Bacteria | 6348 |
| 125 | Ga0070686_100026432 | 3300005544 | Bacteria | 3504 |
| 126 | Ga0070695_100006453 | 3300005545 | Bacteria | 6937 |
| 127 | Ga0070695_100021763 | 3300005545 | Bacteria | 3928 |
| 128 | Ga0070695_100342451 | 3300005545 | Bacteria | 1118 |
| 129 | Ga0070695_100379992 | 3300005545 | Bacteria | 1066 |
| 130 | Ga0070696_100026844 | 3300005546 | Bacteria | 3919 |
| 131 | Ga0070696_100039140 | 3300005546 | Unclassified | 3274 |
| 132 | Ga0070696_100078803 | 3300005546 | Unclassified | 2330 |
| 133 | Ga0070696_100228828 | 3300005546 | Bacteria | 1398 |
| 134 | Ga0070693_100001191 | 3300005547 | Bacteria | 11706 |
| 135 | Ga0070693_100039689 | 3300005547 | Bacteria | 2639 |
| 136 | Ga0070693_100044511 | 3300005547 | Bacteria | 2512 |
| 137 | Ga0070693_100101520 | 3300005547 | Bacteria | 1753 |
| 138 | Ga0070693_100140309 | 3300005547 | Bacteria | 1520 |
| 139 | Ga0070704_100187566 | 3300005549 | Bacteria | 1659 |
| 140 | Ga0070704_100301802 | 3300005549 | Unclassified | 1334 |
| 141 | Ga0070664_100001504 | 3300005564 | Bacteria | 18579 |
| 142 | Ga0070664_100226889 | 3300005564 | Bacteria | 1673 |
| 143 | Ga0068857_100001572 | 3300005577 | Bacteria | 18294 |
| 144 | Ga0068854_100137918 | 3300005578 | Bacteria | 1869 |
| 145 | Ga0068854_100177985 | 3300005578 | Bacteria | 1659 |
| 146 | Ga0070702_100007094 | 3300005615 | Bacteria | 5346 |
| 147 | Ga0070702_100023679 | 3300005615 | Bacteria | 3266 |
| 148 | Ga0070702_100141195 | 3300005615 | Bacteria | 1534 |
| 149 | Ga0070702_100144443 | 3300005615 | Bacteria | 1519 |
| 150 | Ga0070702_100149802 | 3300005615 | Bacteria | 1496 |
| 151 | Ga0070702_100324277 | 3300005615 | Bacteria | 1074 |
| 152 | Ga0068852_100061730 | 3300005616 | Unclassified | 3258 |
| 153 | Ga0068859_100043326 | 3300005617 | Bacteria | 4523 |
| 154 | Ga0068859_100052684 | 3300005617 | Bacteria | 4092 |
| 155 | Ga0068859_100060989 | 3300005617 | Bacteria | 3800 |
| 156 | Ga0068859_100091446 | 3300005617 | Bacteria | 3093 |
| 157 | Ga0068859_100173000 | 3300005617 | Bacteria | 2241 |
| 158 | Ga0068859_100371614 | 3300005617 | Bacteria | 1525 |
| 159 | Ga0068859_100479410 | 3300005617 | Bacteria | 1339 |
| 160 | Ga0068859_100530649 | 3300005617 | Bacteria | 1272 |
| 161 | Ga0068864_100002042 | 3300005618 | Bacteria | 16667 |
| 162 | Ga0068864_100008211 | 3300005618 | Bacteria | 8610 |
| 163 | Ga0068864_100009537 | 3300005618 | Bacteria | 8011 |
| 164 | Ga0068864_100034938 | 3300005618 | Bacteria | 4278 |
| 165 | Ga0068864_100036528 | 3300005618 | Bacteria | 4188 |
| 166 | Ga0068864_100091140 | 3300005618 | Bacteria | 2688 |
| 167 | Ga0068864_100153768 | 3300005618 | Bacteria | 2086 |
| 168 | Ga0068864_100467740 | 3300005618 | Unclassified | 1208 |
| 169 | Ga0068864_100474705 | 3300005618 | Bacteria | 1199 |
| 170 | Ga0068866_10027133 | 3300005718 | Bacteria | 2712 |
| 171 | Ga0068866_10167711 | 3300005718 | Bacteria | 1286 |
| 172 | Ga0068861_100010166 | 3300005719 | Bacteria | 6529 |
| 173 | Ga0068861_100109377 | 3300005719 | Bacteria | 2212 |
| 174 | Ga0068861_100289306 | 3300005719 | Bacteria | 1414 |
| 175 | Ga0068870_10005814 | 3300005840 | Bacteria | 5409 |
| 176 | Ga0068870_10017132 | 3300005840 | Bacteria | 3476 |
| 177 | Ga0068863_100011832 | 3300005841 | Bacteria | 8433 |
| 178 | Ga0068863_100016037 | 3300005841 | Bacteria | 7185 |
| 179 | Ga0068858_100022666 | 3300005842 | Bacteria | 5857 |
| 180 | Ga0068858_100050238 | 3300005842 | Bacteria | 3859 |
| 181 | Ga0068860_100013025 | 3300005843 | Bacteria | 8166 |
| 182 | Ga0068860_100019826 | 3300005843 | Bacteria | 6520 |
| 183 | Ga0068860_100025210 | 3300005843 | Bacteria | 5739 |
| 184 | Ga0068860_100056529 | 3300005843 | Bacteria | 3730 |
| 185 | Ga0068860_100087181 | 3300005843 | Bacteria | 2972 |
| 186 | Ga0068860_100092550 | 3300005843 | Bacteria | 2881 |
| 187 | Ga0068860_100093489 | 3300005843 | Bacteria | 2866 |
| 188 | Ga0068860_100185370 | 3300005843 | Bacteria | 2012 |
| 189 | Ga0068862_100006429 | 3300005844 | Bacteria | 9767 |
| 190 | Ga0068862_100006458 | 3300005844 | Bacteria | 9743 |
| 191 | Ga0068862_100033949 | 3300005844 | Bacteria | 4316 |
| 192 | Ga0068862_100135176 | 3300005844 | Bacteria | 2185 |
| 193 | Ga0068862_100365696 | 3300005844 | Unclassified | 1341 |
| 194 | Ga0081539_10000411 | 3300005985 | Bacteria | 91279 |
| 195 | Ga0081539_10000490 | 3300005985 | Bacteria | 83577 |
| 196 | Ga0081539_10001185 | 3300005985 | Bacteria | 47102 |
| 197 | Ga0081539_10032429 | 3300005985 | Bacteria | 3199 |
| 198 | Ga0070715_10000007 | 3300006163 | Bacteria | 192075 |
| 199 | Ga0070716_100000007 | 3300006173 | Bacteria | 256300 |
| 200 | Ga0097621_100001228 | 3300006237 | Bacteria | 17759 |
| 201 | Ga0097621_100007569 | 3300006237 | Bacteria | 7780 |
| 202 | Ga0097621_100034435 | 3300006237 | Bacteria | 4041 |
| 203 | Ga0097621_100193255 | 3300006237 | Bacteria | 1763 |
| 204 | Ga0068871_100006731 | 3300006358 | Bacteria | 8160 |
| 205 | Ga0068871_100021738 | 3300006358 | Bacteria | 4937 |
| 206 | Ga0068871_100218082 | 3300006358 | Unclassified | 1652 |
| 207 | Ga0075428_100223566 | 3300006844 | Bacteria | 2033 |
| 208 | Ga0075428_100284002 | 3300006844 | Bacteria | 1781 |
| 209 | Ga0075430_100021293 | 3300006846 | Bacteria | 5512 |
| 210 | Ga0075431_100034700 | 3300006847 | Bacteria | 5196 |
| 211 | Ga0075431_100112941 | 3300006847 | Unclassified | 2804 |
| 212 | Ga0075431_100174762 | 3300006847 | Bacteria | 2206 |
| 213 | Ga0075433_10031617 | 3300006852 | Unclassified | 4525 |
| 214 | Ga0075433_10088105 | 3300006852 | Bacteria | 2742 |
| 215 | Ga0075433_10099466 | 3300006852 | Bacteria | 2575 |
| 216 | Ga0075433_10228344 | 3300006852 | Bacteria | 1653 |
| 217 | Ga0075433_10442810 | 3300006852 | Bacteria | 1145 |
| 218 | Ga0075434_100073864 | 3300006871 | Bacteria | 3403 |
| 219 | Ga0075434_100375946 | 3300006871 | Bacteria | 1442 |
| 220 | Ga0075429_100011999 | 3300006880 | Bacteria | 7511 |
| 221 | Ga0075429_100012206 | 3300006880 | Bacteria | 7448 |
| 222 | Ga0068865_100004466 | 3300006881 | Bacteria | 8440 |
| 223 | Ga0068865_100191763 | 3300006881 | Bacteria | 1581 |
| 224 | Ga0097620_100043326 | 3300006931 | Bacteria | 4523 |
| 225 | Ga0097620_100052683 | 3300006931 | Bacteria | 4092 |
| 226 | Ga0097620_100060987 | 3300006931 | Bacteria | 3800 |
| 227 | Ga0097620_100091451 | 3300006931 | Bacteria | 3093 |
| 228 | Ga0097620_100172973 | 3300006931 | Bacteria | 2241 |
| 229 | Ga0097620_100371616 | 3300006931 | Bacteria | 1525 |
| 230 | Ga0097620_100479417 | 3300006931 | Bacteria | 1339 |
| 231 | Ga0097620_100530648 | 3300006931 | Bacteria | 1272 |
| 232 | Ga0075435_100014989 | 3300007076 | Bacteria | 5815 |
| 233 | Ga0105251_10016329 | 3300009011 | Bacteria | 4016 |
| 234 | Ga0105240_10098836 | 3300009093 | Bacteria | 3553 |
| 235 | Ga0105240_10668362 | 3300009093 | Bacteria | 1137 |
| 236 | Ga0111539_10000363 | 3300009094 | Bacteria | 55793 |
| 237 | Ga0111539_10006962 | 3300009094 | Bacteria | 14511 |
| 238 | Ga0111539_10008997 | 3300009094 | Bacteria | 12641 |
| 239 | Ga0111539_10205855 | 3300009094 | Bacteria | 2293 |
| 240 | Ga0105245_10008570 | 3300009098 | Bacteria | 8916 |
| 241 | Ga0105247_10008133 | 3300009101 | Bacteria | 6407 |
| 242 | Ga0105247_10053247 | 3300009101 | Bacteria | 2496 |
| 243 | Ga0114129_10001544 | 3300009147 | Bacteria | 31206 |
| 244 | Ga0114129_10003008 | 3300009147 | Bacteria | 23621 |
| 245 | Ga0114129_10004096 | 3300009147 | Bacteria | 20597 |
| 246 | Ga0114129_10015160 | 3300009147 | Bacteria | 10972 |
| 247 | Ga0114129_10144085 | 3300009147 | Bacteria | 3264 |
| 248 | Ga0114129_10188611 | 3300009147 | Bacteria | 2801 |
| 249 | Ga0114129_10428059 | 3300009147 | Unclassified | 1739 |
| 250 | Ga0114129_10694139 | 3300009147 | Unclassified | 1309 |
| 251 | Ga0105243_10009315 | 3300009148 | Bacteria | 7489 |
| 252 | Ga0105243_10010825 | 3300009148 | Bacteria | 6902 |
| 253 | Ga0105243_10119963 | 3300009148 | Bacteria | 2215 |
| 254 | Ga0105243_10260737 | 3300009148 | Bacteria | 1552 |
| 255 | Ga0105243_10428811 | 3300009148 | Bacteria | 1235 |
| 256 | Ga0105242_10003340 | 3300009176 | Bacteria | 12478 |
| 257 | Ga0105242_10026574 | 3300009176 | Bacteria | 4588 |
| 258 | Ga0105242_10074172 | 3300009176 | Bacteria | 2831 |
| 259 | Ga0105242_10356144 | 3300009176 | Bacteria | 1353 |
| 260 | Ga0105248_10001196 | 3300009177 | Bacteria | 28995 |
| 261 | Ga0105248_10003773 | 3300009177 | Bacteria | 16780 |
| 262 | Ga0105248_10025249 | 3300009177 | Bacteria | 6607 |
| 263 | Ga0105248_10032844 | 3300009177 | Bacteria | 5798 |
| 264 | Ga0105248_10032881 | 3300009177 | Bacteria | 5794 |
| 265 | Ga0105248_10071540 | 3300009177 | Bacteria | 3896 |
| 266 | Ga0105248_10099001 | 3300009177 | Bacteria | 3285 |
| 267 | Ga0105248_10103172 | 3300009177 | Bacteria | 3214 |
| 268 | Ga0105248_10254774 | 3300009177 | Bacteria | 1975 |
| 269 | Ga0105248_10321027 | 3300009177 | Bacteria | 1744 |
| 270 | Ga0105248_10481718 | 3300009177 | Bacteria | 1398 |
| 271 | Ga0105237_10005294 | 3300009545 | Bacteria | 14589 |
| 272 | Ga0105237_10064277 | 3300009545 | Bacteria | 3666 |
| 273 | Ga0105238_10010842 | 3300009551 | Bacteria | 9160 |
| 274 | Ga0105238_10011684 | 3300009551 | Bacteria | 8851 |
| 275 | Ga0105249_10001430 | 3300009553 | Bacteria | 20929 |
| 276 | Ga0105249_10022032 | 3300009553 | Bacteria | 5706 |
| 277 | Ga0105249_10064048 | 3300009553 | Bacteria | 3379 |
| 278 | Ga0105249_10114402 | 3300009553 | Bacteria | 2554 |
| 279 | Ga0105239_10037778 | 3300010375 | Bacteria | 5292 |
| 280 | Ga0105239_10156440 | 3300010375 | Bacteria | 2545 |
| 281 | Ga0105239_10203733 | 3300010375 | Bacteria | 2217 |
| 282 | Ga0105239_10355723 | 3300010375 | Bacteria | 1653 |
| 283 | Ga0105246_10077071 | 3300011119 | Bacteria | 2364 |
| 284 | Ga0105246_10103450 | 3300011119 | Bacteria | 2078 |
| 285 | Ga0157373_10001751 | 3300013100 | Bacteria | 16508 |
| 286 | Ga0157373_10028075 | 3300013100 | Bacteria | 4060 |
| 287 | Ga0157373_10045450 | 3300013100 | Bacteria | 3134 |
| 288 | Ga0157373_10115994 | 3300013100 | Bacteria | 1882 |
| 289 | Ga0157371_10174476 | 3300013102 | Bacteria | 1537 |
| 290 | Ga0157371_10383186 | 3300013102 | Bacteria | 1027 |
| 291 | Ga0157374_10043294 | 3300013296 | Bacteria | 4158 |
| 292 | Ga0157374_10199208 | 3300013296 | Bacteria | 1960 |
| 293 | Ga0157374_10261026 | 3300013296 | Bacteria | 1706 |
| 294 | Ga0157378_10003037 | 3300013297 | Bacteria | 14919 |
| 295 | Ga0157378_10009043 | 3300013297 | Bacteria | 8669 |
| 296 | Ga0157378_10016656 | 3300013297 | Bacteria | 6440 |
| 297 | Ga0157378_10060659 | 3300013297 | Bacteria | 3375 |
| 298 | Ga0157378_10187686 | 3300013297 | Bacteria | 1948 |
| 299 | Ga0157378_10262665 | 3300013297 | Unclassified | 1657 |
| 300 | Ga0163162_10000027 | 3300013306 | Bacteria | 178451 |
| 301 | Ga0163162_10004493 | 3300013306 | Bacteria | 13436 |
| 302 | Ga0163162_10128762 | 3300013306 | Bacteria | 2639 |
| 303 | Ga0163162_10145808 | 3300013306 | Bacteria | 2483 |
| 304 | Ga0163162_10176362 | 3300013306 | Bacteria | 2263 |
| 305 | Ga0163162_10202066 | 3300013306 | Bacteria | 2116 |
| 306 | Ga0157372_10083424 | 3300013307 | Bacteria | 3620 |
| 307 | Ga0157375_10007521 | 3300013308 | Bacteria | 9525 |
| 308 | Ga0157375_10112999 | 3300013308 | Bacteria | 2817 |
| 309 | Ga0157375_10292801 | 3300013308 | Bacteria | 1791 |
| 310 | Ga0157375_10323268 | 3300013308 | Bacteria | 1707 |
| 311 | Ga0163163_10000527 | 3300014325 | Bacteria | 34143 |
| 312 | Ga0163163_10001737 | 3300014325 | Bacteria | 18359 |
| 313 | Ga0163163_10002364 | 3300014325 | Bacteria | 15966 |
| 314 | Ga0163163_10016201 | 3300014325 | Bacteria | 6919 |
| 315 | Ga0163163_10018843 | 3300014325 | Bacteria | 6473 |
| 316 | Ga0163163_10029732 | 3300014325 | Bacteria | 5258 |
| 317 | Ga0163163_10039964 | 3300014325 | Bacteria | 4580 |
| 318 | Ga0163163_10183694 | 3300014325 | Bacteria | 2139 |
| 319 | Ga0163163_10202816 | 3300014325 | Bacteria | 2032 |
| 320 | Ga0163163_10267191 | 3300014325 | Bacteria | 1762 |
| 321 | Ga0157380_10000265 | 3300014326 | Bacteria | 31432 |
| 322 | Ga0157380_10008907 | 3300014326 | Bacteria | 7169 |
| 323 | Ga0157380_10010984 | 3300014326 | Bacteria | 6530 |
| 324 | Ga0157380_10028218 | 3300014326 | Bacteria | 4277 |
| 325 | Ga0157380_10065198 | 3300014326 | Bacteria | 2926 |
| 326 | Ga0157380_10537709 | 3300014326 | Unclassified | 1143 |
| 327 | Ga0157377_10019617 | 3300014745 | Bacteria | 3534 |
| 328 | Ga0157379_10020108 | 3300014968 | Bacteria | 5901 |
| 329 | Ga0157376_10007862 | 3300014969 | Bacteria | 7648 |
| 330 | Ga0163161_10011552 | 3300017792 | Bacteria | 6129 |
| 331 | Ga0207656_10006930 | 3300025321 | Bacteria | 4107 |
| 332 | Ga0207653_10002090 | 3300025885 | Bacteria | 6365 |
| 333 | Ga0207653_10103081 | 3300025885 | Bacteria | 1011 |
| 334 | Ga0207682_10054488 | 3300025893 | Bacteria | 1662 |
| 335 | Ga0207642_10017617 | 3300025899 | Bacteria | 2722 |
| 336 | Ga0207710_10001827 | 3300025900 | Bacteria | 10258 |
| 337 | Ga0207710_10036716 | 3300025900 | Bacteria | 2161 |
| 338 | Ga0207647_10004110 | 3300025904 | Bacteria | 10803 |
| 339 | Ga0207647_10176111 | 3300025904 | Unclassified | 1244 |
| 340 | Ga0207685_10000007 | 3300025905 | Bacteria | 278341 |
| 341 | Ga0207645_10196822 | 3300025907 | Bacteria | 1325 |
| 342 | Ga0207643_10001120 | 3300025908 | Bacteria | 15928 |
| 343 | Ga0207643_10003371 | 3300025908 | Bacteria | 8609 |
| 344 | Ga0207643_10053765 | 3300025908 | Bacteria | 2288 |
| 345 | Ga0207684_10000091 | 3300025910 | Bacteria | 170468 |
| 346 | Ga0207684_10053189 | 3300025910 | Bacteria | 3437 |
| 347 | Ga0207654_10121937 | 3300025911 | Bacteria | 1638 |
| 348 | Ga0207654_10156045 | 3300025911 | Bacteria | 1470 |
| 349 | Ga0207707_10016207 | 3300025912 | Bacteria | 6502 |
| 350 | Ga0207707_10142137 | 3300025912 | Bacteria | 2098 |
| 351 | Ga0207695_10215343 | 3300025913 | Bacteria | 1830 |
| 352 | Ga0207671_10003947 | 3300025914 | Bacteria | 14441 |
| 353 | Ga0207671_10044532 | 3300025914 | Bacteria | 3282 |
| 354 | Ga0207660_10300096 | 3300025917 | Bacteria | 1279 |
| 355 | Ga0207662_10002588 | 3300025918 | Bacteria | 9118 |
| 356 | Ga0207662_10023969 | 3300025918 | Bacteria | 3510 |
| 357 | Ga0207662_10141441 | 3300025918 | Bacteria | 1524 |
| 358 | Ga0207657_10225236 | 3300025919 | Bacteria | 1501 |
| 359 | Ga0207649_10166500 | 3300025920 | Bacteria | 1532 |
| 360 | Ga0207646_10045056 | 3300025922 | Bacteria | 3959 |
| 361 | Ga0207646_10106083 | 3300025922 | Bacteria | 2520 |
| 362 | Ga0207646_10119012 | 3300025922 | Bacteria | 2372 |
| 363 | Ga0207646_10183041 | 3300025922 | Bacteria | 1892 |
| 364 | Ga0207681_10002711 | 3300025923 | Bacteria | 11217 |
| 365 | Ga0207681_10017953 | 3300025923 | Bacteria | 4449 |
| 366 | Ga0207694_10002853 | 3300025924 | Bacteria | 13936 |
| 367 | Ga0207650_10000009 | 3300025925 | Bacteria | 483583 |
| 368 | Ga0207650_10011336 | 3300025925 | Bacteria | 6134 |
| 369 | Ga0207644_10076086 | 3300025931 | Bacteria | 2468 |
| 370 | Ga0207644_10113680 | 3300025931 | Bacteria | 2050 |
| 371 | Ga0207690_10068558 | 3300025932 | Bacteria | 2438 |
| 372 | Ga0207706_10174379 | 3300025933 | Unclassified | 1889 |
| 373 | Ga0207686_10044518 | 3300025934 | Bacteria | 2726 |
| 374 | Ga0207686_10073747 | 3300025934 | Bacteria | 2203 |
| 375 | Ga0207709_10006238 | 3300025935 | Bacteria | 6702 |
| 376 | Ga0207670_10106355 | 3300025936 | Bacteria | 2013 |
| 377 | Ga0207670_10191771 | 3300025936 | Bacteria | 1547 |
| 378 | Ga0207669_10019044 | 3300025937 | Bacteria | 3565 |
| 379 | Ga0207704_10018306 | 3300025938 | Bacteria | 3654 |
| 380 | Ga0207704_10019506 | 3300025938 | Bacteria | 3563 |
| 381 | Ga0207665_10000018 | 3300025939 | Bacteria | 122653 |
| 382 | Ga0207691_10004885 | 3300025940 | Bacteria | 12958 |
| 383 | Ga0207711_10003601 | 3300025941 | Bacteria | 13399 |
| 384 | Ga0207711_10009207 | 3300025941 | Bacteria | 8247 |
| 385 | Ga0207711_10010789 | 3300025941 | Bacteria | 7594 |
| 386 | Ga0207711_10028743 | 3300025941 | Bacteria | 4682 |
| 387 | Ga0207711_10065475 | 3300025941 | Bacteria | 3142 |
| 388 | Ga0207711_10149360 | 3300025941 | Unclassified | 2108 |
| 389 | Ga0207711_10163341 | 3300025941 | Bacteria | 2017 |
| 390 | Ga0207711_10244043 | 3300025941 | Unclassified | 1648 |
| 391 | Ga0207711_10335852 | 3300025941 | Bacteria | 1398 |
| 392 | Ga0207689_10007562 | 3300025942 | Bacteria | 9526 |
| 393 | Ga0207689_10221895 | 3300025942 | Unclassified | 1562 |
| 394 | Ga0207689_10321621 | 3300025942 | Unclassified | 1284 |
| 395 | Ga0207689_10350420 | 3300025942 | Unclassified | 1227 |
| 396 | Ga0207679_10033023 | 3300025945 | Bacteria | 3639 |
| 397 | Ga0207679_10101656 | 3300025945 | Bacteria | 2249 |
| 398 | Ga0207651_10013356 | 3300025960 | Bacteria | 4698 |
| 399 | Ga0207651_10242871 | 3300025960 | Bacteria | 1469 |
| 400 | Ga0207712_10000956 | 3300025961 | Bacteria | 20827 |
| 401 | Ga0207712_10021155 | 3300025961 | Bacteria | 4268 |
| 402 | Ga0207712_10028853 | 3300025961 | Bacteria | 3715 |
| 403 | Ga0207712_10137827 | 3300025961 | Bacteria | 1869 |
| 404 | Ga0207712_10301028 | 3300025961 | Unclassified | 1316 |
| 405 | Ga0207668_10005104 | 3300025972 | Bacteria | 7727 |
| 406 | Ga0207640_10195609 | 3300025981 | Bacteria | 1528 |
| 407 | Ga0207658_10067932 | 3300025986 | Bacteria | 2687 |
| 408 | Ga0207677_10002787 | 3300026023 | Bacteria | 9234 |
| 409 | Ga0207677_10110438 | 3300026023 | Bacteria | 2046 |
| 410 | Ga0207677_10343191 | 3300026023 | Unclassified | 1248 |
| 411 | Ga0207703_10012873 | 3300026035 | Bacteria | 6523 |
| 412 | Ga0207703_10089479 | 3300026035 | Bacteria | 2585 |
| 413 | Ga0207703_10100985 | 3300026035 | Bacteria | 2445 |
| 414 | Ga0207639_10026488 | 3300026041 | Bacteria | 4214 |
| 415 | Ga0207639_10196403 | 3300026041 | Unclassified | 1727 |
| 416 | Ga0207708_10000017 | 3300026075 | Bacteria | 190414 |
| 417 | Ga0207708_10005588 | 3300026075 | Bacteria | 9278 |
| 418 | Ga0207708_10029375 | 3300026075 | Bacteria | 4167 |
| 419 | Ga0207708_10037248 | 3300026075 | Bacteria | 3705 |
| 420 | Ga0207708_10051465 | 3300026075 | Bacteria | 3135 |
| 421 | Ga0207708_10177105 | 3300026075 | Bacteria | 1691 |
| 422 | Ga0207708_10228851 | 3300026075 | Bacteria | 1492 |
| 423 | Ga0207641_10014008 | 3300026088 | Bacteria | 6574 |
| 424 | Ga0207641_10231920 | 3300026088 | Bacteria | 1716 |
| 425 | Ga0207648_10016645 | 3300026089 | Bacteria | 6713 |
| 426 | Ga0207648_10052280 | 3300026089 | Bacteria | 3572 |
| 427 | Ga0207648_10233716 | 3300026089 | Unclassified | 1636 |
| 428 | Ga0207648_10295211 | 3300026089 | Bacteria | 1452 |
| 429 | Ga0207676_10002795 | 3300026095 | Bacteria | 12401 |
| 430 | Ga0207676_10006630 | 3300026095 | Bacteria | 8184 |
| 431 | Ga0207676_10090961 | 3300026095 | Bacteria | 2505 |
| 432 | Ga0207676_10397344 | 3300026095 | Bacteria | 1287 |
| 433 | Ga0207674_10000036 | 3300026116 | Bacteria | 135434 |
| 434 | Ga0207674_10045652 | 3300026116 | Bacteria | 4505 |
| 435 | Ga0207674_10290065 | 3300026116 | Bacteria | 1585 |
| 436 | Ga0207674_10376578 | 3300026116 | Bacteria | 1372 |
| 437 | Ga0207675_100018298 | 3300026118 | Bacteria | 6533 |
| 438 | Ga0207675_100045611 | 3300026118 | Bacteria | 4095 |
| 439 | Ga0207675_100065736 | 3300026118 | Bacteria | 3389 |
| 440 | Ga0207675_100149601 | 3300026118 | Bacteria | 2221 |
| 441 | Ga0207675_100225835 | 3300026118 | Bacteria | 1805 |
| 442 | Ga0207675_100255169 | 3300026118 | Bacteria | 1698 |
| 443 | Ga0207683_10016580 | 3300026121 | Bacteria | 6272 |
| 444 | Ga0207698_10448353 | 3300026142 | Bacteria | 1245 |
| 445 | Ga0207428_10018672 | 3300027907 | Bacteria | 5919 |
| 446 | Ga0207428_10061655 | 3300027907 | Bacteria | 2968 |
| 447 | Ga0207428_10101316 | 3300027907 | Bacteria | 2225 |
| 448 | Ga0268265_10027908 | 3300028380 | Bacteria | 4036 |
| 449 | Ga0268265_10032498 | 3300028380 | Bacteria | 3783 |
| 450 | Ga0268265_10084487 | 3300028380 | Bacteria | 2516 |
| 451 | Ga0268264_10010099 | 3300028381 | Bacteria | 7812 |
| 452 | Ga0268264_10018398 | 3300028381 | Bacteria | 5713 |
| 453 | Ga0268264_10054779 | 3300028381 | Bacteria | 3331 |
| 454 | Ga0268264_10076365 | 3300028381 | Bacteria | 2850 |
| 455 | Ga0268264_10172986 | 3300028381 | Bacteria | 1954 |
| 456 | Ga0268264_10532530 | 3300028381 | Unclassified | 1150 |
| 457 | Ga0307408_100027790 | 3300031548 | Bacteria | 3903 |
| 458 | Ga0307408_100042092 | 3300031548 | Bacteria | 3242 |
| 459 | Ga0307408_100249985 | 3300031548 | Bacteria | 1462 |
| 460 | Ga0307405_10035381 | 3300031731 | Bacteria | 2982 |
| 461 | Ga0307413_10151562 | 3300031824 | Bacteria | 1616 |
| 462 | Ga0307410_10015545 | 3300031852 | Bacteria | 4518 |
| 463 | Ga0307410_10234763 | 3300031852 | Bacteria | 1418 |
| 464 | Ga0307406_10105178 | 3300031901 | Bacteria | 1931 |
| 465 | Ga0307406_10145111 | 3300031901 | Bacteria | 1685 |
| 466 | Ga0307406_10167182 | 3300031901 | Bacteria | 1588 |
| 467 | Ga0307406_10287327 | 3300031901 | Bacteria | 1257 |
| 468 | Ga0307412_10049850 | 3300031911 | Bacteria | 2760 |
| 469 | Ga0307412_10283353 | 3300031911 | Bacteria | 1302 |
| 470 | Ga0307416_100088195 | 3300032002 | Bacteria | 2652 |
| 471 | Ga0307416_100175897 | 3300032002 | Unclassified | 1999 |
| 472 | Ga0307416_100646917 | 3300032002 | Unclassified | 1141 |
| 473 | Ga0307414_10037026 | 3300032004 | Bacteria | 3263 |
| 474 | Ga0307414_10037189 | 3300032004 | Bacteria | 3257 |
| 475 | Ga0307414_10042283 | 3300032004 | Bacteria | 3095 |
| 476 | Ga0307411_10022267 | 3300032005 | Bacteria | 3727 |
| 477 | Ga0307411_10097921 | 3300032005 | Bacteria | 2066 |
| 478 | Ga0307415_100006760 | 3300032126 | Bacteria | 6217 |
| 479 | Ga0307415_100077588 | 3300032126 | Bacteria | 2359 |
| 480 | Ga0307415_100112662 | 3300032126 | Bacteria | 2022 |
| 481 | Ga0373942_0003433 | 3300035207 | Bacteria | 3723 |
| 482 | Ga0373937_0048963 | 3300036401 | Bacteria | 3870 |
| 483 | Ga0395900_0020609 | 3300037418 | Bacteria | 6735 |
| 484 | Ga0395898_0369869 | 3300037466 | Bacteria | 1367 |
| 485 | Ga0395905_0016489 | 3300037471 | Bacteria | 7023 |
| 486 | Ga0395901_0253897 | 3300038443 | Bacteria | 1831 |
| 487 | Ga0395901_0363805 | 3300038443 | Bacteria | 1491 |
| 488 | Ga0439448_0009894 | 3300042005 | Bacteria | 2817 |
| 489 | Ga0439462_0016216 | 3300042015 | Bacteria | 1924 |
| 490 | Ga0439458_0014659 | 3300042157 | Bacteria | 1770 |
| 491 | Ga0451576_0100039 | 3300045051 | Bacteria | 3016 |
| 492 | Ga0495610_0064448 | 3300046512 | Bacteria | 1732 |
| 493 | Ga0495663_0013055 | 3300046525 | Unclassified | 2320 |
| 494 | Ga0495598_0000421 | 3300046537 | Bacteria | 7651 |
| 495 | Ga0495621_0000030 | 3300046539 | Bacteria | 27481 |
| 496 | Ga0495621_0023954 | 3300046539 | Bacteria | 2034 |
| 497 | Ga0495656_0019823 | 3300046615 | Bacteria | 2601 |
| 498 | Ga0495636_0078464 | 3300047318 | Bacteria | 1419 |
| 499 | Ga0496104_0200832 | 3300048907 | Bacteria | 1906 |
| 500 | Ga0496106_0176718 | 3300048909 | Bacteria | 1694 |
| 501 | Ga0496108_0130880 | 3300048911 | Bacteria | 2157 |
| 502 | Ga0496109_0110988 | 3300048912 | Bacteria | 2550 |
| 503 | Ga0496112_0161796 | 3300048915 | Unclassified | 2205 |
| 504 | Ga0496112_0658103 | 3300048915 | Bacteria | 977 |
| 505 | Ga0501292_006900 | 3300049515 | Bacteria | 1628 |
| 506 | Ga0501296_000317 | 3300049519 | Bacteria | 4940 |
| 507 | Ga0501296_000595 | 3300049519 | Bacteria | 3546 |
| 508 | Ga0501296_002360 | 3300049519 | Bacteria | 1969 |
| 509 | Ga0501297_006335 | 3300049520 | Bacteria | 1260 |
| 510 | Ga0501298_000922 | 3300049521 | Bacteria | 4156 |
| 511 | Ga0501298_001555 | 3300049521 | Bacteria | 3388 |
| 512 | Ga0501298_006669 | 3300049521 | Bacteria | 1894 |
| 513 | Ga0501299_000809 | 3300049522 | Bacteria | 3810 |
| 514 | Ga0501299_010285 | 3300049522 | Bacteria | 1560 |
| 515 | Ga0501038_0006435 | 3300049574 | Bacteria | 10871 |
| 516 | Ga0501076_0199646 | 3300049592 | Bacteria | 1633 |
| 517 | Ga0501076_0423906 | 3300049592 | Bacteria | 1095 |
| 518 | Ga0501198_002543 | 3300049649 | Bacteria | 2461 |
| 519 | Ga0501202_005956 | 3300049652 | Bacteria | 2169 |
| 520 | Ga0501202_006231 | 3300049652 | Unclassified | 2130 |
| 521 | Ga0501216_000441 | 3300049660 | Bacteria | 4889 |
| 522 | Ga0501216_011440 | 3300049660 | Bacteria | 1442 |
| 523 | Ga0501216_011563 | 3300049660 | Bacteria | 1436 |
| 524 | Ga0501217_000754 | 3300049661 | Bacteria | 5615 |
| 525 | Ga0501217_006729 | 3300049661 | Bacteria | 2451 |
| 526 | Ga0501217_064306 | 3300049661 | Bacteria | 986 |
| 527 | Ga0501223_008123 | 3300049663 | Bacteria | 2141 |
| 528 | Ga0501224_011431 | 3300049664 | Bacteria | 1306 |
| 529 | Ga0501230_000349 | 3300049667 | Bacteria | 4418 |
| 530 | Ga0501233_000192 | 3300049668 | Bacteria | 9044 |
| 531 | Ga0501233_002483 | 3300049668 | Bacteria | 3256 |
| 532 | Ga0501233_006880 | 3300049668 | Bacteria | 2150 |
| 533 | Ga0501235_001929 | 3300049669 | Bacteria | 4432 |
| 534 | Ga0501235_002948 | 3300049669 | Bacteria | 3665 |
| 535 | Ga0501235_003278 | 3300049669 | Bacteria | 3493 |
| 536 | Ga0501235_031424 | 3300049669 | Bacteria | 1199 |
| 537 | Ga0501236_009690 | 3300049670 | Bacteria | 1247 |
| 538 | Ga0501238_009752 | 3300049671 | Bacteria | 1276 |
| 539 | Ga0501239_005766 | 3300049672 | Bacteria | 1257 |
| 540 | Ga0501240_017430 | 3300049673 | Bacteria | 1045 |
| 541 | Ga0501243_010844 | 3300049675 | Bacteria | 1425 |
| 542 | Ga0501249_009141 | 3300049679 | Bacteria | 2060 |
| 543 | Ga0501249_019403 | 3300049679 | Bacteria | 1476 |
| 544 | Ga0501249_049033 | 3300049679 | Unclassified | 967 |
| 545 | Ga0501250_004171 | 3300049680 | Bacteria | 1425 |
| 546 | Ga0501253_011320 | 3300049683 | Bacteria | 1367 |
| 547 | Ga0501257_026688 | 3300049686 | Bacteria | 1379 |
| 548 | Ga0501221_002516 | 3300049704 | Bacteria | 3024 |
| 549 | Ga0501225_0000268 | 3300049705 | Bacteria | 16456 |
| 550 | Ga0501225_0004226 | 3300049705 | Bacteria | 4287 |
| 551 | Ga0501225_0005467 | 3300049705 | Bacteria | 3731 |
| 552 | Ga0501225_0006095 | 3300049705 | Bacteria | 3521 |
| 553 | Ga0501234_001450 | 3300049707 | Bacteria | 3725 |
| 554 | Ga0501234_005632 | 3300049707 | Bacteria | 1958 |
| 555 | Ga0501245_001321 | 3300049708 | Bacteria | 3186 |
| 556 | Ga0501245_002728 | 3300049708 | Bacteria | 2369 |
| 557 | Ga0501268_003559 | 3300049765 | Bacteria | 2142 |
| 558 | Ga0501273_003459 | 3300049770 | Bacteria | 1677 |
| 559 | Ga0501283_005574 | 3300049779 | Bacteria | 1737 |
| 560 | Ga0501212_004637 | 3300049851 | Bacteria | 1785 |
| 561 | Ga0501226_000293 | 3300049853 | Bacteria | 7511 |
| 562 | Ga0501226_005688 | 3300049853 | Bacteria | 1417 |
| 563 | nmdc:mga05p37_164959_c1 | 3300050507 | Bacteria | 2704 |
| 564 | nmdc:mga05p37_333934_c1 | 3300050507 | Unclassified | 1789 |
| 565 | nmdc:mga05p37_502271_c1 | 3300050507 | Unclassified | 1391 |
| 566 | nmdc:mga05p37_77487_c1 | 3300050507 | Bacteria | 4092 |
| 567 | nmdc:mga05p37_79525_c1 | 3300050507 | Bacteria | 4037 |
| 568 | nmdc:mga05p37_8649_c1 | 3300050507 | Bacteria | 6322 |
| 569 | nmdc:mga09592_186542_c1 | 3300050508 | Bacteria | 1795 |
| 570 | nmdc:mga0qj67_147620_c1 | 3300050509 | Bacteria | 1907 |
| 571 | nmdc:mga06r32_262372_c1 | 3300050510 | Bacteria | 1715 |
| 572 | nmdc:mga06r32_93133_c2 | 3300050510 | Bacteria | 2291 |
| 573 | nmdc:mga08y16_15940_c1 | 3300050511 | Bacteria | 7900 |
| 574 | nmdc:mga08y16_1742_c1 | 3300050511 | Bacteria | 22070 |
| 575 | nmdc:mga08y16_48572_c1 | 3300050511 | Bacteria | 4441 |
| 576 | nmdc:mga0n895_234759_c1 | 3300050512 | Bacteria | 1861 |
| 577 | nmdc:mga0n895_59092_c1 | 3300050512 | Bacteria | 3783 |
| 578 | nmdc:mga0rr50_62702_c1 | 3300050513 | Bacteria | 2806 |
| 579 | nmdc:mga0a205_158248_c1 | 3300050515 | Bacteria | 2163 |
| 580 | nmdc:mga0a205_245170_c1 | 3300050515 | Bacteria | 1672 |
| 581 | nmdc:mga0a205_36293_c1 | 3300050515 | Bacteria | 4736 |
| 582 | nmdc:mga0a205_418189_c1 | 3300050515 | Unclassified | 1203 |
| 583 | nmdc:mga0a205_49497_c1 | 3300050515 | Bacteria | 4056 |
| 584 | nmdc:mga0a205_53651_c1 | 3300050515 | Unclassified | 3891 |
| 585 | nmdc:mga0a205_66366_c1 | 3300050515 | Bacteria | 3487 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048915 | Ga0496112_0658103 | Ga0496112_0658103_47_835 | 262 |
| 2 | 3300049661 | Ga0501217_064306 | Ga0501217_064306_184_972 | 262 |
| 3 | 3300049679 | Ga0501249_049033 | Ga0501249_049033_167_955 | 262 |
| 4 | 3300050515 | nmdc:mga0a205_418189_c1 | nmdc:mga0a205_418189_c1_405_1193 | 262 |
| 5 | 3300032126 | Ga0307415_100112662 | Ga0307415_1001126623 | 269 |
| 6 | 3300047318 | Ga0495636_0078464 | Ga0495636_0078464_573_1382 | 269 |
| 7 | 3300026116 | Ga0207674_10376578 | Ga0207674_103765782 | 270 |
| 8 | 3300049673 | Ga0501240_017430 | Ga0501240_017430_217_1035 | 272 |
| 9 | 3300005543 | Ga0070672_100257069 | Ga0070672_1002570692 | 290 |
| 10 | 3300005617 | Ga0068859_100052684 | Ga0068859_1000526842 | 293 |
| 11 | 3300005843 | Ga0068860_100087181 | Ga0068860_1000871812 | 293 |
| 12 | 3300006931 | Ga0097620_100052683 | Ga0097620_1000526832 | 293 |
| 13 | 3300013306 | Ga0163162_10176362 | Ga0163162_101763622 | 293 |
| 14 | 3300025960 | Ga0207651_10242871 | Ga0207651_102428712 | 293 |
| 15 | 3300005536 | Ga0070697_100330745 | Ga0070697_1003307452 | 296 |
| 16 | 3300005347 | Ga0070668_100023596 | Ga0070668_1000235964 | 298 |
| 17 | 3300005985 | Ga0081539_10032429 | Ga0081539_100324292 | 298 |
| 18 | 3300009553 | Ga0105249_10001430 | Ga0105249_1000143015 | 298 |
| 19 | 3300013306 | Ga0163162_10000027 | Ga0163162_10000027111 | 298 |
| 20 | 3300025961 | Ga0207712_10000956 | Ga0207712_100009566 | 298 |
| 21 | 3300025972 | Ga0207668_10005104 | Ga0207668_100051042 | 298 |
| 22 | 3300009177 | Ga0105248_10321027 | Ga0105248_103210272 | 300 |
| 23 | 3300014325 | Ga0163163_10029732 | Ga0163163_100297325 | 300 |
| 24 | 3300005536 | Ga0070697_100000205 | Ga0070697_10000020541 | 305 |
| 25 | 3300005618 | Ga0068864_100467740 | Ga0068864_1004677402 | 305 |
| 26 | 3300026095 | Ga0207676_10397344 | Ga0207676_103973441 | 305 |
| 27 | 3300014326 | Ga0157380_10028218 | Ga0157380_100282182 | 306 |
| 28 | 3300010375 | Ga0105239_10037778 | Ga0105239_100377785 | 307 |
| 29 | 3300013308 | Ga0157375_10112999 | Ga0157375_101129992 | 307 |
| 30 | 3300014745 | Ga0157377_10019617 | Ga0157377_100196173 | 307 |
| 31 | 3300006852 | Ga0075433_10031617 | Ga0075433_100316174 | 308 |
| 32 | 3300050512 | nmdc:mga0n895_59092_c1 | nmdc:mga0n895_59092_c1_1067_2032 | 308 |
| 33 | 3300050515 | nmdc:mga0a205_66366_c1 | nmdc:mga0a205_66366_c1_539_1504 | 308 |
| 34 | 3300005364 | Ga0070673_100392882 | Ga0070673_1003928822 | 309 |
| 35 | 3300025942 | Ga0207689_10321621 | Ga0207689_103216212 | 309 |
| 36 | 3300006163 | Ga0070715_10000007 | Ga0070715_10000007175 | 310 |
| 37 | 3300006173 | Ga0070716_100000007 | Ga0070716_100000007140 | 310 |
| 38 | 3300025905 | Ga0207685_10000007 | Ga0207685_1000000791 | 310 |
| 39 | 3300025922 | Ga0207646_10106083 | Ga0207646_101060832 | 310 |
| 40 | 3300025939 | Ga0207665_10000018 | Ga0207665_1000001822 | 310 |
| 41 | 3300009177 | Ga0105248_10032881 | Ga0105248_100328814 | 311 |
| 42 | 3300013306 | Ga0163162_10004493 | Ga0163162_1000449314 | 311 |
| 43 | 3300025941 | Ga0207711_10149360 | Ga0207711_101493602 | 311 |
| 44 | 3300031548 | Ga0307408_100249985 | Ga0307408_1002499852 | 311 |
| 45 | 3300005330 | Ga0070690_100012650 | Ga0070690_1000126505 | 313 |
| 46 | 3300005438 | Ga0070701_10099823 | Ga0070701_100998232 | 313 |
| 47 | 3300005441 | Ga0070700_100129297 | Ga0070700_1001292972 | 313 |
| 48 | 3300005444 | Ga0070694_100094917 | Ga0070694_1000949172 | 313 |
| 49 | 3300005544 | Ga0070686_100026432 | Ga0070686_1000264322 | 313 |
| 50 | 3300005546 | Ga0070696_100078803 | Ga0070696_1000788033 | 313 |
| 51 | 3300005615 | Ga0070702_100141195 | Ga0070702_1001411952 | 313 |
| 52 | 3300005844 | Ga0068862_100006458 | Ga0068862_1000064583 | 313 |
| 53 | 3300009098 | Ga0105245_10008570 | Ga0105245_100085705 | 313 |
| 54 | 3300009148 | Ga0105243_10009315 | Ga0105243_100093156 | 313 |
| 55 | 3300009176 | Ga0105242_10003340 | Ga0105242_100033403 | 313 |
| 56 | 3300009177 | Ga0105248_10099001 | Ga0105248_100990013 | 313 |
| 57 | 3300013102 | Ga0157371_10383186 | Ga0157371_103831861 | 313 |
| 58 | 3300013296 | Ga0157374_10261026 | Ga0157374_102610261 | 313 |
| 59 | 3300013297 | Ga0157378_10009043 | Ga0157378_100090437 | 313 |
| 60 | 3300013297 | Ga0157378_10060659 | Ga0157378_100606593 | 313 |
| 61 | 3300013306 | Ga0163162_10202066 | Ga0163162_102020662 | 313 |
| 62 | 3300014326 | Ga0157380_10065198 | Ga0157380_100651982 | 313 |
| 63 | 3300014969 | Ga0157376_10007862 | Ga0157376_100078626 | 313 |
| 64 | 3300025961 | Ga0207712_10301028 | Ga0207712_103010282 | 313 |
| 65 | 3300026075 | Ga0207708_10228851 | Ga0207708_102288511 | 313 |
| 66 | 3300028380 | Ga0268265_10032498 | Ga0268265_100324982 | 313 |
| 67 | 3300049851 | Ga0501212_004637 | Ga0501212_004637_822_1763 | 313 |
| 68 | 3300005337 | Ga0070682_100000088 | Ga0070682_10000008850 | 314 |
| 69 | 3300005445 | Ga0070708_100000147 | Ga0070708_10000014731 | 315 |
| 70 | 3300005467 | Ga0070706_100034202 | Ga0070706_1000342025 | 315 |
| 71 | 3300005468 | Ga0070707_100009346 | Ga0070707_1000093464 | 315 |
| 72 | 3300005471 | Ga0070698_100011920 | Ga0070698_1000119206 | 315 |
| 73 | 3300005518 | Ga0070699_100002774 | Ga0070699_10000277412 | 315 |
| 74 | 3300005536 | Ga0070697_100001795 | Ga0070697_10000179513 | 315 |
| 75 | 3300025910 | Ga0207684_10053189 | Ga0207684_100531891 | 315 |
| 76 | 3300025922 | Ga0207646_10045056 | Ga0207646_100450562 | 315 |
| 77 | 3300025931 | Ga0207644_10076086 | Ga0207644_100760862 | 316 |
| 78 | 3300005330 | Ga0070690_100014555 | Ga0070690_1000145554 | 320 |
| 79 | 3300005444 | Ga0070694_100112576 | Ga0070694_1001125762 | 320 |
| 80 | 3300005445 | Ga0070708_100085454 | Ga0070708_1000854542 | 320 |
| 81 | 3300005468 | Ga0070707_100125538 | Ga0070707_1001255382 | 320 |
| 82 | 3300005518 | Ga0070699_100202158 | Ga0070699_1002021582 | 320 |
| 83 | 3300005546 | Ga0070696_100039140 | Ga0070696_1000391402 | 320 |
| 84 | 3300005844 | Ga0068862_100365696 | Ga0068862_1003656961 | 320 |
| 85 | 3300005985 | Ga0081539_10000411 | Ga0081539_1000041120 | 320 |
| 86 | 3300006852 | Ga0075433_10228344 | Ga0075433_102283441 | 320 |
| 87 | 3300006852 | Ga0075433_10442810 | Ga0075433_104428102 | 320 |
| 88 | 3300009147 | Ga0114129_10003008 | Ga0114129_1000300813 | 320 |
| 89 | 3300009553 | Ga0105249_10064048 | Ga0105249_100640484 | 320 |
| 90 | 3300013297 | Ga0157378_10262665 | Ga0157378_102626652 | 320 |
| 91 | 3300014326 | Ga0157380_10010984 | Ga0157380_100109845 | 320 |
| 92 | 3300028380 | Ga0268265_10084487 | Ga0268265_100844873 | 320 |
| 93 | 3300037471 | Ga0395905_0016489 | Ga0395905_0016489_2181_3143 | 320 |
| 94 | 3300000532 | CNAas_1000248 | CNAas_10002482 | 321 |
| 95 | 3300002459 | JGI24751J29686_10000016 | JGI24751J29686_1000001661 | 321 |
| 96 | 3300002459 | JGI24751J29686_10000049 | JGI24751J29686_1000004956 | 321 |
| 97 | 3300003203 | JGI25406J46586_10001054 | JGI25406J46586_100010548 | 321 |
| 98 | 3300003203 | JGI25406J46586_10064679 | JGI25406J46586_100646791 | 321 |
| 99 | 3300003322 | rootL2_10161821 | rootL2_101618214 | 321 |
| 100 | 3300005289 | Ga0065704_10004321 | Ga0065704_100043214 | 321 |
| 101 | 3300005289 | Ga0065704_10089428 | Ga0065704_100894281 | 321 |
| 102 | 3300005290 | Ga0065712_10003404 | Ga0065712_100034045 | 321 |
| 103 | 3300005290 | Ga0065712_10011796 | Ga0065712_100117963 | 321 |
| 104 | 3300005293 | Ga0065715_10001666 | Ga0065715_100016663 | 321 |
| 105 | 3300005293 | Ga0065715_10018816 | Ga0065715_100188162 | 321 |
| 106 | 3300005293 | Ga0065715_10024130 | Ga0065715_100241302 | 321 |
| 107 | 3300005293 | Ga0065715_10089743 | Ga0065715_100897436 | 321 |
| 108 | 3300005293 | Ga0065715_10095439 | Ga0065715_100954393 | 321 |
| 109 | 3300005293 | Ga0065715_10098517 | Ga0065715_100985172 | 321 |
| 110 | 3300005293 | Ga0065715_10147560 | Ga0065715_101475602 | 321 |
| 111 | 3300005295 | Ga0065707_10001657 | Ga0065707_100016574 | 321 |
| 112 | 3300005295 | Ga0065707_10091765 | Ga0065707_100917652 | 321 |
| 113 | 3300005295 | Ga0065707_10164701 | Ga0065707_101647011 | 321 |
| 114 | 3300005328 | Ga0070676_10017855 | Ga0070676_100178553 | 321 |
| 115 | 3300005328 | Ga0070676_10109582 | Ga0070676_101095822 | 321 |
| 116 | 3300005330 | Ga0070690_100002689 | Ga0070690_1000026896 | 321 |
| 117 | 3300005330 | Ga0070690_100041559 | Ga0070690_1000415593 | 321 |
| 118 | 3300005331 | Ga0070670_100001702 | Ga0070670_10000170215 | 321 |
| 119 | 3300005331 | Ga0070670_100002456 | Ga0070670_1000024568 | 321 |
| 120 | 3300005331 | Ga0070670_100054997 | Ga0070670_1000549974 | 321 |
| 121 | 3300005331 | Ga0070670_100103903 | Ga0070670_1001039032 | 321 |
| 122 | 3300005334 | Ga0068869_100005586 | Ga0068869_1000055866 | 321 |
| 123 | 3300005334 | Ga0068869_100104809 | Ga0068869_1001048092 | 321 |
| 124 | 3300005334 | Ga0068869_100221231 | Ga0068869_1002212312 | 321 |
| 125 | 3300005334 | Ga0068869_100440135 | Ga0068869_1004401351 | 321 |
| 126 | 3300005335 | Ga0070666_10018711 | Ga0070666_100187114 | 321 |
| 127 | 3300005336 | Ga0070680_100020042 | Ga0070680_1000200425 | 321 |
| 128 | 3300005337 | Ga0070682_100020603 | Ga0070682_1000206032 | 321 |
| 129 | 3300005338 | Ga0068868_100021324 | Ga0068868_1000213242 | 321 |
| 130 | 3300005338 | Ga0068868_100022838 | Ga0068868_1000228383 | 321 |
| 131 | 3300005339 | Ga0070660_100019722 | Ga0070660_1000197225 | 321 |
| 132 | 3300005340 | Ga0070689_100000707 | Ga0070689_10000070714 | 321 |
| 133 | 3300005340 | Ga0070689_100038467 | Ga0070689_1000384672 | 321 |
| 134 | 3300005340 | Ga0070689_100210778 | Ga0070689_1002107782 | 321 |
| 135 | 3300005340 | Ga0070689_100325994 | Ga0070689_1003259941 | 321 |
| 136 | 3300005343 | Ga0070687_100013620 | Ga0070687_1000136203 | 321 |
| 137 | 3300005345 | Ga0070692_10007499 | Ga0070692_100074994 | 321 |
| 138 | 3300005345 | Ga0070692_10050172 | Ga0070692_100501722 | 321 |
| 139 | 3300005353 | Ga0070669_100005009 | Ga0070669_1000050092 | 321 |
| 140 | 3300005353 | Ga0070669_100005360 | Ga0070669_1000053603 | 321 |
| 141 | 3300005353 | Ga0070669_100050656 | Ga0070669_1000506562 | 321 |
| 142 | 3300005353 | Ga0070669_100159549 | Ga0070669_1001595492 | 321 |
| 143 | 3300005354 | Ga0070675_100048607 | Ga0070675_1000486071 | 321 |
| 144 | 3300005354 | Ga0070675_100081208 | Ga0070675_1000812083 | 321 |
| 145 | 3300005355 | Ga0070671_100252731 | Ga0070671_1002527312 | 321 |
| 146 | 3300005364 | Ga0070673_100001840 | Ga0070673_10000184012 | 321 |
| 147 | 3300005364 | Ga0070673_100041566 | Ga0070673_1000415662 | 321 |
| 148 | 3300005365 | Ga0070688_100180868 | Ga0070688_1001808682 | 321 |
| 149 | 3300005366 | Ga0070659_100004894 | Ga0070659_1000048945 | 321 |
| 150 | 3300005438 | Ga0070701_10028279 | Ga0070701_100282793 | 321 |
| 151 | 3300005438 | Ga0070701_10066848 | Ga0070701_100668482 | 321 |
| 152 | 3300005438 | Ga0070701_10132937 | Ga0070701_101329371 | 321 |
| 153 | 3300005440 | Ga0070705_100012146 | Ga0070705_1000121463 | 321 |
| 154 | 3300005440 | Ga0070705_100084455 | Ga0070705_1000844552 | 321 |
| 155 | 3300005441 | Ga0070700_100000005 | Ga0070700_10000000577 | 321 |
| 156 | 3300005441 | Ga0070700_100005202 | Ga0070700_1000052023 | 321 |
| 157 | 3300005441 | Ga0070700_100056026 | Ga0070700_1000560262 | 321 |
| 158 | 3300005441 | Ga0070700_100057362 | Ga0070700_1000573622 | 321 |
| 159 | 3300005441 | Ga0070700_100237035 | Ga0070700_1002370351 | 321 |
| 160 | 3300005444 | Ga0070694_100033130 | Ga0070694_1000331302 | 321 |
| 161 | 3300005444 | Ga0070694_100067981 | Ga0070694_1000679812 | 321 |
| 162 | 3300005444 | Ga0070694_100072084 | Ga0070694_1000720842 | 321 |
| 163 | 3300005444 | Ga0070694_100083466 | Ga0070694_1000834662 | 321 |
| 164 | 3300005444 | Ga0070694_100093984 | Ga0070694_1000939842 | 321 |
| 165 | 3300005444 | Ga0070694_100116843 | Ga0070694_1001168432 | 321 |
| 166 | 3300005444 | Ga0070694_100121614 | Ga0070694_1001216142 | 321 |
| 167 | 3300005444 | Ga0070694_100153350 | Ga0070694_1001533502 | 321 |
| 168 | 3300005444 | Ga0070694_100161701 | Ga0070694_1001617012 | 321 |
| 169 | 3300005445 | Ga0070708_100196576 | Ga0070708_1001965762 | 321 |
| 170 | 3300005456 | Ga0070678_100205433 | Ga0070678_1002054332 | 321 |
| 171 | 3300005457 | Ga0070662_100240709 | Ga0070662_1002407092 | 321 |
| 172 | 3300005458 | Ga0070681_10003280 | Ga0070681_100032804 | 321 |
| 173 | 3300005458 | Ga0070681_10017543 | Ga0070681_100175432 | 321 |
| 174 | 3300005458 | Ga0070681_10144463 | Ga0070681_101444632 | 321 |
| 175 | 3300005459 | Ga0068867_100017874 | Ga0068867_1000178744 | 321 |
| 176 | 3300005459 | Ga0068867_100045417 | Ga0068867_1000454172 | 321 |
| 177 | 3300005459 | Ga0068867_100183472 | Ga0068867_1001834722 | 321 |
| 178 | 3300005459 | Ga0068867_100325581 | Ga0068867_1003255812 | 321 |
| 179 | 3300005466 | Ga0070685_10006707 | Ga0070685_100067073 | 321 |
| 180 | 3300005467 | Ga0070706_100000085 | Ga0070706_10000008551 | 321 |
| 181 | 3300005467 | Ga0070706_100001794 | Ga0070706_10000179420 | 321 |
| 182 | 3300005468 | Ga0070707_100023548 | Ga0070707_1000235486 | 321 |
| 183 | 3300005471 | Ga0070698_100051202 | Ga0070698_1000512024 | 321 |
| 184 | 3300005518 | Ga0070699_100005204 | Ga0070699_1000052046 | 321 |
| 185 | 3300005518 | Ga0070699_100130238 | Ga0070699_1001302382 | 321 |
| 186 | 3300005518 | Ga0070699_100266586 | Ga0070699_1002665861 | 321 |
| 187 | 3300005536 | Ga0070697_100000185 | Ga0070697_10000018526 | 321 |
| 188 | 3300005536 | Ga0070697_100060250 | Ga0070697_1000602502 | 321 |
| 189 | 3300005536 | Ga0070697_100168950 | Ga0070697_1001689502 | 321 |
| 190 | 3300005536 | Ga0070697_100169394 | Ga0070697_1001693942 | 321 |
| 191 | 3300005539 | Ga0068853_100034440 | Ga0068853_1000344403 | 321 |
| 192 | 3300005539 | Ga0068853_100046864 | Ga0068853_1000468642 | 321 |
| 193 | 3300005543 | Ga0070672_100031586 | Ga0070672_1000315863 | 321 |
| 194 | 3300005543 | Ga0070672_100100828 | Ga0070672_1001008282 | 321 |
| 195 | 3300005544 | Ga0070686_100004398 | Ga0070686_1000043983 | 321 |
| 196 | 3300005544 | Ga0070686_100006843 | Ga0070686_1000068432 | 321 |
| 197 | 3300005545 | Ga0070695_100006453 | Ga0070695_1000064533 | 321 |
| 198 | 3300005545 | Ga0070695_100021763 | Ga0070695_1000217634 | 321 |
| 199 | 3300005545 | Ga0070695_100342451 | Ga0070695_1003424511 | 321 |
| 200 | 3300005545 | Ga0070695_100379992 | Ga0070695_1003799921 | 321 |
| 201 | 3300005546 | Ga0070696_100026844 | Ga0070696_1000268442 | 321 |
| 202 | 3300005546 | Ga0070696_100228828 | Ga0070696_1002288282 | 321 |
| 203 | 3300005547 | Ga0070693_100001191 | Ga0070693_1000011912 | 321 |
| 204 | 3300005547 | Ga0070693_100039689 | Ga0070693_1000396892 | 321 |
| 205 | 3300005547 | Ga0070693_100044511 | Ga0070693_1000445113 | 321 |
| 206 | 3300005547 | Ga0070693_100101520 | Ga0070693_1001015202 | 321 |
| 207 | 3300005547 | Ga0070693_100140309 | Ga0070693_1001403091 | 321 |
| 208 | 3300005549 | Ga0070704_100187566 | Ga0070704_1001875662 | 321 |
| 209 | 3300005549 | Ga0070704_100301802 | Ga0070704_1003018022 | 321 |
| 210 | 3300005564 | Ga0070664_100001504 | Ga0070664_1000015048 | 321 |
| 211 | 3300005564 | Ga0070664_100226889 | Ga0070664_1002268891 | 321 |
| 212 | 3300005577 | Ga0068857_100001572 | Ga0068857_1000015722 | 321 |
| 213 | 3300005578 | Ga0068854_100137918 | Ga0068854_1001379182 | 321 |
| 214 | 3300005578 | Ga0068854_100177985 | Ga0068854_1001779852 | 321 |
| 215 | 3300005615 | Ga0070702_100007094 | Ga0070702_1000070945 | 321 |
| 216 | 3300005615 | Ga0070702_100023679 | Ga0070702_1000236792 | 321 |
| 217 | 3300005615 | Ga0070702_100144443 | Ga0070702_1001444432 | 321 |
| 218 | 3300005615 | Ga0070702_100149802 | Ga0070702_1001498021 | 321 |
| 219 | 3300005615 | Ga0070702_100324277 | Ga0070702_1003242771 | 321 |
| 220 | 3300005616 | Ga0068852_100061730 | Ga0068852_1000617303 | 321 |
| 221 | 3300005617 | Ga0068859_100043326 | Ga0068859_1000433262 | 321 |
| 222 | 3300005617 | Ga0068859_100060989 | Ga0068859_1000609893 | 321 |
| 223 | 3300005617 | Ga0068859_100091446 | Ga0068859_1000914462 | 321 |
| 224 | 3300005617 | Ga0068859_100173000 | Ga0068859_1001730002 | 321 |
| 225 | 3300005617 | Ga0068859_100371614 | Ga0068859_1003716142 | 321 |
| 226 | 3300005617 | Ga0068859_100479410 | Ga0068859_1004794102 | 321 |
| 227 | 3300005617 | Ga0068859_100530649 | Ga0068859_1005306491 | 321 |
| 228 | 3300005618 | Ga0068864_100002042 | Ga0068864_1000020427 | 321 |
| 229 | 3300005618 | Ga0068864_100008211 | Ga0068864_1000082112 | 321 |
| 230 | 3300005618 | Ga0068864_100009537 | Ga0068864_1000095377 | 321 |
| 231 | 3300005618 | Ga0068864_100034938 | Ga0068864_1000349382 | 321 |
| 232 | 3300005618 | Ga0068864_100036528 | Ga0068864_1000365282 | 321 |
| 233 | 3300005618 | Ga0068864_100091140 | Ga0068864_1000911403 | 321 |
| 234 | 3300005618 | Ga0068864_100153768 | Ga0068864_1001537681 | 321 |
| 235 | 3300005618 | Ga0068864_100474705 | Ga0068864_1004747052 | 321 |
| 236 | 3300005718 | Ga0068866_10027133 | Ga0068866_100271332 | 321 |
| 237 | 3300005718 | Ga0068866_10167711 | Ga0068866_101677111 | 321 |
| 238 | 3300005719 | Ga0068861_100010166 | Ga0068861_1000101663 | 321 |
| 239 | 3300005719 | Ga0068861_100109377 | Ga0068861_1001093772 | 321 |
| 240 | 3300005719 | Ga0068861_100289306 | Ga0068861_1002893062 | 321 |
| 241 | 3300005840 | Ga0068870_10005814 | Ga0068870_100058145 | 321 |
| 242 | 3300005840 | Ga0068870_10017132 | Ga0068870_100171324 | 321 |
| 243 | 3300005841 | Ga0068863_100011832 | Ga0068863_1000118328 | 321 |
| 244 | 3300005841 | Ga0068863_100016037 | Ga0068863_1000160375 | 321 |
| 245 | 3300005842 | Ga0068858_100022666 | Ga0068858_1000226663 | 321 |
| 246 | 3300005842 | Ga0068858_100050238 | Ga0068858_1000502382 | 321 |
| 247 | 3300005843 | Ga0068860_100013025 | Ga0068860_1000130257 | 321 |
| 248 | 3300005843 | Ga0068860_100019826 | Ga0068860_1000198264 | 321 |
| 249 | 3300005843 | Ga0068860_100025210 | Ga0068860_1000252104 | 321 |
| 250 | 3300005843 | Ga0068860_100056529 | Ga0068860_1000565293 | 321 |
| 251 | 3300005843 | Ga0068860_100092550 | Ga0068860_1000925502 | 321 |
| 252 | 3300005843 | Ga0068860_100093489 | Ga0068860_1000934891 | 321 |
| 253 | 3300005843 | Ga0068860_100185370 | Ga0068860_1001853702 | 321 |
| 254 | 3300005844 | Ga0068862_100006429 | Ga0068862_1000064293 | 321 |
| 255 | 3300005844 | Ga0068862_100033949 | Ga0068862_1000339494 | 321 |
| 256 | 3300005844 | Ga0068862_100135176 | Ga0068862_1001351762 | 321 |
| 257 | 3300005985 | Ga0081539_10000490 | Ga0081539_1000049021 | 321 |
| 258 | 3300005985 | Ga0081539_10001185 | Ga0081539_1000118526 | 321 |
| 259 | 3300006237 | Ga0097621_100001228 | Ga0097621_10000122812 | 321 |
| 260 | 3300006237 | Ga0097621_100007569 | Ga0097621_1000075693 | 321 |
| 261 | 3300006237 | Ga0097621_100034435 | Ga0097621_1000344352 | 321 |
| 262 | 3300006237 | Ga0097621_100193255 | Ga0097621_1001932552 | 321 |
| 263 | 3300006358 | Ga0068871_100006731 | Ga0068871_1000067316 | 321 |
| 264 | 3300006358 | Ga0068871_100021738 | Ga0068871_1000217385 | 321 |
| 265 | 3300006358 | Ga0068871_100218082 | Ga0068871_1002180822 | 321 |
| 266 | 3300006844 | Ga0075428_100223566 | Ga0075428_1002235662 | 321 |
| 267 | 3300006844 | Ga0075428_100284002 | Ga0075428_1002840022 | 321 |
| 268 | 3300006846 | Ga0075430_100021293 | Ga0075430_1000212933 | 321 |
| 269 | 3300006847 | Ga0075431_100034700 | Ga0075431_1000347003 | 321 |
| 270 | 3300006847 | Ga0075431_100112941 | Ga0075431_1001129412 | 321 |
| 271 | 3300006847 | Ga0075431_100174762 | Ga0075431_1001747622 | 321 |
| 272 | 3300006852 | Ga0075433_10088105 | Ga0075433_100881052 | 321 |
| 273 | 3300006852 | Ga0075433_10099466 | Ga0075433_100994663 | 321 |
| 274 | 3300006871 | Ga0075434_100073864 | Ga0075434_1000738642 | 321 |
| 275 | 3300006871 | Ga0075434_100375946 | Ga0075434_1003759462 | 321 |
| 276 | 3300006880 | Ga0075429_100011999 | Ga0075429_1000119994 | 321 |
| 277 | 3300006880 | Ga0075429_100012206 | Ga0075429_1000122065 | 321 |
| 278 | 3300006881 | Ga0068865_100004466 | Ga0068865_1000044666 | 321 |
| 279 | 3300006881 | Ga0068865_100191763 | Ga0068865_1001917631 | 321 |
| 280 | 3300006931 | Ga0097620_100043326 | Ga0097620_1000433262 | 321 |
| 281 | 3300006931 | Ga0097620_100060987 | Ga0097620_1000609873 | 321 |
| 282 | 3300006931 | Ga0097620_100091451 | Ga0097620_1000914512 | 321 |
| 283 | 3300006931 | Ga0097620_100172973 | Ga0097620_1001729732 | 321 |
| 284 | 3300006931 | Ga0097620_100371616 | Ga0097620_1003716161 | 321 |
| 285 | 3300006931 | Ga0097620_100479417 | Ga0097620_1004794172 | 321 |
| 286 | 3300006931 | Ga0097620_100530648 | Ga0097620_1005306481 | 321 |
| 287 | 3300007076 | Ga0075435_100014989 | Ga0075435_1000149892 | 321 |
| 288 | 3300009011 | Ga0105251_10016329 | Ga0105251_100163293 | 321 |
| 289 | 3300009093 | Ga0105240_10098836 | Ga0105240_100988362 | 321 |
| 290 | 3300009093 | Ga0105240_10668362 | Ga0105240_106683622 | 321 |
| 291 | 3300009094 | Ga0111539_10000363 | Ga0111539_1000036331 | 321 |
| 292 | 3300009094 | Ga0111539_10006962 | Ga0111539_1000696212 | 321 |
| 293 | 3300009094 | Ga0111539_10008997 | Ga0111539_100089979 | 321 |
| 294 | 3300009094 | Ga0111539_10205855 | Ga0111539_102058551 | 321 |
| 295 | 3300009101 | Ga0105247_10008133 | Ga0105247_100081337 | 321 |
| 296 | 3300009101 | Ga0105247_10053247 | Ga0105247_100532472 | 321 |
| 297 | 3300009147 | Ga0114129_10001544 | Ga0114129_1000154422 | 321 |
| 298 | 3300009147 | Ga0114129_10004096 | Ga0114129_100040967 | 321 |
| 299 | 3300009147 | Ga0114129_10015160 | Ga0114129_100151607 | 321 |
| 300 | 3300009147 | Ga0114129_10144085 | Ga0114129_101440853 | 321 |
| 301 | 3300009147 | Ga0114129_10188611 | Ga0114129_101886112 | 321 |
| 302 | 3300009147 | Ga0114129_10428059 | Ga0114129_104280592 | 321 |
| 303 | 3300009147 | Ga0114129_10694139 | Ga0114129_106941391 | 321 |
| 304 | 3300009148 | Ga0105243_10010825 | Ga0105243_100108252 | 321 |
| 305 | 3300009148 | Ga0105243_10119963 | Ga0105243_101199632 | 321 |
| 306 | 3300009148 | Ga0105243_10260737 | Ga0105243_102607372 | 321 |
| 307 | 3300009148 | Ga0105243_10428811 | Ga0105243_104288111 | 321 |
| 308 | 3300009176 | Ga0105242_10026574 | Ga0105242_100265743 | 321 |
| 309 | 3300009176 | Ga0105242_10074172 | Ga0105242_100741721 | 321 |
| 310 | 3300009176 | Ga0105242_10356144 | Ga0105242_103561441 | 321 |
| 311 | 3300009177 | Ga0105248_10001196 | Ga0105248_1000119614 | 321 |
| 312 | 3300009177 | Ga0105248_10003773 | Ga0105248_100037734 | 321 |
| 313 | 3300009177 | Ga0105248_10025249 | Ga0105248_100252492 | 321 |
| 314 | 3300009177 | Ga0105248_10032844 | Ga0105248_100328445 | 321 |
| 315 | 3300009177 | Ga0105248_10071540 | Ga0105248_100715404 | 321 |
| 316 | 3300009177 | Ga0105248_10103172 | Ga0105248_101031723 | 321 |
| 317 | 3300009177 | Ga0105248_10254774 | Ga0105248_102547742 | 321 |
| 318 | 3300009177 | Ga0105248_10481718 | Ga0105248_104817182 | 321 |
| 319 | 3300009545 | Ga0105237_10005294 | Ga0105237_100052942 | 321 |
| 320 | 3300009545 | Ga0105237_10064277 | Ga0105237_100642774 | 321 |
| 321 | 3300009551 | Ga0105238_10010842 | Ga0105238_100108422 | 321 |
| 322 | 3300009551 | Ga0105238_10011684 | Ga0105238_100116842 | 321 |
| 323 | 3300009553 | Ga0105249_10022032 | Ga0105249_100220324 | 321 |
| 324 | 3300009553 | Ga0105249_10114402 | Ga0105249_101144021 | 321 |
| 325 | 3300010375 | Ga0105239_10156440 | Ga0105239_101564402 | 321 |
| 326 | 3300010375 | Ga0105239_10203733 | Ga0105239_102037332 | 321 |
| 327 | 3300010375 | Ga0105239_10355723 | Ga0105239_103557232 | 321 |
| 328 | 3300011119 | Ga0105246_10077071 | Ga0105246_100770712 | 321 |
| 329 | 3300011119 | Ga0105246_10103450 | Ga0105246_101034502 | 321 |
| 330 | 3300013100 | Ga0157373_10001751 | Ga0157373_100017513 | 321 |
| 331 | 3300013100 | Ga0157373_10028075 | Ga0157373_100280753 | 321 |
| 332 | 3300013100 | Ga0157373_10045450 | Ga0157373_100454503 | 321 |
| 333 | 3300013100 | Ga0157373_10115994 | Ga0157373_101159942 | 321 |
| 334 | 3300013102 | Ga0157371_10174476 | Ga0157371_101744762 | 321 |
| 335 | 3300013296 | Ga0157374_10043294 | Ga0157374_100432944 | 321 |
| 336 | 3300013296 | Ga0157374_10199208 | Ga0157374_101992082 | 321 |
| 337 | 3300013297 | Ga0157378_10003037 | Ga0157378_100030378 | 321 |
| 338 | 3300013297 | Ga0157378_10016656 | Ga0157378_100166566 | 321 |
| 339 | 3300013297 | Ga0157378_10187686 | Ga0157378_101876862 | 321 |
| 340 | 3300013306 | Ga0163162_10128762 | Ga0163162_101287622 | 321 |
| 341 | 3300013306 | Ga0163162_10145808 | Ga0163162_101458083 | 321 |
| 342 | 3300013307 | Ga0157372_10083424 | Ga0157372_100834242 | 321 |
| 343 | 3300013308 | Ga0157375_10007521 | Ga0157375_100075212 | 321 |
| 344 | 3300013308 | Ga0157375_10292801 | Ga0157375_102928012 | 321 |
| 345 | 3300013308 | Ga0157375_10323268 | Ga0157375_103232682 | 321 |
| 346 | 3300014325 | Ga0163163_10000527 | Ga0163163_1000052712 | 321 |
| 347 | 3300014325 | Ga0163163_10001737 | Ga0163163_100017376 | 321 |
| 348 | 3300014325 | Ga0163163_10002364 | Ga0163163_100023648 | 321 |
| 349 | 3300014325 | Ga0163163_10016201 | Ga0163163_100162016 | 321 |
| 350 | 3300014325 | Ga0163163_10018843 | Ga0163163_100188432 | 321 |
| 351 | 3300014325 | Ga0163163_10039964 | Ga0163163_100399641 | 321 |
| 352 | 3300014325 | Ga0163163_10183694 | Ga0163163_101836942 | 321 |
| 353 | 3300014325 | Ga0163163_10202816 | Ga0163163_102028162 | 321 |
| 354 | 3300014325 | Ga0163163_10267191 | Ga0163163_102671912 | 321 |
| 355 | 3300014326 | Ga0157380_10000265 | Ga0157380_1000026524 | 321 |
| 356 | 3300014326 | Ga0157380_10008907 | Ga0157380_100089076 | 321 |
| 357 | 3300014326 | Ga0157380_10537709 | Ga0157380_105377092 | 321 |
| 358 | 3300014968 | Ga0157379_10020108 | Ga0157379_100201082 | 321 |
| 359 | 3300017792 | Ga0163161_10011552 | Ga0163161_100115522 | 321 |
| 360 | 3300025321 | Ga0207656_10006930 | Ga0207656_100069302 | 321 |
| 361 | 3300025885 | Ga0207653_10002090 | Ga0207653_100020903 | 321 |
| 362 | 3300025885 | Ga0207653_10103081 | Ga0207653_101030811 | 321 |
| 363 | 3300025893 | Ga0207682_10054488 | Ga0207682_100544882 | 321 |
| 364 | 3300025899 | Ga0207642_10017617 | Ga0207642_100176172 | 321 |
| 365 | 3300025900 | Ga0207710_10001827 | Ga0207710_100018279 | 321 |
| 366 | 3300025900 | Ga0207710_10036716 | Ga0207710_100367162 | 321 |
| 367 | 3300025904 | Ga0207647_10004110 | Ga0207647_100041106 | 321 |
| 368 | 3300025904 | Ga0207647_10176111 | Ga0207647_101761111 | 321 |
| 369 | 3300025907 | Ga0207645_10196822 | Ga0207645_101968222 | 321 |
| 370 | 3300025908 | Ga0207643_10001120 | Ga0207643_100011203 | 321 |
| 371 | 3300025908 | Ga0207643_10003371 | Ga0207643_100033712 | 321 |
| 372 | 3300025908 | Ga0207643_10053765 | Ga0207643_100537653 | 321 |
| 373 | 3300025910 | Ga0207684_10000091 | Ga0207684_1000009161 | 321 |
| 374 | 3300025911 | Ga0207654_10121937 | Ga0207654_101219372 | 321 |
| 375 | 3300025911 | Ga0207654_10156045 | Ga0207654_101560452 | 321 |
| 376 | 3300025912 | Ga0207707_10016207 | Ga0207707_100162072 | 321 |
| 377 | 3300025912 | Ga0207707_10142137 | Ga0207707_101421372 | 321 |
| 378 | 3300025913 | Ga0207695_10215343 | Ga0207695_102153432 | 321 |
| 379 | 3300025914 | Ga0207671_10003947 | Ga0207671_1000394714 | 321 |
| 380 | 3300025914 | Ga0207671_10044532 | Ga0207671_100445323 | 321 |
| 381 | 3300025917 | Ga0207660_10300096 | Ga0207660_103000961 | 321 |
| 382 | 3300025918 | Ga0207662_10002588 | Ga0207662_100025883 | 321 |
| 383 | 3300025918 | Ga0207662_10023969 | Ga0207662_100239693 | 321 |
| 384 | 3300025918 | Ga0207662_10141441 | Ga0207662_101414412 | 321 |
| 385 | 3300025919 | Ga0207657_10225236 | Ga0207657_102252362 | 321 |
| 386 | 3300025920 | Ga0207649_10166500 | Ga0207649_101665002 | 321 |
| 387 | 3300025922 | Ga0207646_10119012 | Ga0207646_101190122 | 321 |
| 388 | 3300025922 | Ga0207646_10183041 | Ga0207646_101830412 | 321 |
| 389 | 3300025923 | Ga0207681_10002711 | Ga0207681_100027113 | 321 |
| 390 | 3300025923 | Ga0207681_10017953 | Ga0207681_100179534 | 321 |
| 391 | 3300025924 | Ga0207694_10002853 | Ga0207694_100028538 | 321 |
| 392 | 3300025925 | Ga0207650_10000009 | Ga0207650_1000000981 | 321 |
| 393 | 3300025925 | Ga0207650_10011336 | Ga0207650_100113364 | 321 |
| 394 | 3300025931 | Ga0207644_10113680 | Ga0207644_101136802 | 321 |
| 395 | 3300025932 | Ga0207690_10068558 | Ga0207690_100685582 | 321 |
| 396 | 3300025933 | Ga0207706_10174379 | Ga0207706_101743792 | 321 |
| 397 | 3300025934 | Ga0207686_10044518 | Ga0207686_100445183 | 321 |
| 398 | 3300025934 | Ga0207686_10073747 | Ga0207686_100737472 | 321 |
| 399 | 3300025935 | Ga0207709_10006238 | Ga0207709_100062382 | 321 |
| 400 | 3300025936 | Ga0207670_10106355 | Ga0207670_101063552 | 321 |
| 401 | 3300025936 | Ga0207670_10191771 | Ga0207670_101917712 | 321 |
| 402 | 3300025937 | Ga0207669_10019044 | Ga0207669_100190442 | 321 |
| 403 | 3300025938 | Ga0207704_10018306 | Ga0207704_100183063 | 321 |
| 404 | 3300025938 | Ga0207704_10019506 | Ga0207704_100195063 | 321 |
| 405 | 3300025940 | Ga0207691_10004885 | Ga0207691_100048859 | 321 |
| 406 | 3300025941 | Ga0207711_10003601 | Ga0207711_100036017 | 321 |
| 407 | 3300025941 | Ga0207711_10009207 | Ga0207711_100092077 | 321 |
| 408 | 3300025941 | Ga0207711_10010789 | Ga0207711_100107895 | 321 |
| 409 | 3300025941 | Ga0207711_10028743 | Ga0207711_100287434 | 321 |
| 410 | 3300025941 | Ga0207711_10065475 | Ga0207711_100654751 | 321 |
| 411 | 3300025941 | Ga0207711_10163341 | Ga0207711_101633412 | 321 |
| 412 | 3300025941 | Ga0207711_10244043 | Ga0207711_102440432 | 321 |
| 413 | 3300025941 | Ga0207711_10335852 | Ga0207711_103358522 | 321 |
| 414 | 3300025942 | Ga0207689_10007562 | Ga0207689_100075625 | 321 |
| 415 | 3300025942 | Ga0207689_10221895 | Ga0207689_102218951 | 321 |
| 416 | 3300025942 | Ga0207689_10350420 | Ga0207689_103504202 | 321 |
| 417 | 3300025945 | Ga0207679_10033023 | Ga0207679_100330233 | 321 |
| 418 | 3300025945 | Ga0207679_10101656 | Ga0207679_101016562 | 321 |
| 419 | 3300025960 | Ga0207651_10013356 | Ga0207651_100133562 | 321 |
| 420 | 3300025961 | Ga0207712_10021155 | Ga0207712_100211553 | 321 |
| 421 | 3300025961 | Ga0207712_10028853 | Ga0207712_100288533 | 321 |
| 422 | 3300025961 | Ga0207712_10137827 | Ga0207712_101378272 | 321 |
| 423 | 3300025981 | Ga0207640_10195609 | Ga0207640_101956092 | 321 |
| 424 | 3300025986 | Ga0207658_10067932 | Ga0207658_100679322 | 321 |
| 425 | 3300026023 | Ga0207677_10002787 | Ga0207677_100027874 | 321 |
| 426 | 3300026023 | Ga0207677_10110438 | Ga0207677_101104382 | 321 |
| 427 | 3300026023 | Ga0207677_10343191 | Ga0207677_103431911 | 321 |
| 428 | 3300026035 | Ga0207703_10012873 | Ga0207703_100128731 | 321 |
| 429 | 3300026035 | Ga0207703_10089479 | Ga0207703_100894792 | 321 |
| 430 | 3300026035 | Ga0207703_10100985 | Ga0207703_101009852 | 321 |
| 431 | 3300026041 | Ga0207639_10026488 | Ga0207639_100264883 | 321 |
| 432 | 3300026041 | Ga0207639_10196403 | Ga0207639_101964032 | 321 |
| 433 | 3300026075 | Ga0207708_10000017 | Ga0207708_1000001755 | 321 |
| 434 | 3300026075 | Ga0207708_10005588 | Ga0207708_100055887 | 321 |
| 435 | 3300026075 | Ga0207708_10029375 | Ga0207708_100293754 | 321 |
| 436 | 3300026075 | Ga0207708_10037248 | Ga0207708_100372482 | 321 |
| 437 | 3300026075 | Ga0207708_10051465 | Ga0207708_100514653 | 321 |
| 438 | 3300026075 | Ga0207708_10177105 | Ga0207708_101771052 | 321 |
| 439 | 3300026088 | Ga0207641_10014008 | Ga0207641_100140084 | 321 |
| 440 | 3300026088 | Ga0207641_10231920 | Ga0207641_102319202 | 321 |
| 441 | 3300026089 | Ga0207648_10016645 | Ga0207648_100166456 | 321 |
| 442 | 3300026089 | Ga0207648_10052280 | Ga0207648_100522804 | 321 |
| 443 | 3300026089 | Ga0207648_10233716 | Ga0207648_102337162 | 321 |
| 444 | 3300026089 | Ga0207648_10295211 | Ga0207648_102952112 | 321 |
| 445 | 3300026095 | Ga0207676_10002795 | Ga0207676_100027957 | 321 |
| 446 | 3300026095 | Ga0207676_10006630 | Ga0207676_100066303 | 321 |
| 447 | 3300026095 | Ga0207676_10090961 | Ga0207676_100909613 | 321 |
| 448 | 3300026116 | Ga0207674_10000036 | Ga0207674_1000003677 | 321 |
| 449 | 3300026116 | Ga0207674_10045652 | Ga0207674_100456523 | 321 |
| 450 | 3300026116 | Ga0207674_10290065 | Ga0207674_102900652 | 321 |
| 451 | 3300026118 | Ga0207675_100018298 | Ga0207675_1000182986 | 321 |
| 452 | 3300026118 | Ga0207675_100045611 | Ga0207675_1000456114 | 321 |
| 453 | 3300026118 | Ga0207675_100065736 | Ga0207675_1000657363 | 321 |
| 454 | 3300026118 | Ga0207675_100149601 | Ga0207675_1001496012 | 321 |
| 455 | 3300026118 | Ga0207675_100225835 | Ga0207675_1002258352 | 321 |
| 456 | 3300026118 | Ga0207675_100255169 | Ga0207675_1002551692 | 321 |
| 457 | 3300026121 | Ga0207683_10016580 | Ga0207683_100165803 | 321 |
| 458 | 3300026142 | Ga0207698_10448353 | Ga0207698_104483532 | 321 |
| 459 | 3300027907 | Ga0207428_10018672 | Ga0207428_100186722 | 321 |
| 460 | 3300027907 | Ga0207428_10061655 | Ga0207428_100616553 | 321 |
| 461 | 3300027907 | Ga0207428_10101316 | Ga0207428_101013162 | 321 |
| 462 | 3300028380 | Ga0268265_10027908 | Ga0268265_100279083 | 321 |
| 463 | 3300028381 | Ga0268264_10010099 | Ga0268264_100100998 | 321 |
| 464 | 3300028381 | Ga0268264_10018398 | Ga0268264_100183982 | 321 |
| 465 | 3300028381 | Ga0268264_10054779 | Ga0268264_100547792 | 321 |
| 466 | 3300028381 | Ga0268264_10076365 | Ga0268264_100763653 | 321 |
| 467 | 3300028381 | Ga0268264_10172986 | Ga0268264_101729862 | 321 |
| 468 | 3300028381 | Ga0268264_10532530 | Ga0268264_105325301 | 321 |
| 469 | 3300031548 | Ga0307408_100027790 | Ga0307408_1000277903 | 321 |
| 470 | 3300031548 | Ga0307408_100042092 | Ga0307408_1000420922 | 321 |
| 471 | 3300031731 | Ga0307405_10035381 | Ga0307405_100353812 | 321 |
| 472 | 3300031824 | Ga0307413_10151562 | Ga0307413_101515622 | 321 |
| 473 | 3300031852 | Ga0307410_10015545 | Ga0307410_100155453 | 321 |
| 474 | 3300031852 | Ga0307410_10234763 | Ga0307410_102347631 | 321 |
| 475 | 3300031901 | Ga0307406_10105178 | Ga0307406_101051781 | 321 |
| 476 | 3300031901 | Ga0307406_10145111 | Ga0307406_101451112 | 321 |
| 477 | 3300031901 | Ga0307406_10167182 | Ga0307406_101671822 | 321 |
| 478 | 3300031901 | Ga0307406_10287327 | Ga0307406_102873272 | 321 |
| 479 | 3300031911 | Ga0307412_10049850 | Ga0307412_100498502 | 321 |
| 480 | 3300031911 | Ga0307412_10283353 | Ga0307412_102833532 | 321 |
| 481 | 3300032002 | Ga0307416_100088195 | Ga0307416_1000881953 | 321 |
| 482 | 3300032002 | Ga0307416_100175897 | Ga0307416_1001758972 | 321 |
| 483 | 3300032002 | Ga0307416_100646917 | Ga0307416_1006469172 | 321 |
| 484 | 3300032004 | Ga0307414_10037026 | Ga0307414_100370262 | 321 |
| 485 | 3300032004 | Ga0307414_10037189 | Ga0307414_100371893 | 321 |
| 486 | 3300032004 | Ga0307414_10042283 | Ga0307414_100422832 | 321 |
| 487 | 3300032005 | Ga0307411_10022267 | Ga0307411_100222672 | 321 |
| 488 | 3300032005 | Ga0307411_10097921 | Ga0307411_100979212 | 321 |
| 489 | 3300032126 | Ga0307415_100006760 | Ga0307415_1000067603 | 321 |
| 490 | 3300032126 | Ga0307415_100077588 | Ga0307415_1000775882 | 321 |
| 491 | 3300035207 | Ga0373942_0003433 | Ga0373942_0003433_2439_3404 | 321 |
| 492 | 3300036401 | Ga0373937_0048963 | Ga0373937_0048963_2280_3245 | 321 |
| 493 | 3300037418 | Ga0395900_0020609 | Ga0395900_0020609_5017_5982 | 321 |
| 494 | 3300037466 | Ga0395898_0369869 | Ga0395898_0369869_186_1151 | 321 |
| 495 | 3300038443 | Ga0395901_0253897 | Ga0395901_0253897_638_1603 | 321 |
| 496 | 3300038443 | Ga0395901_0363805 | Ga0395901_0363805_91_1056 | 321 |
| 497 | 3300042005 | Ga0439448_0009894 | Ga0439448_0009894_1758_2723 | 321 |
| 498 | 3300042015 | Ga0439462_0016216 | Ga0439462_0016216_477_1442 | 321 |
| 499 | 3300042157 | Ga0439458_0014659 | Ga0439458_0014659_265_1230 | 321 |
| 500 | 3300045051 | Ga0451576_0100039 | Ga0451576_0100039_408_1373 | 321 |
| 501 | 3300046512 | Ga0495610_0064448 | Ga0495610_0064448_754_1719 | 321 |
| 502 | 3300046525 | Ga0495663_0013055 | Ga0495663_0013055_1088_2053 | 321 |
| 503 | 3300046537 | Ga0495598_0000421 | Ga0495598_0000421_5723_6688 | 321 |
| 504 | 3300046539 | Ga0495621_0000030 | Ga0495621_0000030_20027_20992 | 321 |
| 505 | 3300046539 | Ga0495621_0023954 | Ga0495621_0023954_433_1398 | 321 |
| 506 | 3300046615 | Ga0495656_0019823 | Ga0495656_0019823_1329_2294 | 321 |
| 507 | 3300048907 | Ga0496104_0200832 | Ga0496104_0200832_509_1474 | 321 |
| 508 | 3300048909 | Ga0496106_0176718 | Ga0496106_0176718_388_1353 | 321 |
| 509 | 3300048911 | Ga0496108_0130880 | Ga0496108_0130880_355_1320 | 321 |
| 510 | 3300048912 | Ga0496109_0110988 | Ga0496109_0110988_140_1105 | 321 |
| 511 | 3300048915 | Ga0496112_0161796 | Ga0496112_0161796_175_1140 | 321 |
| 512 | 3300049515 | Ga0501292_006900 | Ga0501292_006900_402_1367 | 321 |
| 513 | 3300049519 | Ga0501296_000317 | Ga0501296_000317_1496_2461 | 321 |
| 514 | 3300049519 | Ga0501296_000595 | Ga0501296_000595_83_1048 | 321 |
| 515 | 3300049519 | Ga0501296_002360 | Ga0501296_002360_73_1038 | 321 |
| 516 | 3300049520 | Ga0501297_006335 | Ga0501297_006335_63_1028 | 321 |
| 517 | 3300049521 | Ga0501298_000922 | Ga0501298_000922_743_1708 | 321 |
| 518 | 3300049521 | Ga0501298_001555 | Ga0501298_001555_2280_3245 | 321 |
| 519 | 3300049521 | Ga0501298_006669 | Ga0501298_006669_200_1165 | 321 |
| 520 | 3300049522 | Ga0501299_000809 | Ga0501299_000809_2459_3424 | 321 |
| 521 | 3300049522 | Ga0501299_010285 | Ga0501299_010285_548_1513 | 321 |
| 522 | 3300049574 | Ga0501038_0006435 | Ga0501038_0006435_4605_5570 | 321 |
| 523 | 3300049592 | Ga0501076_0199646 | Ga0501076_0199646_31_996 | 321 |
| 524 | 3300049592 | Ga0501076_0423906 | Ga0501076_0423906_89_1054 | 321 |
| 525 | 3300049649 | Ga0501198_002543 | Ga0501198_002543_407_1372 | 321 |
| 526 | 3300049652 | Ga0501202_005956 | Ga0501202_005956_1040_2005 | 321 |
| 527 | 3300049652 | Ga0501202_006231 | Ga0501202_006231_1052_2017 | 321 |
| 528 | 3300049660 | Ga0501216_000441 | Ga0501216_000441_1900_2865 | 321 |
| 529 | 3300049660 | Ga0501216_011440 | Ga0501216_011440_34_999 | 321 |
| 530 | 3300049660 | Ga0501216_011563 | Ga0501216_011563_252_1217 | 321 |
| 531 | 3300049661 | Ga0501217_000754 | Ga0501217_000754_4077_5042 | 321 |
| 532 | 3300049661 | Ga0501217_006729 | Ga0501217_006729_231_1196 | 321 |
| 533 | 3300049663 | Ga0501223_008123 | Ga0501223_008123_709_1674 | 321 |
| 534 | 3300049664 | Ga0501224_011431 | Ga0501224_011431_93_1058 | 321 |
| 535 | 3300049667 | Ga0501230_000349 | Ga0501230_000349_2052_3017 | 321 |
| 536 | 3300049668 | Ga0501233_000192 | Ga0501233_000192_1108_2073 | 321 |
| 537 | 3300049668 | Ga0501233_002483 | Ga0501233_002483_1861_2826 | 321 |
| 538 | 3300049668 | Ga0501233_006880 | Ga0501233_006880_74_1039 | 321 |
| 539 | 3300049669 | Ga0501235_001929 | Ga0501235_001929_762_1727 | 321 |
| 540 | 3300049669 | Ga0501235_002948 | Ga0501235_002948_2147_3112 | 321 |
| 541 | 3300049669 | Ga0501235_003278 | Ga0501235_003278_2051_3016 | 321 |
| 542 | 3300049669 | Ga0501235_031424 | Ga0501235_031424_201_1166 | 321 |
| 543 | 3300049670 | Ga0501236_009690 | Ga0501236_009690_176_1141 | 321 |
| 544 | 3300049671 | Ga0501238_009752 | Ga0501238_009752_194_1159 | 321 |
| 545 | 3300049672 | Ga0501239_005766 | Ga0501239_005766_186_1151 | 321 |
| 546 | 3300049675 | Ga0501243_010844 | Ga0501243_010844_410_1375 | 321 |
| 547 | 3300049679 | Ga0501249_009141 | Ga0501249_009141_680_1645 | 321 |
| 548 | 3300049679 | Ga0501249_019403 | Ga0501249_019403_365_1330 | 321 |
| 549 | 3300049680 | Ga0501250_004171 | Ga0501250_004171_242_1207 | 321 |
| 550 | 3300049683 | Ga0501253_011320 | Ga0501253_011320_216_1181 | 321 |
| 551 | 3300049686 | Ga0501257_026688 | Ga0501257_026688_68_1033 | 321 |
| 552 | 3300049704 | Ga0501221_002516 | Ga0501221_002516_793_1758 | 321 |
| 553 | 3300049705 | Ga0501225_0000268 | Ga0501225_0000268_15025_15990 | 321 |
| 554 | 3300049705 | Ga0501225_0004226 | Ga0501225_0004226_1704_2669 | 321 |
| 555 | 3300049705 | Ga0501225_0005467 | Ga0501225_0005467_2156_3121 | 321 |
| 556 | 3300049705 | Ga0501225_0006095 | Ga0501225_0006095_2519_3484 | 321 |
| 557 | 3300049707 | Ga0501234_001450 | Ga0501234_001450_594_1559 | 321 |
| 558 | 3300049707 | Ga0501234_005632 | Ga0501234_005632_457_1422 | 321 |
| 559 | 3300049708 | Ga0501245_001321 | Ga0501245_001321_581_1546 | 321 |
| 560 | 3300049708 | Ga0501245_002728 | Ga0501245_002728_857_1822 | 321 |
| 561 | 3300049765 | Ga0501268_003559 | Ga0501268_003559_456_1421 | 321 |
| 562 | 3300049770 | Ga0501273_003459 | Ga0501273_003459_248_1213 | 321 |
| 563 | 3300049779 | Ga0501283_005574 | Ga0501283_005574_458_1423 | 321 |
| 564 | 3300049853 | Ga0501226_000293 | Ga0501226_000293_3379_4344 | 321 |
| 565 | 3300049853 | Ga0501226_005688 | Ga0501226_005688_225_1190 | 321 |
| 566 | 3300050507 | nmdc:mga05p37_164959_c1 | nmdc:mga05p37_164959_c1_350_1315 | 321 |
| 567 | 3300050507 | nmdc:mga05p37_333934_c1 | nmdc:mga05p37_333934_c1_239_1204 | 321 |
| 568 | 3300050507 | nmdc:mga05p37_502271_c1 | nmdc:mga05p37_502271_c1_280_1245 | 321 |
| 569 | 3300050507 | nmdc:mga05p37_77487_c1 | nmdc:mga05p37_77487_c1_1087_2052 | 321 |
| 570 | 3300050507 | nmdc:mga05p37_79525_c1 | nmdc:mga05p37_79525_c1_1319_2284 | 321 |
| 571 | 3300050507 | nmdc:mga05p37_8649_c1 | nmdc:mga05p37_8649_c1_2944_3909 | 321 |
| 572 | 3300050508 | nmdc:mga09592_186542_c1 | nmdc:mga09592_186542_c1_708_1673 | 321 |
| 573 | 3300050509 | nmdc:mga0qj67_147620_c1 | nmdc:mga0qj67_147620_c1_63_1028 | 321 |
| 574 | 3300050510 | nmdc:mga06r32_262372_c1 | nmdc:mga06r32_262372_c1_242_1207 | 321 |
| 575 | 3300050510 | nmdc:mga06r32_93133_c2 | nmdc:mga06r32_93133_c2_540_1505 | 321 |
| 576 | 3300050511 | nmdc:mga08y16_15940_c1 | nmdc:mga08y16_15940_c1_669_1634 | 321 |
| 577 | 3300050511 | nmdc:mga08y16_1742_c1 | nmdc:mga08y16_1742_c1_5153_6118 | 321 |
| 578 | 3300050511 | nmdc:mga08y16_48572_c1 | nmdc:mga08y16_48572_c1_657_1622 | 321 |
| 579 | 3300050512 | nmdc:mga0n895_234759_c1 | nmdc:mga0n895_234759_c1_822_1787 | 321 |
| 580 | 3300050513 | nmdc:mga0rr50_62702_c1 | nmdc:mga0rr50_62702_c1_512_1477 | 321 |
| 581 | 3300050515 | nmdc:mga0a205_158248_c1 | nmdc:mga0a205_158248_c1_1020_1985 | 321 |
| 582 | 3300050515 | nmdc:mga0a205_245170_c1 | nmdc:mga0a205_245170_c1_22_987 | 321 |
| 583 | 3300050515 | nmdc:mga0a205_36293_c1 | nmdc:mga0a205_36293_c1_3368_4333 | 321 |
| 584 | 3300050515 | nmdc:mga0a205_49497_c1 | nmdc:mga0a205_49497_c1_88_1053 | 321 |
| 585 | 3300050515 | nmdc:mga0a205_53651_c1 | nmdc:mga0a205_53651_c1_86_1051 | 321 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3c1q-assembly1.cif.gz_A | the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae | 0.8312 | 147 | 257 |
| 2vma-assembly1.cif.gz_A | the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae | 0.8303 | 147 | 253 |
| 2whn-assembly1.cif.gz_A | n-terminal domain from the pilc type iv pilus biogenesis protein | 0.8271 | 147 | 249 |
| 2vmb-assembly2.cif.gz_B | the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae | 0.8163 | 147 | 253 |
| 5nbg-assembly1.cif.gz_B | structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system | 0.8157 | 147 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P36646_249_359_1.20.81.30 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.8303 | 145 | 246 | 1.20.81.30 |
| 3c1qB00 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.8113 | 147 | 248 | 1.20.81.30 |
| af_P36646_52_165_1.20.81.30 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.8102 | 147 | 255 | 1.20.81.30 |
| af_I6Y479_96_222_1.20.81.30 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.7759 | 154 | 277 | 1.20.81.30 |
| af_I6Y479_96_222_1.20.81.30 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.7537 | 154 | 277 | 1.20.81.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661RPX5-F1-model_v4 | deleted | 0.8434 | 5 | 245 |
|
| AF-A0A661RPX5-F1-model_v4 | deleted | 0.808 | 5 | 245 |
|
| AF-A0A7C3HXL6-F1-model_v4 | Type II secretion system F family protein | 0.7356 | 66 | 321 |
GO:0005886
|
| AF-A0A521U6W8-F1-model_v4 | Secretion system protein | 0.7335 | 61 | 321 |
GO:0005886
|
| AF-A0A7C6LIE8-F1-model_v4 | deleted | 0.7325 | 74 | 321 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar