F466505

General Info

Members Datasets Scaffolds Average Seq Length
585 231 585 319

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_66366_c1|nmdc:mga0a205_66366_c1_539_1504
Length 308
Sequence MLLSFLVFIFALFLVLGAYLAATHSTDSKRKKLQKRLSEALLHSAHTEDIDVILARNELMSEIPALNRLLVRVHTALQLKRMLDQADLHITPSRLIMFSAMASLPLIILGGVVAAMLPFLHVWWKRRQRFNQFLEHLPDALELMSRALSAGHAFSEALHMVAEEMPEPISGEFRKTYEEQNLGLSLKLALENLMERIPLLDLRMCVTAVLIQRETGGNLGEILEKVSYTIRERFRIMGDLKTLTTSSRLSAWLLCGLPIFVAIAVTFMNPDYMAVLWKDPRGHYLIAAALSMQITGMLIVRKILNIKI

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
191 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
192 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
193 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
194 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
198 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
199 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
200 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
201 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
202 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
203 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
204 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
205 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
206 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
207 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
208 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
209 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
210 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
211 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
212 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
213 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
214 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
215 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
218 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
219 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
220 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
221 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
222 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
223 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.03
Rhizosphere 98.8
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000248 3300000532 Bacteria 5117
2 JGI24751J29686_10000016 3300002459 Bacteria 112162
3 JGI24751J29686_10000049 3300002459 Bacteria 69226
4 JGI25406J46586_10001054 3300003203 Bacteria 12938
5 JGI25406J46586_10064679 3300003203 Bacteria 1168
6 rootL2_10161821 3300003322 Bacteria 3726
7 Ga0065704_10004321 3300005289 Bacteria 5595
8 Ga0065704_10089428 3300005289 Bacteria 2846
9 Ga0065712_10003404 3300005290 Bacteria 5240
10 Ga0065712_10011796 3300005290 Bacteria 3591
11 Ga0065715_10001666 3300005293 Bacteria 5800
12 Ga0065715_10018816 3300005293 Bacteria 3373
13 Ga0065715_10024130 3300005293 Bacteria 1581
14 Ga0065715_10089743 3300005293 Bacteria 8643
15 Ga0065715_10095439 3300005293 Bacteria 4080
16 Ga0065715_10098517 3300005293 Bacteria 3536
17 Ga0065715_10147560 3300005293 Bacteria 1761
18 Ga0065707_10001657 3300005295 Bacteria 6678
19 Ga0065707_10091765 3300005295 Bacteria 3882
20 Ga0065707_10164701 3300005295 Bacteria 1527
21 Ga0070676_10017855 3300005328 Bacteria 3928
22 Ga0070676_10109582 3300005328 Bacteria 1718
23 Ga0070690_100002689 3300005330 Bacteria 9586
24 Ga0070690_100012650 3300005330 Bacteria 4968
25 Ga0070690_100014555 3300005330 Bacteria 4669
26 Ga0070690_100041559 3300005330 Bacteria 2911
27 Ga0070670_100001702 3300005331 Bacteria 17907
28 Ga0070670_100002456 3300005331 Bacteria 15283
29 Ga0070670_100054997 3300005331 Bacteria 3416
30 Ga0070670_100103903 3300005331 Bacteria 2447
31 Ga0068869_100005586 3300005334 Bacteria 7914
32 Ga0068869_100104809 3300005334 Bacteria 2144
33 Ga0068869_100221231 3300005334 Bacteria 1501
34 Ga0068869_100440135 3300005334 Bacteria 1079
35 Ga0070666_10018711 3300005335 Bacteria 4459
36 Ga0070680_100020042 3300005336 Bacteria 5302
37 Ga0070682_100000088 3300005337 Bacteria 83442
38 Ga0070682_100020603 3300005337 Bacteria 3883
39 Ga0068868_100021324 3300005338 Bacteria 4879
40 Ga0068868_100022838 3300005338 Bacteria 4728
41 Ga0070660_100019722 3300005339 Bacteria 4945
42 Ga0070689_100000707 3300005340 Bacteria 20291
43 Ga0070689_100038467 3300005340 Bacteria 3660
44 Ga0070689_100210778 3300005340 Bacteria 1590
45 Ga0070689_100325994 3300005340 Unclassified 1284
46 Ga0070687_100013620 3300005343 Bacteria 3629
47 Ga0070692_10007499 3300005345 Unclassified 4806
48 Ga0070692_10050172 3300005345 Bacteria 2166
49 Ga0070668_100023596 3300005347 Bacteria 4654
50 Ga0070669_100005009 3300005353 Bacteria 9569
51 Ga0070669_100005360 3300005353 Bacteria 9253
52 Ga0070669_100050656 3300005353 Bacteria 3034
53 Ga0070669_100159549 3300005353 Bacteria 1751
54 Ga0070675_100048607 3300005354 Bacteria 3479
55 Ga0070675_100081208 3300005354 Bacteria 2703
56 Ga0070671_100252731 3300005355 Bacteria 1497
57 Ga0070673_100001840 3300005364 Bacteria 12678
58 Ga0070673_100041566 3300005364 Bacteria 3537
59 Ga0070673_100392882 3300005364 Bacteria 1239
60 Ga0070688_100180868 3300005365 Bacteria 1462
61 Ga0070659_100004894 3300005366 Bacteria 9573
62 Ga0070701_10028279 3300005438 Bacteria 2755
63 Ga0070701_10066848 3300005438 Bacteria 1911
64 Ga0070701_10099823 3300005438 Bacteria 1606
65 Ga0070701_10132937 3300005438 Bacteria 1415
66 Ga0070705_100012146 3300005440 Bacteria 4369
67 Ga0070705_100084455 3300005440 Bacteria 1959
68 Ga0070700_100000005 3300005441 Bacteria 233160
69 Ga0070700_100005202 3300005441 Bacteria 6877
70 Ga0070700_100056026 3300005441 Bacteria 2470
71 Ga0070700_100057362 3300005441 Bacteria 2444
72 Ga0070700_100129297 3300005441 Bacteria 1702
73 Ga0070700_100237035 3300005441 Bacteria 1302
74 Ga0070694_100033130 3300005444 Bacteria 3397
75 Ga0070694_100067981 3300005444 Bacteria 2447
76 Ga0070694_100072084 3300005444 Bacteria 2382
77 Ga0070694_100083466 3300005444 Bacteria 2227
78 Ga0070694_100093984 3300005444 Bacteria 2109
79 Ga0070694_100094917 3300005444 Bacteria 2099
80 Ga0070694_100112576 3300005444 Bacteria 1941
81 Ga0070694_100116843 3300005444 Bacteria 1908
82 Ga0070694_100121614 3300005444 Bacteria 1874
83 Ga0070694_100153350 3300005444 Bacteria 1684
84 Ga0070694_100161701 3300005444 Bacteria 1643
85 Ga0070708_100000147 3300005445 Bacteria 48675
86 Ga0070708_100085454 3300005445 Bacteria 2863
87 Ga0070708_100196576 3300005445 Bacteria 1887
88 Ga0070678_100205433 3300005456 Bacteria 1628
89 Ga0070662_100240709 3300005457 Unclassified 1451
90 Ga0070681_10003280 3300005458 Bacteria 15110
91 Ga0070681_10017543 3300005458 Bacteria 7154
92 Ga0070681_10144463 3300005458 Bacteria 2309
93 Ga0068867_100017874 3300005459 Bacteria 5037
94 Ga0068867_100045417 3300005459 Bacteria 3222
95 Ga0068867_100183472 3300005459 Bacteria 1665
96 Ga0068867_100325581 3300005459 Bacteria 1274
97 Ga0070685_10006707 3300005466 Bacteria 5876
98 Ga0070706_100000085 3300005467 Bacteria 108868
99 Ga0070706_100001794 3300005467 Bacteria 22223
100 Ga0070706_100034202 3300005467 Bacteria 4693
101 Ga0070707_100009346 3300005468 Bacteria 9100
102 Ga0070707_100023548 3300005468 Bacteria 5823
103 Ga0070707_100125538 3300005468 Bacteria 2493
104 Ga0070698_100011920 3300005471 Bacteria 9224
105 Ga0070698_100051202 3300005471 Bacteria 4207
106 Ga0070699_100002774 3300005518 Bacteria 15628
107 Ga0070699_100005204 3300005518 Bacteria 11434
108 Ga0070699_100130238 3300005518 Bacteria 2218
109 Ga0070699_100202158 3300005518 Bacteria 1767
110 Ga0070699_100266586 3300005518 Bacteria 1532
111 Ga0070697_100000185 3300005536 Bacteria 51425
112 Ga0070697_100000205 3300005536 Bacteria 48600
113 Ga0070697_100001795 3300005536 Bacteria 16382
114 Ga0070697_100060250 3300005536 Bacteria 3093
115 Ga0070697_100168950 3300005536 Unclassified 1850
116 Ga0070697_100169394 3300005536 Bacteria 1848
117 Ga0070697_100330745 3300005536 Unclassified 1313
118 Ga0068853_100034440 3300005539 Bacteria 4298
119 Ga0068853_100046864 3300005539 Bacteria 3708
120 Ga0070672_100031586 3300005543 Bacteria 3987
121 Ga0070672_100100828 3300005543 Bacteria 2342
122 Ga0070672_100257069 3300005543 Bacteria 1472
123 Ga0070686_100004398 3300005544 Bacteria 7772
124 Ga0070686_100006843 3300005544 Bacteria 6348
125 Ga0070686_100026432 3300005544 Bacteria 3504
126 Ga0070695_100006453 3300005545 Bacteria 6937
127 Ga0070695_100021763 3300005545 Bacteria 3928
128 Ga0070695_100342451 3300005545 Bacteria 1118
129 Ga0070695_100379992 3300005545 Bacteria 1066
130 Ga0070696_100026844 3300005546 Bacteria 3919
131 Ga0070696_100039140 3300005546 Unclassified 3274
132 Ga0070696_100078803 3300005546 Unclassified 2330
133 Ga0070696_100228828 3300005546 Bacteria 1398
134 Ga0070693_100001191 3300005547 Bacteria 11706
135 Ga0070693_100039689 3300005547 Bacteria 2639
136 Ga0070693_100044511 3300005547 Bacteria 2512
137 Ga0070693_100101520 3300005547 Bacteria 1753
138 Ga0070693_100140309 3300005547 Bacteria 1520
139 Ga0070704_100187566 3300005549 Bacteria 1659
140 Ga0070704_100301802 3300005549 Unclassified 1334
141 Ga0070664_100001504 3300005564 Bacteria 18579
142 Ga0070664_100226889 3300005564 Bacteria 1673
143 Ga0068857_100001572 3300005577 Bacteria 18294
144 Ga0068854_100137918 3300005578 Bacteria 1869
145 Ga0068854_100177985 3300005578 Bacteria 1659
146 Ga0070702_100007094 3300005615 Bacteria 5346
147 Ga0070702_100023679 3300005615 Bacteria 3266
148 Ga0070702_100141195 3300005615 Bacteria 1534
149 Ga0070702_100144443 3300005615 Bacteria 1519
150 Ga0070702_100149802 3300005615 Bacteria 1496
151 Ga0070702_100324277 3300005615 Bacteria 1074
152 Ga0068852_100061730 3300005616 Unclassified 3258
153 Ga0068859_100043326 3300005617 Bacteria 4523
154 Ga0068859_100052684 3300005617 Bacteria 4092
155 Ga0068859_100060989 3300005617 Bacteria 3800
156 Ga0068859_100091446 3300005617 Bacteria 3093
157 Ga0068859_100173000 3300005617 Bacteria 2241
158 Ga0068859_100371614 3300005617 Bacteria 1525
159 Ga0068859_100479410 3300005617 Bacteria 1339
160 Ga0068859_100530649 3300005617 Bacteria 1272
161 Ga0068864_100002042 3300005618 Bacteria 16667
162 Ga0068864_100008211 3300005618 Bacteria 8610
163 Ga0068864_100009537 3300005618 Bacteria 8011
164 Ga0068864_100034938 3300005618 Bacteria 4278
165 Ga0068864_100036528 3300005618 Bacteria 4188
166 Ga0068864_100091140 3300005618 Bacteria 2688
167 Ga0068864_100153768 3300005618 Bacteria 2086
168 Ga0068864_100467740 3300005618 Unclassified 1208
169 Ga0068864_100474705 3300005618 Bacteria 1199
170 Ga0068866_10027133 3300005718 Bacteria 2712
171 Ga0068866_10167711 3300005718 Bacteria 1286
172 Ga0068861_100010166 3300005719 Bacteria 6529
173 Ga0068861_100109377 3300005719 Bacteria 2212
174 Ga0068861_100289306 3300005719 Bacteria 1414
175 Ga0068870_10005814 3300005840 Bacteria 5409
176 Ga0068870_10017132 3300005840 Bacteria 3476
177 Ga0068863_100011832 3300005841 Bacteria 8433
178 Ga0068863_100016037 3300005841 Bacteria 7185
179 Ga0068858_100022666 3300005842 Bacteria 5857
180 Ga0068858_100050238 3300005842 Bacteria 3859
181 Ga0068860_100013025 3300005843 Bacteria 8166
182 Ga0068860_100019826 3300005843 Bacteria 6520
183 Ga0068860_100025210 3300005843 Bacteria 5739
184 Ga0068860_100056529 3300005843 Bacteria 3730
185 Ga0068860_100087181 3300005843 Bacteria 2972
186 Ga0068860_100092550 3300005843 Bacteria 2881
187 Ga0068860_100093489 3300005843 Bacteria 2866
188 Ga0068860_100185370 3300005843 Bacteria 2012
189 Ga0068862_100006429 3300005844 Bacteria 9767
190 Ga0068862_100006458 3300005844 Bacteria 9743
191 Ga0068862_100033949 3300005844 Bacteria 4316
192 Ga0068862_100135176 3300005844 Bacteria 2185
193 Ga0068862_100365696 3300005844 Unclassified 1341
194 Ga0081539_10000411 3300005985 Bacteria 91279
195 Ga0081539_10000490 3300005985 Bacteria 83577
196 Ga0081539_10001185 3300005985 Bacteria 47102
197 Ga0081539_10032429 3300005985 Bacteria 3199
198 Ga0070715_10000007 3300006163 Bacteria 192075
199 Ga0070716_100000007 3300006173 Bacteria 256300
200 Ga0097621_100001228 3300006237 Bacteria 17759
201 Ga0097621_100007569 3300006237 Bacteria 7780
202 Ga0097621_100034435 3300006237 Bacteria 4041
203 Ga0097621_100193255 3300006237 Bacteria 1763
204 Ga0068871_100006731 3300006358 Bacteria 8160
205 Ga0068871_100021738 3300006358 Bacteria 4937
206 Ga0068871_100218082 3300006358 Unclassified 1652
207 Ga0075428_100223566 3300006844 Bacteria 2033
208 Ga0075428_100284002 3300006844 Bacteria 1781
209 Ga0075430_100021293 3300006846 Bacteria 5512
210 Ga0075431_100034700 3300006847 Bacteria 5196
211 Ga0075431_100112941 3300006847 Unclassified 2804
212 Ga0075431_100174762 3300006847 Bacteria 2206
213 Ga0075433_10031617 3300006852 Unclassified 4525
214 Ga0075433_10088105 3300006852 Bacteria 2742
215 Ga0075433_10099466 3300006852 Bacteria 2575
216 Ga0075433_10228344 3300006852 Bacteria 1653
217 Ga0075433_10442810 3300006852 Bacteria 1145
218 Ga0075434_100073864 3300006871 Bacteria 3403
219 Ga0075434_100375946 3300006871 Bacteria 1442
220 Ga0075429_100011999 3300006880 Bacteria 7511
221 Ga0075429_100012206 3300006880 Bacteria 7448
222 Ga0068865_100004466 3300006881 Bacteria 8440
223 Ga0068865_100191763 3300006881 Bacteria 1581
224 Ga0097620_100043326 3300006931 Bacteria 4523
225 Ga0097620_100052683 3300006931 Bacteria 4092
226 Ga0097620_100060987 3300006931 Bacteria 3800
227 Ga0097620_100091451 3300006931 Bacteria 3093
228 Ga0097620_100172973 3300006931 Bacteria 2241
229 Ga0097620_100371616 3300006931 Bacteria 1525
230 Ga0097620_100479417 3300006931 Bacteria 1339
231 Ga0097620_100530648 3300006931 Bacteria 1272
232 Ga0075435_100014989 3300007076 Bacteria 5815
233 Ga0105251_10016329 3300009011 Bacteria 4016
234 Ga0105240_10098836 3300009093 Bacteria 3553
235 Ga0105240_10668362 3300009093 Bacteria 1137
236 Ga0111539_10000363 3300009094 Bacteria 55793
237 Ga0111539_10006962 3300009094 Bacteria 14511
238 Ga0111539_10008997 3300009094 Bacteria 12641
239 Ga0111539_10205855 3300009094 Bacteria 2293
240 Ga0105245_10008570 3300009098 Bacteria 8916
241 Ga0105247_10008133 3300009101 Bacteria 6407
242 Ga0105247_10053247 3300009101 Bacteria 2496
243 Ga0114129_10001544 3300009147 Bacteria 31206
244 Ga0114129_10003008 3300009147 Bacteria 23621
245 Ga0114129_10004096 3300009147 Bacteria 20597
246 Ga0114129_10015160 3300009147 Bacteria 10972
247 Ga0114129_10144085 3300009147 Bacteria 3264
248 Ga0114129_10188611 3300009147 Bacteria 2801
249 Ga0114129_10428059 3300009147 Unclassified 1739
250 Ga0114129_10694139 3300009147 Unclassified 1309
251 Ga0105243_10009315 3300009148 Bacteria 7489
252 Ga0105243_10010825 3300009148 Bacteria 6902
253 Ga0105243_10119963 3300009148 Bacteria 2215
254 Ga0105243_10260737 3300009148 Bacteria 1552
255 Ga0105243_10428811 3300009148 Bacteria 1235
256 Ga0105242_10003340 3300009176 Bacteria 12478
257 Ga0105242_10026574 3300009176 Bacteria 4588
258 Ga0105242_10074172 3300009176 Bacteria 2831
259 Ga0105242_10356144 3300009176 Bacteria 1353
260 Ga0105248_10001196 3300009177 Bacteria 28995
261 Ga0105248_10003773 3300009177 Bacteria 16780
262 Ga0105248_10025249 3300009177 Bacteria 6607
263 Ga0105248_10032844 3300009177 Bacteria 5798
264 Ga0105248_10032881 3300009177 Bacteria 5794
265 Ga0105248_10071540 3300009177 Bacteria 3896
266 Ga0105248_10099001 3300009177 Bacteria 3285
267 Ga0105248_10103172 3300009177 Bacteria 3214
268 Ga0105248_10254774 3300009177 Bacteria 1975
269 Ga0105248_10321027 3300009177 Bacteria 1744
270 Ga0105248_10481718 3300009177 Bacteria 1398
271 Ga0105237_10005294 3300009545 Bacteria 14589
272 Ga0105237_10064277 3300009545 Bacteria 3666
273 Ga0105238_10010842 3300009551 Bacteria 9160
274 Ga0105238_10011684 3300009551 Bacteria 8851
275 Ga0105249_10001430 3300009553 Bacteria 20929
276 Ga0105249_10022032 3300009553 Bacteria 5706
277 Ga0105249_10064048 3300009553 Bacteria 3379
278 Ga0105249_10114402 3300009553 Bacteria 2554
279 Ga0105239_10037778 3300010375 Bacteria 5292
280 Ga0105239_10156440 3300010375 Bacteria 2545
281 Ga0105239_10203733 3300010375 Bacteria 2217
282 Ga0105239_10355723 3300010375 Bacteria 1653
283 Ga0105246_10077071 3300011119 Bacteria 2364
284 Ga0105246_10103450 3300011119 Bacteria 2078
285 Ga0157373_10001751 3300013100 Bacteria 16508
286 Ga0157373_10028075 3300013100 Bacteria 4060
287 Ga0157373_10045450 3300013100 Bacteria 3134
288 Ga0157373_10115994 3300013100 Bacteria 1882
289 Ga0157371_10174476 3300013102 Bacteria 1537
290 Ga0157371_10383186 3300013102 Bacteria 1027
291 Ga0157374_10043294 3300013296 Bacteria 4158
292 Ga0157374_10199208 3300013296 Bacteria 1960
293 Ga0157374_10261026 3300013296 Bacteria 1706
294 Ga0157378_10003037 3300013297 Bacteria 14919
295 Ga0157378_10009043 3300013297 Bacteria 8669
296 Ga0157378_10016656 3300013297 Bacteria 6440
297 Ga0157378_10060659 3300013297 Bacteria 3375
298 Ga0157378_10187686 3300013297 Bacteria 1948
299 Ga0157378_10262665 3300013297 Unclassified 1657
300 Ga0163162_10000027 3300013306 Bacteria 178451
301 Ga0163162_10004493 3300013306 Bacteria 13436
302 Ga0163162_10128762 3300013306 Bacteria 2639
303 Ga0163162_10145808 3300013306 Bacteria 2483
304 Ga0163162_10176362 3300013306 Bacteria 2263
305 Ga0163162_10202066 3300013306 Bacteria 2116
306 Ga0157372_10083424 3300013307 Bacteria 3620
307 Ga0157375_10007521 3300013308 Bacteria 9525
308 Ga0157375_10112999 3300013308 Bacteria 2817
309 Ga0157375_10292801 3300013308 Bacteria 1791
310 Ga0157375_10323268 3300013308 Bacteria 1707
311 Ga0163163_10000527 3300014325 Bacteria 34143
312 Ga0163163_10001737 3300014325 Bacteria 18359
313 Ga0163163_10002364 3300014325 Bacteria 15966
314 Ga0163163_10016201 3300014325 Bacteria 6919
315 Ga0163163_10018843 3300014325 Bacteria 6473
316 Ga0163163_10029732 3300014325 Bacteria 5258
317 Ga0163163_10039964 3300014325 Bacteria 4580
318 Ga0163163_10183694 3300014325 Bacteria 2139
319 Ga0163163_10202816 3300014325 Bacteria 2032
320 Ga0163163_10267191 3300014325 Bacteria 1762
321 Ga0157380_10000265 3300014326 Bacteria 31432
322 Ga0157380_10008907 3300014326 Bacteria 7169
323 Ga0157380_10010984 3300014326 Bacteria 6530
324 Ga0157380_10028218 3300014326 Bacteria 4277
325 Ga0157380_10065198 3300014326 Bacteria 2926
326 Ga0157380_10537709 3300014326 Unclassified 1143
327 Ga0157377_10019617 3300014745 Bacteria 3534
328 Ga0157379_10020108 3300014968 Bacteria 5901
329 Ga0157376_10007862 3300014969 Bacteria 7648
330 Ga0163161_10011552 3300017792 Bacteria 6129
331 Ga0207656_10006930 3300025321 Bacteria 4107
332 Ga0207653_10002090 3300025885 Bacteria 6365
333 Ga0207653_10103081 3300025885 Bacteria 1011
334 Ga0207682_10054488 3300025893 Bacteria 1662
335 Ga0207642_10017617 3300025899 Bacteria 2722
336 Ga0207710_10001827 3300025900 Bacteria 10258
337 Ga0207710_10036716 3300025900 Bacteria 2161
338 Ga0207647_10004110 3300025904 Bacteria 10803
339 Ga0207647_10176111 3300025904 Unclassified 1244
340 Ga0207685_10000007 3300025905 Bacteria 278341
341 Ga0207645_10196822 3300025907 Bacteria 1325
342 Ga0207643_10001120 3300025908 Bacteria 15928
343 Ga0207643_10003371 3300025908 Bacteria 8609
344 Ga0207643_10053765 3300025908 Bacteria 2288
345 Ga0207684_10000091 3300025910 Bacteria 170468
346 Ga0207684_10053189 3300025910 Bacteria 3437
347 Ga0207654_10121937 3300025911 Bacteria 1638
348 Ga0207654_10156045 3300025911 Bacteria 1470
349 Ga0207707_10016207 3300025912 Bacteria 6502
350 Ga0207707_10142137 3300025912 Bacteria 2098
351 Ga0207695_10215343 3300025913 Bacteria 1830
352 Ga0207671_10003947 3300025914 Bacteria 14441
353 Ga0207671_10044532 3300025914 Bacteria 3282
354 Ga0207660_10300096 3300025917 Bacteria 1279
355 Ga0207662_10002588 3300025918 Bacteria 9118
356 Ga0207662_10023969 3300025918 Bacteria 3510
357 Ga0207662_10141441 3300025918 Bacteria 1524
358 Ga0207657_10225236 3300025919 Bacteria 1501
359 Ga0207649_10166500 3300025920 Bacteria 1532
360 Ga0207646_10045056 3300025922 Bacteria 3959
361 Ga0207646_10106083 3300025922 Bacteria 2520
362 Ga0207646_10119012 3300025922 Bacteria 2372
363 Ga0207646_10183041 3300025922 Bacteria 1892
364 Ga0207681_10002711 3300025923 Bacteria 11217
365 Ga0207681_10017953 3300025923 Bacteria 4449
366 Ga0207694_10002853 3300025924 Bacteria 13936
367 Ga0207650_10000009 3300025925 Bacteria 483583
368 Ga0207650_10011336 3300025925 Bacteria 6134
369 Ga0207644_10076086 3300025931 Bacteria 2468
370 Ga0207644_10113680 3300025931 Bacteria 2050
371 Ga0207690_10068558 3300025932 Bacteria 2438
372 Ga0207706_10174379 3300025933 Unclassified 1889
373 Ga0207686_10044518 3300025934 Bacteria 2726
374 Ga0207686_10073747 3300025934 Bacteria 2203
375 Ga0207709_10006238 3300025935 Bacteria 6702
376 Ga0207670_10106355 3300025936 Bacteria 2013
377 Ga0207670_10191771 3300025936 Bacteria 1547
378 Ga0207669_10019044 3300025937 Bacteria 3565
379 Ga0207704_10018306 3300025938 Bacteria 3654
380 Ga0207704_10019506 3300025938 Bacteria 3563
381 Ga0207665_10000018 3300025939 Bacteria 122653
382 Ga0207691_10004885 3300025940 Bacteria 12958
383 Ga0207711_10003601 3300025941 Bacteria 13399
384 Ga0207711_10009207 3300025941 Bacteria 8247
385 Ga0207711_10010789 3300025941 Bacteria 7594
386 Ga0207711_10028743 3300025941 Bacteria 4682
387 Ga0207711_10065475 3300025941 Bacteria 3142
388 Ga0207711_10149360 3300025941 Unclassified 2108
389 Ga0207711_10163341 3300025941 Bacteria 2017
390 Ga0207711_10244043 3300025941 Unclassified 1648
391 Ga0207711_10335852 3300025941 Bacteria 1398
392 Ga0207689_10007562 3300025942 Bacteria 9526
393 Ga0207689_10221895 3300025942 Unclassified 1562
394 Ga0207689_10321621 3300025942 Unclassified 1284
395 Ga0207689_10350420 3300025942 Unclassified 1227
396 Ga0207679_10033023 3300025945 Bacteria 3639
397 Ga0207679_10101656 3300025945 Bacteria 2249
398 Ga0207651_10013356 3300025960 Bacteria 4698
399 Ga0207651_10242871 3300025960 Bacteria 1469
400 Ga0207712_10000956 3300025961 Bacteria 20827
401 Ga0207712_10021155 3300025961 Bacteria 4268
402 Ga0207712_10028853 3300025961 Bacteria 3715
403 Ga0207712_10137827 3300025961 Bacteria 1869
404 Ga0207712_10301028 3300025961 Unclassified 1316
405 Ga0207668_10005104 3300025972 Bacteria 7727
406 Ga0207640_10195609 3300025981 Bacteria 1528
407 Ga0207658_10067932 3300025986 Bacteria 2687
408 Ga0207677_10002787 3300026023 Bacteria 9234
409 Ga0207677_10110438 3300026023 Bacteria 2046
410 Ga0207677_10343191 3300026023 Unclassified 1248
411 Ga0207703_10012873 3300026035 Bacteria 6523
412 Ga0207703_10089479 3300026035 Bacteria 2585
413 Ga0207703_10100985 3300026035 Bacteria 2445
414 Ga0207639_10026488 3300026041 Bacteria 4214
415 Ga0207639_10196403 3300026041 Unclassified 1727
416 Ga0207708_10000017 3300026075 Bacteria 190414
417 Ga0207708_10005588 3300026075 Bacteria 9278
418 Ga0207708_10029375 3300026075 Bacteria 4167
419 Ga0207708_10037248 3300026075 Bacteria 3705
420 Ga0207708_10051465 3300026075 Bacteria 3135
421 Ga0207708_10177105 3300026075 Bacteria 1691
422 Ga0207708_10228851 3300026075 Bacteria 1492
423 Ga0207641_10014008 3300026088 Bacteria 6574
424 Ga0207641_10231920 3300026088 Bacteria 1716
425 Ga0207648_10016645 3300026089 Bacteria 6713
426 Ga0207648_10052280 3300026089 Bacteria 3572
427 Ga0207648_10233716 3300026089 Unclassified 1636
428 Ga0207648_10295211 3300026089 Bacteria 1452
429 Ga0207676_10002795 3300026095 Bacteria 12401
430 Ga0207676_10006630 3300026095 Bacteria 8184
431 Ga0207676_10090961 3300026095 Bacteria 2505
432 Ga0207676_10397344 3300026095 Bacteria 1287
433 Ga0207674_10000036 3300026116 Bacteria 135434
434 Ga0207674_10045652 3300026116 Bacteria 4505
435 Ga0207674_10290065 3300026116 Bacteria 1585
436 Ga0207674_10376578 3300026116 Bacteria 1372
437 Ga0207675_100018298 3300026118 Bacteria 6533
438 Ga0207675_100045611 3300026118 Bacteria 4095
439 Ga0207675_100065736 3300026118 Bacteria 3389
440 Ga0207675_100149601 3300026118 Bacteria 2221
441 Ga0207675_100225835 3300026118 Bacteria 1805
442 Ga0207675_100255169 3300026118 Bacteria 1698
443 Ga0207683_10016580 3300026121 Bacteria 6272
444 Ga0207698_10448353 3300026142 Bacteria 1245
445 Ga0207428_10018672 3300027907 Bacteria 5919
446 Ga0207428_10061655 3300027907 Bacteria 2968
447 Ga0207428_10101316 3300027907 Bacteria 2225
448 Ga0268265_10027908 3300028380 Bacteria 4036
449 Ga0268265_10032498 3300028380 Bacteria 3783
450 Ga0268265_10084487 3300028380 Bacteria 2516
451 Ga0268264_10010099 3300028381 Bacteria 7812
452 Ga0268264_10018398 3300028381 Bacteria 5713
453 Ga0268264_10054779 3300028381 Bacteria 3331
454 Ga0268264_10076365 3300028381 Bacteria 2850
455 Ga0268264_10172986 3300028381 Bacteria 1954
456 Ga0268264_10532530 3300028381 Unclassified 1150
457 Ga0307408_100027790 3300031548 Bacteria 3903
458 Ga0307408_100042092 3300031548 Bacteria 3242
459 Ga0307408_100249985 3300031548 Bacteria 1462
460 Ga0307405_10035381 3300031731 Bacteria 2982
461 Ga0307413_10151562 3300031824 Bacteria 1616
462 Ga0307410_10015545 3300031852 Bacteria 4518
463 Ga0307410_10234763 3300031852 Bacteria 1418
464 Ga0307406_10105178 3300031901 Bacteria 1931
465 Ga0307406_10145111 3300031901 Bacteria 1685
466 Ga0307406_10167182 3300031901 Bacteria 1588
467 Ga0307406_10287327 3300031901 Bacteria 1257
468 Ga0307412_10049850 3300031911 Bacteria 2760
469 Ga0307412_10283353 3300031911 Bacteria 1302
470 Ga0307416_100088195 3300032002 Bacteria 2652
471 Ga0307416_100175897 3300032002 Unclassified 1999
472 Ga0307416_100646917 3300032002 Unclassified 1141
473 Ga0307414_10037026 3300032004 Bacteria 3263
474 Ga0307414_10037189 3300032004 Bacteria 3257
475 Ga0307414_10042283 3300032004 Bacteria 3095
476 Ga0307411_10022267 3300032005 Bacteria 3727
477 Ga0307411_10097921 3300032005 Bacteria 2066
478 Ga0307415_100006760 3300032126 Bacteria 6217
479 Ga0307415_100077588 3300032126 Bacteria 2359
480 Ga0307415_100112662 3300032126 Bacteria 2022
481 Ga0373942_0003433 3300035207 Bacteria 3723
482 Ga0373937_0048963 3300036401 Bacteria 3870
483 Ga0395900_0020609 3300037418 Bacteria 6735
484 Ga0395898_0369869 3300037466 Bacteria 1367
485 Ga0395905_0016489 3300037471 Bacteria 7023
486 Ga0395901_0253897 3300038443 Bacteria 1831
487 Ga0395901_0363805 3300038443 Bacteria 1491
488 Ga0439448_0009894 3300042005 Bacteria 2817
489 Ga0439462_0016216 3300042015 Bacteria 1924
490 Ga0439458_0014659 3300042157 Bacteria 1770
491 Ga0451576_0100039 3300045051 Bacteria 3016
492 Ga0495610_0064448 3300046512 Bacteria 1732
493 Ga0495663_0013055 3300046525 Unclassified 2320
494 Ga0495598_0000421 3300046537 Bacteria 7651
495 Ga0495621_0000030 3300046539 Bacteria 27481
496 Ga0495621_0023954 3300046539 Bacteria 2034
497 Ga0495656_0019823 3300046615 Bacteria 2601
498 Ga0495636_0078464 3300047318 Bacteria 1419
499 Ga0496104_0200832 3300048907 Bacteria 1906
500 Ga0496106_0176718 3300048909 Bacteria 1694
501 Ga0496108_0130880 3300048911 Bacteria 2157
502 Ga0496109_0110988 3300048912 Bacteria 2550
503 Ga0496112_0161796 3300048915 Unclassified 2205
504 Ga0496112_0658103 3300048915 Bacteria 977
505 Ga0501292_006900 3300049515 Bacteria 1628
506 Ga0501296_000317 3300049519 Bacteria 4940
507 Ga0501296_000595 3300049519 Bacteria 3546
508 Ga0501296_002360 3300049519 Bacteria 1969
509 Ga0501297_006335 3300049520 Bacteria 1260
510 Ga0501298_000922 3300049521 Bacteria 4156
511 Ga0501298_001555 3300049521 Bacteria 3388
512 Ga0501298_006669 3300049521 Bacteria 1894
513 Ga0501299_000809 3300049522 Bacteria 3810
514 Ga0501299_010285 3300049522 Bacteria 1560
515 Ga0501038_0006435 3300049574 Bacteria 10871
516 Ga0501076_0199646 3300049592 Bacteria 1633
517 Ga0501076_0423906 3300049592 Bacteria 1095
518 Ga0501198_002543 3300049649 Bacteria 2461
519 Ga0501202_005956 3300049652 Bacteria 2169
520 Ga0501202_006231 3300049652 Unclassified 2130
521 Ga0501216_000441 3300049660 Bacteria 4889
522 Ga0501216_011440 3300049660 Bacteria 1442
523 Ga0501216_011563 3300049660 Bacteria 1436
524 Ga0501217_000754 3300049661 Bacteria 5615
525 Ga0501217_006729 3300049661 Bacteria 2451
526 Ga0501217_064306 3300049661 Bacteria 986
527 Ga0501223_008123 3300049663 Bacteria 2141
528 Ga0501224_011431 3300049664 Bacteria 1306
529 Ga0501230_000349 3300049667 Bacteria 4418
530 Ga0501233_000192 3300049668 Bacteria 9044
531 Ga0501233_002483 3300049668 Bacteria 3256
532 Ga0501233_006880 3300049668 Bacteria 2150
533 Ga0501235_001929 3300049669 Bacteria 4432
534 Ga0501235_002948 3300049669 Bacteria 3665
535 Ga0501235_003278 3300049669 Bacteria 3493
536 Ga0501235_031424 3300049669 Bacteria 1199
537 Ga0501236_009690 3300049670 Bacteria 1247
538 Ga0501238_009752 3300049671 Bacteria 1276
539 Ga0501239_005766 3300049672 Bacteria 1257
540 Ga0501240_017430 3300049673 Bacteria 1045
541 Ga0501243_010844 3300049675 Bacteria 1425
542 Ga0501249_009141 3300049679 Bacteria 2060
543 Ga0501249_019403 3300049679 Bacteria 1476
544 Ga0501249_049033 3300049679 Unclassified 967
545 Ga0501250_004171 3300049680 Bacteria 1425
546 Ga0501253_011320 3300049683 Bacteria 1367
547 Ga0501257_026688 3300049686 Bacteria 1379
548 Ga0501221_002516 3300049704 Bacteria 3024
549 Ga0501225_0000268 3300049705 Bacteria 16456
550 Ga0501225_0004226 3300049705 Bacteria 4287
551 Ga0501225_0005467 3300049705 Bacteria 3731
552 Ga0501225_0006095 3300049705 Bacteria 3521
553 Ga0501234_001450 3300049707 Bacteria 3725
554 Ga0501234_005632 3300049707 Bacteria 1958
555 Ga0501245_001321 3300049708 Bacteria 3186
556 Ga0501245_002728 3300049708 Bacteria 2369
557 Ga0501268_003559 3300049765 Bacteria 2142
558 Ga0501273_003459 3300049770 Bacteria 1677
559 Ga0501283_005574 3300049779 Bacteria 1737
560 Ga0501212_004637 3300049851 Bacteria 1785
561 Ga0501226_000293 3300049853 Bacteria 7511
562 Ga0501226_005688 3300049853 Bacteria 1417
563 nmdc:mga05p37_164959_c1 3300050507 Bacteria 2704
564 nmdc:mga05p37_333934_c1 3300050507 Unclassified 1789
565 nmdc:mga05p37_502271_c1 3300050507 Unclassified 1391
566 nmdc:mga05p37_77487_c1 3300050507 Bacteria 4092
567 nmdc:mga05p37_79525_c1 3300050507 Bacteria 4037
568 nmdc:mga05p37_8649_c1 3300050507 Bacteria 6322
569 nmdc:mga09592_186542_c1 3300050508 Bacteria 1795
570 nmdc:mga0qj67_147620_c1 3300050509 Bacteria 1907
571 nmdc:mga06r32_262372_c1 3300050510 Bacteria 1715
572 nmdc:mga06r32_93133_c2 3300050510 Bacteria 2291
573 nmdc:mga08y16_15940_c1 3300050511 Bacteria 7900
574 nmdc:mga08y16_1742_c1 3300050511 Bacteria 22070
575 nmdc:mga08y16_48572_c1 3300050511 Bacteria 4441
576 nmdc:mga0n895_234759_c1 3300050512 Bacteria 1861
577 nmdc:mga0n895_59092_c1 3300050512 Bacteria 3783
578 nmdc:mga0rr50_62702_c1 3300050513 Bacteria 2806
579 nmdc:mga0a205_158248_c1 3300050515 Bacteria 2163
580 nmdc:mga0a205_245170_c1 3300050515 Bacteria 1672
581 nmdc:mga0a205_36293_c1 3300050515 Bacteria 4736
582 nmdc:mga0a205_418189_c1 3300050515 Unclassified 1203
583 nmdc:mga0a205_49497_c1 3300050515 Bacteria 4056
584 nmdc:mga0a205_53651_c1 3300050515 Unclassified 3891
585 nmdc:mga0a205_66366_c1 3300050515 Bacteria 3487

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0658103 Ga0496112_0658103_47_835 262
2 3300049661 Ga0501217_064306 Ga0501217_064306_184_972 262
3 3300049679 Ga0501249_049033 Ga0501249_049033_167_955 262
4 3300050515 nmdc:mga0a205_418189_c1 nmdc:mga0a205_418189_c1_405_1193 262
5 3300032126 Ga0307415_100112662 Ga0307415_1001126623 269
6 3300047318 Ga0495636_0078464 Ga0495636_0078464_573_1382 269
7 3300026116 Ga0207674_10376578 Ga0207674_103765782 270
8 3300049673 Ga0501240_017430 Ga0501240_017430_217_1035 272
9 3300005543 Ga0070672_100257069 Ga0070672_1002570692 290
10 3300005617 Ga0068859_100052684 Ga0068859_1000526842 293
11 3300005843 Ga0068860_100087181 Ga0068860_1000871812 293
12 3300006931 Ga0097620_100052683 Ga0097620_1000526832 293
13 3300013306 Ga0163162_10176362 Ga0163162_101763622 293
14 3300025960 Ga0207651_10242871 Ga0207651_102428712 293
15 3300005536 Ga0070697_100330745 Ga0070697_1003307452 296
16 3300005347 Ga0070668_100023596 Ga0070668_1000235964 298
17 3300005985 Ga0081539_10032429 Ga0081539_100324292 298
18 3300009553 Ga0105249_10001430 Ga0105249_1000143015 298
19 3300013306 Ga0163162_10000027 Ga0163162_10000027111 298
20 3300025961 Ga0207712_10000956 Ga0207712_100009566 298
21 3300025972 Ga0207668_10005104 Ga0207668_100051042 298
22 3300009177 Ga0105248_10321027 Ga0105248_103210272 300
23 3300014325 Ga0163163_10029732 Ga0163163_100297325 300
24 3300005536 Ga0070697_100000205 Ga0070697_10000020541 305
25 3300005618 Ga0068864_100467740 Ga0068864_1004677402 305
26 3300026095 Ga0207676_10397344 Ga0207676_103973441 305
27 3300014326 Ga0157380_10028218 Ga0157380_100282182 306
28 3300010375 Ga0105239_10037778 Ga0105239_100377785 307
29 3300013308 Ga0157375_10112999 Ga0157375_101129992 307
30 3300014745 Ga0157377_10019617 Ga0157377_100196173 307
31 3300006852 Ga0075433_10031617 Ga0075433_100316174 308
32 3300050512 nmdc:mga0n895_59092_c1 nmdc:mga0n895_59092_c1_1067_2032 308
33 3300050515 nmdc:mga0a205_66366_c1 nmdc:mga0a205_66366_c1_539_1504 308
34 3300005364 Ga0070673_100392882 Ga0070673_1003928822 309
35 3300025942 Ga0207689_10321621 Ga0207689_103216212 309
36 3300006163 Ga0070715_10000007 Ga0070715_10000007175 310
37 3300006173 Ga0070716_100000007 Ga0070716_100000007140 310
38 3300025905 Ga0207685_10000007 Ga0207685_1000000791 310
39 3300025922 Ga0207646_10106083 Ga0207646_101060832 310
40 3300025939 Ga0207665_10000018 Ga0207665_1000001822 310
41 3300009177 Ga0105248_10032881 Ga0105248_100328814 311
42 3300013306 Ga0163162_10004493 Ga0163162_1000449314 311
43 3300025941 Ga0207711_10149360 Ga0207711_101493602 311
44 3300031548 Ga0307408_100249985 Ga0307408_1002499852 311
45 3300005330 Ga0070690_100012650 Ga0070690_1000126505 313
46 3300005438 Ga0070701_10099823 Ga0070701_100998232 313
47 3300005441 Ga0070700_100129297 Ga0070700_1001292972 313
48 3300005444 Ga0070694_100094917 Ga0070694_1000949172 313
49 3300005544 Ga0070686_100026432 Ga0070686_1000264322 313
50 3300005546 Ga0070696_100078803 Ga0070696_1000788033 313
51 3300005615 Ga0070702_100141195 Ga0070702_1001411952 313
52 3300005844 Ga0068862_100006458 Ga0068862_1000064583 313
53 3300009098 Ga0105245_10008570 Ga0105245_100085705 313
54 3300009148 Ga0105243_10009315 Ga0105243_100093156 313
55 3300009176 Ga0105242_10003340 Ga0105242_100033403 313
56 3300009177 Ga0105248_10099001 Ga0105248_100990013 313
57 3300013102 Ga0157371_10383186 Ga0157371_103831861 313
58 3300013296 Ga0157374_10261026 Ga0157374_102610261 313
59 3300013297 Ga0157378_10009043 Ga0157378_100090437 313
60 3300013297 Ga0157378_10060659 Ga0157378_100606593 313
61 3300013306 Ga0163162_10202066 Ga0163162_102020662 313
62 3300014326 Ga0157380_10065198 Ga0157380_100651982 313
63 3300014969 Ga0157376_10007862 Ga0157376_100078626 313
64 3300025961 Ga0207712_10301028 Ga0207712_103010282 313
65 3300026075 Ga0207708_10228851 Ga0207708_102288511 313
66 3300028380 Ga0268265_10032498 Ga0268265_100324982 313
67 3300049851 Ga0501212_004637 Ga0501212_004637_822_1763 313
68 3300005337 Ga0070682_100000088 Ga0070682_10000008850 314
69 3300005445 Ga0070708_100000147 Ga0070708_10000014731 315
70 3300005467 Ga0070706_100034202 Ga0070706_1000342025 315
71 3300005468 Ga0070707_100009346 Ga0070707_1000093464 315
72 3300005471 Ga0070698_100011920 Ga0070698_1000119206 315
73 3300005518 Ga0070699_100002774 Ga0070699_10000277412 315
74 3300005536 Ga0070697_100001795 Ga0070697_10000179513 315
75 3300025910 Ga0207684_10053189 Ga0207684_100531891 315
76 3300025922 Ga0207646_10045056 Ga0207646_100450562 315
77 3300025931 Ga0207644_10076086 Ga0207644_100760862 316
78 3300005330 Ga0070690_100014555 Ga0070690_1000145554 320
79 3300005444 Ga0070694_100112576 Ga0070694_1001125762 320
80 3300005445 Ga0070708_100085454 Ga0070708_1000854542 320
81 3300005468 Ga0070707_100125538 Ga0070707_1001255382 320
82 3300005518 Ga0070699_100202158 Ga0070699_1002021582 320
83 3300005546 Ga0070696_100039140 Ga0070696_1000391402 320
84 3300005844 Ga0068862_100365696 Ga0068862_1003656961 320
85 3300005985 Ga0081539_10000411 Ga0081539_1000041120 320
86 3300006852 Ga0075433_10228344 Ga0075433_102283441 320
87 3300006852 Ga0075433_10442810 Ga0075433_104428102 320
88 3300009147 Ga0114129_10003008 Ga0114129_1000300813 320
89 3300009553 Ga0105249_10064048 Ga0105249_100640484 320
90 3300013297 Ga0157378_10262665 Ga0157378_102626652 320
91 3300014326 Ga0157380_10010984 Ga0157380_100109845 320
92 3300028380 Ga0268265_10084487 Ga0268265_100844873 320
93 3300037471 Ga0395905_0016489 Ga0395905_0016489_2181_3143 320
94 3300000532 CNAas_1000248 CNAas_10002482 321
95 3300002459 JGI24751J29686_10000016 JGI24751J29686_1000001661 321
96 3300002459 JGI24751J29686_10000049 JGI24751J29686_1000004956 321
97 3300003203 JGI25406J46586_10001054 JGI25406J46586_100010548 321
98 3300003203 JGI25406J46586_10064679 JGI25406J46586_100646791 321
99 3300003322 rootL2_10161821 rootL2_101618214 321
100 3300005289 Ga0065704_10004321 Ga0065704_100043214 321
101 3300005289 Ga0065704_10089428 Ga0065704_100894281 321
102 3300005290 Ga0065712_10003404 Ga0065712_100034045 321
103 3300005290 Ga0065712_10011796 Ga0065712_100117963 321
104 3300005293 Ga0065715_10001666 Ga0065715_100016663 321
105 3300005293 Ga0065715_10018816 Ga0065715_100188162 321
106 3300005293 Ga0065715_10024130 Ga0065715_100241302 321
107 3300005293 Ga0065715_10089743 Ga0065715_100897436 321
108 3300005293 Ga0065715_10095439 Ga0065715_100954393 321
109 3300005293 Ga0065715_10098517 Ga0065715_100985172 321
110 3300005293 Ga0065715_10147560 Ga0065715_101475602 321
111 3300005295 Ga0065707_10001657 Ga0065707_100016574 321
112 3300005295 Ga0065707_10091765 Ga0065707_100917652 321
113 3300005295 Ga0065707_10164701 Ga0065707_101647011 321
114 3300005328 Ga0070676_10017855 Ga0070676_100178553 321
115 3300005328 Ga0070676_10109582 Ga0070676_101095822 321
116 3300005330 Ga0070690_100002689 Ga0070690_1000026896 321
117 3300005330 Ga0070690_100041559 Ga0070690_1000415593 321
118 3300005331 Ga0070670_100001702 Ga0070670_10000170215 321
119 3300005331 Ga0070670_100002456 Ga0070670_1000024568 321
120 3300005331 Ga0070670_100054997 Ga0070670_1000549974 321
121 3300005331 Ga0070670_100103903 Ga0070670_1001039032 321
122 3300005334 Ga0068869_100005586 Ga0068869_1000055866 321
123 3300005334 Ga0068869_100104809 Ga0068869_1001048092 321
124 3300005334 Ga0068869_100221231 Ga0068869_1002212312 321
125 3300005334 Ga0068869_100440135 Ga0068869_1004401351 321
126 3300005335 Ga0070666_10018711 Ga0070666_100187114 321
127 3300005336 Ga0070680_100020042 Ga0070680_1000200425 321
128 3300005337 Ga0070682_100020603 Ga0070682_1000206032 321
129 3300005338 Ga0068868_100021324 Ga0068868_1000213242 321
130 3300005338 Ga0068868_100022838 Ga0068868_1000228383 321
131 3300005339 Ga0070660_100019722 Ga0070660_1000197225 321
132 3300005340 Ga0070689_100000707 Ga0070689_10000070714 321
133 3300005340 Ga0070689_100038467 Ga0070689_1000384672 321
134 3300005340 Ga0070689_100210778 Ga0070689_1002107782 321
135 3300005340 Ga0070689_100325994 Ga0070689_1003259941 321
136 3300005343 Ga0070687_100013620 Ga0070687_1000136203 321
137 3300005345 Ga0070692_10007499 Ga0070692_100074994 321
138 3300005345 Ga0070692_10050172 Ga0070692_100501722 321
139 3300005353 Ga0070669_100005009 Ga0070669_1000050092 321
140 3300005353 Ga0070669_100005360 Ga0070669_1000053603 321
141 3300005353 Ga0070669_100050656 Ga0070669_1000506562 321
142 3300005353 Ga0070669_100159549 Ga0070669_1001595492 321
143 3300005354 Ga0070675_100048607 Ga0070675_1000486071 321
144 3300005354 Ga0070675_100081208 Ga0070675_1000812083 321
145 3300005355 Ga0070671_100252731 Ga0070671_1002527312 321
146 3300005364 Ga0070673_100001840 Ga0070673_10000184012 321
147 3300005364 Ga0070673_100041566 Ga0070673_1000415662 321
148 3300005365 Ga0070688_100180868 Ga0070688_1001808682 321
149 3300005366 Ga0070659_100004894 Ga0070659_1000048945 321
150 3300005438 Ga0070701_10028279 Ga0070701_100282793 321
151 3300005438 Ga0070701_10066848 Ga0070701_100668482 321
152 3300005438 Ga0070701_10132937 Ga0070701_101329371 321
153 3300005440 Ga0070705_100012146 Ga0070705_1000121463 321
154 3300005440 Ga0070705_100084455 Ga0070705_1000844552 321
155 3300005441 Ga0070700_100000005 Ga0070700_10000000577 321
156 3300005441 Ga0070700_100005202 Ga0070700_1000052023 321
157 3300005441 Ga0070700_100056026 Ga0070700_1000560262 321
158 3300005441 Ga0070700_100057362 Ga0070700_1000573622 321
159 3300005441 Ga0070700_100237035 Ga0070700_1002370351 321
160 3300005444 Ga0070694_100033130 Ga0070694_1000331302 321
161 3300005444 Ga0070694_100067981 Ga0070694_1000679812 321
162 3300005444 Ga0070694_100072084 Ga0070694_1000720842 321
163 3300005444 Ga0070694_100083466 Ga0070694_1000834662 321
164 3300005444 Ga0070694_100093984 Ga0070694_1000939842 321
165 3300005444 Ga0070694_100116843 Ga0070694_1001168432 321
166 3300005444 Ga0070694_100121614 Ga0070694_1001216142 321
167 3300005444 Ga0070694_100153350 Ga0070694_1001533502 321
168 3300005444 Ga0070694_100161701 Ga0070694_1001617012 321
169 3300005445 Ga0070708_100196576 Ga0070708_1001965762 321
170 3300005456 Ga0070678_100205433 Ga0070678_1002054332 321
171 3300005457 Ga0070662_100240709 Ga0070662_1002407092 321
172 3300005458 Ga0070681_10003280 Ga0070681_100032804 321
173 3300005458 Ga0070681_10017543 Ga0070681_100175432 321
174 3300005458 Ga0070681_10144463 Ga0070681_101444632 321
175 3300005459 Ga0068867_100017874 Ga0068867_1000178744 321
176 3300005459 Ga0068867_100045417 Ga0068867_1000454172 321
177 3300005459 Ga0068867_100183472 Ga0068867_1001834722 321
178 3300005459 Ga0068867_100325581 Ga0068867_1003255812 321
179 3300005466 Ga0070685_10006707 Ga0070685_100067073 321
180 3300005467 Ga0070706_100000085 Ga0070706_10000008551 321
181 3300005467 Ga0070706_100001794 Ga0070706_10000179420 321
182 3300005468 Ga0070707_100023548 Ga0070707_1000235486 321
183 3300005471 Ga0070698_100051202 Ga0070698_1000512024 321
184 3300005518 Ga0070699_100005204 Ga0070699_1000052046 321
185 3300005518 Ga0070699_100130238 Ga0070699_1001302382 321
186 3300005518 Ga0070699_100266586 Ga0070699_1002665861 321
187 3300005536 Ga0070697_100000185 Ga0070697_10000018526 321
188 3300005536 Ga0070697_100060250 Ga0070697_1000602502 321
189 3300005536 Ga0070697_100168950 Ga0070697_1001689502 321
190 3300005536 Ga0070697_100169394 Ga0070697_1001693942 321
191 3300005539 Ga0068853_100034440 Ga0068853_1000344403 321
192 3300005539 Ga0068853_100046864 Ga0068853_1000468642 321
193 3300005543 Ga0070672_100031586 Ga0070672_1000315863 321
194 3300005543 Ga0070672_100100828 Ga0070672_1001008282 321
195 3300005544 Ga0070686_100004398 Ga0070686_1000043983 321
196 3300005544 Ga0070686_100006843 Ga0070686_1000068432 321
197 3300005545 Ga0070695_100006453 Ga0070695_1000064533 321
198 3300005545 Ga0070695_100021763 Ga0070695_1000217634 321
199 3300005545 Ga0070695_100342451 Ga0070695_1003424511 321
200 3300005545 Ga0070695_100379992 Ga0070695_1003799921 321
201 3300005546 Ga0070696_100026844 Ga0070696_1000268442 321
202 3300005546 Ga0070696_100228828 Ga0070696_1002288282 321
203 3300005547 Ga0070693_100001191 Ga0070693_1000011912 321
204 3300005547 Ga0070693_100039689 Ga0070693_1000396892 321
205 3300005547 Ga0070693_100044511 Ga0070693_1000445113 321
206 3300005547 Ga0070693_100101520 Ga0070693_1001015202 321
207 3300005547 Ga0070693_100140309 Ga0070693_1001403091 321
208 3300005549 Ga0070704_100187566 Ga0070704_1001875662 321
209 3300005549 Ga0070704_100301802 Ga0070704_1003018022 321
210 3300005564 Ga0070664_100001504 Ga0070664_1000015048 321
211 3300005564 Ga0070664_100226889 Ga0070664_1002268891 321
212 3300005577 Ga0068857_100001572 Ga0068857_1000015722 321
213 3300005578 Ga0068854_100137918 Ga0068854_1001379182 321
214 3300005578 Ga0068854_100177985 Ga0068854_1001779852 321
215 3300005615 Ga0070702_100007094 Ga0070702_1000070945 321
216 3300005615 Ga0070702_100023679 Ga0070702_1000236792 321
217 3300005615 Ga0070702_100144443 Ga0070702_1001444432 321
218 3300005615 Ga0070702_100149802 Ga0070702_1001498021 321
219 3300005615 Ga0070702_100324277 Ga0070702_1003242771 321
220 3300005616 Ga0068852_100061730 Ga0068852_1000617303 321
221 3300005617 Ga0068859_100043326 Ga0068859_1000433262 321
222 3300005617 Ga0068859_100060989 Ga0068859_1000609893 321
223 3300005617 Ga0068859_100091446 Ga0068859_1000914462 321
224 3300005617 Ga0068859_100173000 Ga0068859_1001730002 321
225 3300005617 Ga0068859_100371614 Ga0068859_1003716142 321
226 3300005617 Ga0068859_100479410 Ga0068859_1004794102 321
227 3300005617 Ga0068859_100530649 Ga0068859_1005306491 321
228 3300005618 Ga0068864_100002042 Ga0068864_1000020427 321
229 3300005618 Ga0068864_100008211 Ga0068864_1000082112 321
230 3300005618 Ga0068864_100009537 Ga0068864_1000095377 321
231 3300005618 Ga0068864_100034938 Ga0068864_1000349382 321
232 3300005618 Ga0068864_100036528 Ga0068864_1000365282 321
233 3300005618 Ga0068864_100091140 Ga0068864_1000911403 321
234 3300005618 Ga0068864_100153768 Ga0068864_1001537681 321
235 3300005618 Ga0068864_100474705 Ga0068864_1004747052 321
236 3300005718 Ga0068866_10027133 Ga0068866_100271332 321
237 3300005718 Ga0068866_10167711 Ga0068866_101677111 321
238 3300005719 Ga0068861_100010166 Ga0068861_1000101663 321
239 3300005719 Ga0068861_100109377 Ga0068861_1001093772 321
240 3300005719 Ga0068861_100289306 Ga0068861_1002893062 321
241 3300005840 Ga0068870_10005814 Ga0068870_100058145 321
242 3300005840 Ga0068870_10017132 Ga0068870_100171324 321
243 3300005841 Ga0068863_100011832 Ga0068863_1000118328 321
244 3300005841 Ga0068863_100016037 Ga0068863_1000160375 321
245 3300005842 Ga0068858_100022666 Ga0068858_1000226663 321
246 3300005842 Ga0068858_100050238 Ga0068858_1000502382 321
247 3300005843 Ga0068860_100013025 Ga0068860_1000130257 321
248 3300005843 Ga0068860_100019826 Ga0068860_1000198264 321
249 3300005843 Ga0068860_100025210 Ga0068860_1000252104 321
250 3300005843 Ga0068860_100056529 Ga0068860_1000565293 321
251 3300005843 Ga0068860_100092550 Ga0068860_1000925502 321
252 3300005843 Ga0068860_100093489 Ga0068860_1000934891 321
253 3300005843 Ga0068860_100185370 Ga0068860_1001853702 321
254 3300005844 Ga0068862_100006429 Ga0068862_1000064293 321
255 3300005844 Ga0068862_100033949 Ga0068862_1000339494 321
256 3300005844 Ga0068862_100135176 Ga0068862_1001351762 321
257 3300005985 Ga0081539_10000490 Ga0081539_1000049021 321
258 3300005985 Ga0081539_10001185 Ga0081539_1000118526 321
259 3300006237 Ga0097621_100001228 Ga0097621_10000122812 321
260 3300006237 Ga0097621_100007569 Ga0097621_1000075693 321
261 3300006237 Ga0097621_100034435 Ga0097621_1000344352 321
262 3300006237 Ga0097621_100193255 Ga0097621_1001932552 321
263 3300006358 Ga0068871_100006731 Ga0068871_1000067316 321
264 3300006358 Ga0068871_100021738 Ga0068871_1000217385 321
265 3300006358 Ga0068871_100218082 Ga0068871_1002180822 321
266 3300006844 Ga0075428_100223566 Ga0075428_1002235662 321
267 3300006844 Ga0075428_100284002 Ga0075428_1002840022 321
268 3300006846 Ga0075430_100021293 Ga0075430_1000212933 321
269 3300006847 Ga0075431_100034700 Ga0075431_1000347003 321
270 3300006847 Ga0075431_100112941 Ga0075431_1001129412 321
271 3300006847 Ga0075431_100174762 Ga0075431_1001747622 321
272 3300006852 Ga0075433_10088105 Ga0075433_100881052 321
273 3300006852 Ga0075433_10099466 Ga0075433_100994663 321
274 3300006871 Ga0075434_100073864 Ga0075434_1000738642 321
275 3300006871 Ga0075434_100375946 Ga0075434_1003759462 321
276 3300006880 Ga0075429_100011999 Ga0075429_1000119994 321
277 3300006880 Ga0075429_100012206 Ga0075429_1000122065 321
278 3300006881 Ga0068865_100004466 Ga0068865_1000044666 321
279 3300006881 Ga0068865_100191763 Ga0068865_1001917631 321
280 3300006931 Ga0097620_100043326 Ga0097620_1000433262 321
281 3300006931 Ga0097620_100060987 Ga0097620_1000609873 321
282 3300006931 Ga0097620_100091451 Ga0097620_1000914512 321
283 3300006931 Ga0097620_100172973 Ga0097620_1001729732 321
284 3300006931 Ga0097620_100371616 Ga0097620_1003716161 321
285 3300006931 Ga0097620_100479417 Ga0097620_1004794172 321
286 3300006931 Ga0097620_100530648 Ga0097620_1005306481 321
287 3300007076 Ga0075435_100014989 Ga0075435_1000149892 321
288 3300009011 Ga0105251_10016329 Ga0105251_100163293 321
289 3300009093 Ga0105240_10098836 Ga0105240_100988362 321
290 3300009093 Ga0105240_10668362 Ga0105240_106683622 321
291 3300009094 Ga0111539_10000363 Ga0111539_1000036331 321
292 3300009094 Ga0111539_10006962 Ga0111539_1000696212 321
293 3300009094 Ga0111539_10008997 Ga0111539_100089979 321
294 3300009094 Ga0111539_10205855 Ga0111539_102058551 321
295 3300009101 Ga0105247_10008133 Ga0105247_100081337 321
296 3300009101 Ga0105247_10053247 Ga0105247_100532472 321
297 3300009147 Ga0114129_10001544 Ga0114129_1000154422 321
298 3300009147 Ga0114129_10004096 Ga0114129_100040967 321
299 3300009147 Ga0114129_10015160 Ga0114129_100151607 321
300 3300009147 Ga0114129_10144085 Ga0114129_101440853 321
301 3300009147 Ga0114129_10188611 Ga0114129_101886112 321
302 3300009147 Ga0114129_10428059 Ga0114129_104280592 321
303 3300009147 Ga0114129_10694139 Ga0114129_106941391 321
304 3300009148 Ga0105243_10010825 Ga0105243_100108252 321
305 3300009148 Ga0105243_10119963 Ga0105243_101199632 321
306 3300009148 Ga0105243_10260737 Ga0105243_102607372 321
307 3300009148 Ga0105243_10428811 Ga0105243_104288111 321
308 3300009176 Ga0105242_10026574 Ga0105242_100265743 321
309 3300009176 Ga0105242_10074172 Ga0105242_100741721 321
310 3300009176 Ga0105242_10356144 Ga0105242_103561441 321
311 3300009177 Ga0105248_10001196 Ga0105248_1000119614 321
312 3300009177 Ga0105248_10003773 Ga0105248_100037734 321
313 3300009177 Ga0105248_10025249 Ga0105248_100252492 321
314 3300009177 Ga0105248_10032844 Ga0105248_100328445 321
315 3300009177 Ga0105248_10071540 Ga0105248_100715404 321
316 3300009177 Ga0105248_10103172 Ga0105248_101031723 321
317 3300009177 Ga0105248_10254774 Ga0105248_102547742 321
318 3300009177 Ga0105248_10481718 Ga0105248_104817182 321
319 3300009545 Ga0105237_10005294 Ga0105237_100052942 321
320 3300009545 Ga0105237_10064277 Ga0105237_100642774 321
321 3300009551 Ga0105238_10010842 Ga0105238_100108422 321
322 3300009551 Ga0105238_10011684 Ga0105238_100116842 321
323 3300009553 Ga0105249_10022032 Ga0105249_100220324 321
324 3300009553 Ga0105249_10114402 Ga0105249_101144021 321
325 3300010375 Ga0105239_10156440 Ga0105239_101564402 321
326 3300010375 Ga0105239_10203733 Ga0105239_102037332 321
327 3300010375 Ga0105239_10355723 Ga0105239_103557232 321
328 3300011119 Ga0105246_10077071 Ga0105246_100770712 321
329 3300011119 Ga0105246_10103450 Ga0105246_101034502 321
330 3300013100 Ga0157373_10001751 Ga0157373_100017513 321
331 3300013100 Ga0157373_10028075 Ga0157373_100280753 321
332 3300013100 Ga0157373_10045450 Ga0157373_100454503 321
333 3300013100 Ga0157373_10115994 Ga0157373_101159942 321
334 3300013102 Ga0157371_10174476 Ga0157371_101744762 321
335 3300013296 Ga0157374_10043294 Ga0157374_100432944 321
336 3300013296 Ga0157374_10199208 Ga0157374_101992082 321
337 3300013297 Ga0157378_10003037 Ga0157378_100030378 321
338 3300013297 Ga0157378_10016656 Ga0157378_100166566 321
339 3300013297 Ga0157378_10187686 Ga0157378_101876862 321
340 3300013306 Ga0163162_10128762 Ga0163162_101287622 321
341 3300013306 Ga0163162_10145808 Ga0163162_101458083 321
342 3300013307 Ga0157372_10083424 Ga0157372_100834242 321
343 3300013308 Ga0157375_10007521 Ga0157375_100075212 321
344 3300013308 Ga0157375_10292801 Ga0157375_102928012 321
345 3300013308 Ga0157375_10323268 Ga0157375_103232682 321
346 3300014325 Ga0163163_10000527 Ga0163163_1000052712 321
347 3300014325 Ga0163163_10001737 Ga0163163_100017376 321
348 3300014325 Ga0163163_10002364 Ga0163163_100023648 321
349 3300014325 Ga0163163_10016201 Ga0163163_100162016 321
350 3300014325 Ga0163163_10018843 Ga0163163_100188432 321
351 3300014325 Ga0163163_10039964 Ga0163163_100399641 321
352 3300014325 Ga0163163_10183694 Ga0163163_101836942 321
353 3300014325 Ga0163163_10202816 Ga0163163_102028162 321
354 3300014325 Ga0163163_10267191 Ga0163163_102671912 321
355 3300014326 Ga0157380_10000265 Ga0157380_1000026524 321
356 3300014326 Ga0157380_10008907 Ga0157380_100089076 321
357 3300014326 Ga0157380_10537709 Ga0157380_105377092 321
358 3300014968 Ga0157379_10020108 Ga0157379_100201082 321
359 3300017792 Ga0163161_10011552 Ga0163161_100115522 321
360 3300025321 Ga0207656_10006930 Ga0207656_100069302 321
361 3300025885 Ga0207653_10002090 Ga0207653_100020903 321
362 3300025885 Ga0207653_10103081 Ga0207653_101030811 321
363 3300025893 Ga0207682_10054488 Ga0207682_100544882 321
364 3300025899 Ga0207642_10017617 Ga0207642_100176172 321
365 3300025900 Ga0207710_10001827 Ga0207710_100018279 321
366 3300025900 Ga0207710_10036716 Ga0207710_100367162 321
367 3300025904 Ga0207647_10004110 Ga0207647_100041106 321
368 3300025904 Ga0207647_10176111 Ga0207647_101761111 321
369 3300025907 Ga0207645_10196822 Ga0207645_101968222 321
370 3300025908 Ga0207643_10001120 Ga0207643_100011203 321
371 3300025908 Ga0207643_10003371 Ga0207643_100033712 321
372 3300025908 Ga0207643_10053765 Ga0207643_100537653 321
373 3300025910 Ga0207684_10000091 Ga0207684_1000009161 321
374 3300025911 Ga0207654_10121937 Ga0207654_101219372 321
375 3300025911 Ga0207654_10156045 Ga0207654_101560452 321
376 3300025912 Ga0207707_10016207 Ga0207707_100162072 321
377 3300025912 Ga0207707_10142137 Ga0207707_101421372 321
378 3300025913 Ga0207695_10215343 Ga0207695_102153432 321
379 3300025914 Ga0207671_10003947 Ga0207671_1000394714 321
380 3300025914 Ga0207671_10044532 Ga0207671_100445323 321
381 3300025917 Ga0207660_10300096 Ga0207660_103000961 321
382 3300025918 Ga0207662_10002588 Ga0207662_100025883 321
383 3300025918 Ga0207662_10023969 Ga0207662_100239693 321
384 3300025918 Ga0207662_10141441 Ga0207662_101414412 321
385 3300025919 Ga0207657_10225236 Ga0207657_102252362 321
386 3300025920 Ga0207649_10166500 Ga0207649_101665002 321
387 3300025922 Ga0207646_10119012 Ga0207646_101190122 321
388 3300025922 Ga0207646_10183041 Ga0207646_101830412 321
389 3300025923 Ga0207681_10002711 Ga0207681_100027113 321
390 3300025923 Ga0207681_10017953 Ga0207681_100179534 321
391 3300025924 Ga0207694_10002853 Ga0207694_100028538 321
392 3300025925 Ga0207650_10000009 Ga0207650_1000000981 321
393 3300025925 Ga0207650_10011336 Ga0207650_100113364 321
394 3300025931 Ga0207644_10113680 Ga0207644_101136802 321
395 3300025932 Ga0207690_10068558 Ga0207690_100685582 321
396 3300025933 Ga0207706_10174379 Ga0207706_101743792 321
397 3300025934 Ga0207686_10044518 Ga0207686_100445183 321
398 3300025934 Ga0207686_10073747 Ga0207686_100737472 321
399 3300025935 Ga0207709_10006238 Ga0207709_100062382 321
400 3300025936 Ga0207670_10106355 Ga0207670_101063552 321
401 3300025936 Ga0207670_10191771 Ga0207670_101917712 321
402 3300025937 Ga0207669_10019044 Ga0207669_100190442 321
403 3300025938 Ga0207704_10018306 Ga0207704_100183063 321
404 3300025938 Ga0207704_10019506 Ga0207704_100195063 321
405 3300025940 Ga0207691_10004885 Ga0207691_100048859 321
406 3300025941 Ga0207711_10003601 Ga0207711_100036017 321
407 3300025941 Ga0207711_10009207 Ga0207711_100092077 321
408 3300025941 Ga0207711_10010789 Ga0207711_100107895 321
409 3300025941 Ga0207711_10028743 Ga0207711_100287434 321
410 3300025941 Ga0207711_10065475 Ga0207711_100654751 321
411 3300025941 Ga0207711_10163341 Ga0207711_101633412 321
412 3300025941 Ga0207711_10244043 Ga0207711_102440432 321
413 3300025941 Ga0207711_10335852 Ga0207711_103358522 321
414 3300025942 Ga0207689_10007562 Ga0207689_100075625 321
415 3300025942 Ga0207689_10221895 Ga0207689_102218951 321
416 3300025942 Ga0207689_10350420 Ga0207689_103504202 321
417 3300025945 Ga0207679_10033023 Ga0207679_100330233 321
418 3300025945 Ga0207679_10101656 Ga0207679_101016562 321
419 3300025960 Ga0207651_10013356 Ga0207651_100133562 321
420 3300025961 Ga0207712_10021155 Ga0207712_100211553 321
421 3300025961 Ga0207712_10028853 Ga0207712_100288533 321
422 3300025961 Ga0207712_10137827 Ga0207712_101378272 321
423 3300025981 Ga0207640_10195609 Ga0207640_101956092 321
424 3300025986 Ga0207658_10067932 Ga0207658_100679322 321
425 3300026023 Ga0207677_10002787 Ga0207677_100027874 321
426 3300026023 Ga0207677_10110438 Ga0207677_101104382 321
427 3300026023 Ga0207677_10343191 Ga0207677_103431911 321
428 3300026035 Ga0207703_10012873 Ga0207703_100128731 321
429 3300026035 Ga0207703_10089479 Ga0207703_100894792 321
430 3300026035 Ga0207703_10100985 Ga0207703_101009852 321
431 3300026041 Ga0207639_10026488 Ga0207639_100264883 321
432 3300026041 Ga0207639_10196403 Ga0207639_101964032 321
433 3300026075 Ga0207708_10000017 Ga0207708_1000001755 321
434 3300026075 Ga0207708_10005588 Ga0207708_100055887 321
435 3300026075 Ga0207708_10029375 Ga0207708_100293754 321
436 3300026075 Ga0207708_10037248 Ga0207708_100372482 321
437 3300026075 Ga0207708_10051465 Ga0207708_100514653 321
438 3300026075 Ga0207708_10177105 Ga0207708_101771052 321
439 3300026088 Ga0207641_10014008 Ga0207641_100140084 321
440 3300026088 Ga0207641_10231920 Ga0207641_102319202 321
441 3300026089 Ga0207648_10016645 Ga0207648_100166456 321
442 3300026089 Ga0207648_10052280 Ga0207648_100522804 321
443 3300026089 Ga0207648_10233716 Ga0207648_102337162 321
444 3300026089 Ga0207648_10295211 Ga0207648_102952112 321
445 3300026095 Ga0207676_10002795 Ga0207676_100027957 321
446 3300026095 Ga0207676_10006630 Ga0207676_100066303 321
447 3300026095 Ga0207676_10090961 Ga0207676_100909613 321
448 3300026116 Ga0207674_10000036 Ga0207674_1000003677 321
449 3300026116 Ga0207674_10045652 Ga0207674_100456523 321
450 3300026116 Ga0207674_10290065 Ga0207674_102900652 321
451 3300026118 Ga0207675_100018298 Ga0207675_1000182986 321
452 3300026118 Ga0207675_100045611 Ga0207675_1000456114 321
453 3300026118 Ga0207675_100065736 Ga0207675_1000657363 321
454 3300026118 Ga0207675_100149601 Ga0207675_1001496012 321
455 3300026118 Ga0207675_100225835 Ga0207675_1002258352 321
456 3300026118 Ga0207675_100255169 Ga0207675_1002551692 321
457 3300026121 Ga0207683_10016580 Ga0207683_100165803 321
458 3300026142 Ga0207698_10448353 Ga0207698_104483532 321
459 3300027907 Ga0207428_10018672 Ga0207428_100186722 321
460 3300027907 Ga0207428_10061655 Ga0207428_100616553 321
461 3300027907 Ga0207428_10101316 Ga0207428_101013162 321
462 3300028380 Ga0268265_10027908 Ga0268265_100279083 321
463 3300028381 Ga0268264_10010099 Ga0268264_100100998 321
464 3300028381 Ga0268264_10018398 Ga0268264_100183982 321
465 3300028381 Ga0268264_10054779 Ga0268264_100547792 321
466 3300028381 Ga0268264_10076365 Ga0268264_100763653 321
467 3300028381 Ga0268264_10172986 Ga0268264_101729862 321
468 3300028381 Ga0268264_10532530 Ga0268264_105325301 321
469 3300031548 Ga0307408_100027790 Ga0307408_1000277903 321
470 3300031548 Ga0307408_100042092 Ga0307408_1000420922 321
471 3300031731 Ga0307405_10035381 Ga0307405_100353812 321
472 3300031824 Ga0307413_10151562 Ga0307413_101515622 321
473 3300031852 Ga0307410_10015545 Ga0307410_100155453 321
474 3300031852 Ga0307410_10234763 Ga0307410_102347631 321
475 3300031901 Ga0307406_10105178 Ga0307406_101051781 321
476 3300031901 Ga0307406_10145111 Ga0307406_101451112 321
477 3300031901 Ga0307406_10167182 Ga0307406_101671822 321
478 3300031901 Ga0307406_10287327 Ga0307406_102873272 321
479 3300031911 Ga0307412_10049850 Ga0307412_100498502 321
480 3300031911 Ga0307412_10283353 Ga0307412_102833532 321
481 3300032002 Ga0307416_100088195 Ga0307416_1000881953 321
482 3300032002 Ga0307416_100175897 Ga0307416_1001758972 321
483 3300032002 Ga0307416_100646917 Ga0307416_1006469172 321
484 3300032004 Ga0307414_10037026 Ga0307414_100370262 321
485 3300032004 Ga0307414_10037189 Ga0307414_100371893 321
486 3300032004 Ga0307414_10042283 Ga0307414_100422832 321
487 3300032005 Ga0307411_10022267 Ga0307411_100222672 321
488 3300032005 Ga0307411_10097921 Ga0307411_100979212 321
489 3300032126 Ga0307415_100006760 Ga0307415_1000067603 321
490 3300032126 Ga0307415_100077588 Ga0307415_1000775882 321
491 3300035207 Ga0373942_0003433 Ga0373942_0003433_2439_3404 321
492 3300036401 Ga0373937_0048963 Ga0373937_0048963_2280_3245 321
493 3300037418 Ga0395900_0020609 Ga0395900_0020609_5017_5982 321
494 3300037466 Ga0395898_0369869 Ga0395898_0369869_186_1151 321
495 3300038443 Ga0395901_0253897 Ga0395901_0253897_638_1603 321
496 3300038443 Ga0395901_0363805 Ga0395901_0363805_91_1056 321
497 3300042005 Ga0439448_0009894 Ga0439448_0009894_1758_2723 321
498 3300042015 Ga0439462_0016216 Ga0439462_0016216_477_1442 321
499 3300042157 Ga0439458_0014659 Ga0439458_0014659_265_1230 321
500 3300045051 Ga0451576_0100039 Ga0451576_0100039_408_1373 321
501 3300046512 Ga0495610_0064448 Ga0495610_0064448_754_1719 321
502 3300046525 Ga0495663_0013055 Ga0495663_0013055_1088_2053 321
503 3300046537 Ga0495598_0000421 Ga0495598_0000421_5723_6688 321
504 3300046539 Ga0495621_0000030 Ga0495621_0000030_20027_20992 321
505 3300046539 Ga0495621_0023954 Ga0495621_0023954_433_1398 321
506 3300046615 Ga0495656_0019823 Ga0495656_0019823_1329_2294 321
507 3300048907 Ga0496104_0200832 Ga0496104_0200832_509_1474 321
508 3300048909 Ga0496106_0176718 Ga0496106_0176718_388_1353 321
509 3300048911 Ga0496108_0130880 Ga0496108_0130880_355_1320 321
510 3300048912 Ga0496109_0110988 Ga0496109_0110988_140_1105 321
511 3300048915 Ga0496112_0161796 Ga0496112_0161796_175_1140 321
512 3300049515 Ga0501292_006900 Ga0501292_006900_402_1367 321
513 3300049519 Ga0501296_000317 Ga0501296_000317_1496_2461 321
514 3300049519 Ga0501296_000595 Ga0501296_000595_83_1048 321
515 3300049519 Ga0501296_002360 Ga0501296_002360_73_1038 321
516 3300049520 Ga0501297_006335 Ga0501297_006335_63_1028 321
517 3300049521 Ga0501298_000922 Ga0501298_000922_743_1708 321
518 3300049521 Ga0501298_001555 Ga0501298_001555_2280_3245 321
519 3300049521 Ga0501298_006669 Ga0501298_006669_200_1165 321
520 3300049522 Ga0501299_000809 Ga0501299_000809_2459_3424 321
521 3300049522 Ga0501299_010285 Ga0501299_010285_548_1513 321
522 3300049574 Ga0501038_0006435 Ga0501038_0006435_4605_5570 321
523 3300049592 Ga0501076_0199646 Ga0501076_0199646_31_996 321
524 3300049592 Ga0501076_0423906 Ga0501076_0423906_89_1054 321
525 3300049649 Ga0501198_002543 Ga0501198_002543_407_1372 321
526 3300049652 Ga0501202_005956 Ga0501202_005956_1040_2005 321
527 3300049652 Ga0501202_006231 Ga0501202_006231_1052_2017 321
528 3300049660 Ga0501216_000441 Ga0501216_000441_1900_2865 321
529 3300049660 Ga0501216_011440 Ga0501216_011440_34_999 321
530 3300049660 Ga0501216_011563 Ga0501216_011563_252_1217 321
531 3300049661 Ga0501217_000754 Ga0501217_000754_4077_5042 321
532 3300049661 Ga0501217_006729 Ga0501217_006729_231_1196 321
533 3300049663 Ga0501223_008123 Ga0501223_008123_709_1674 321
534 3300049664 Ga0501224_011431 Ga0501224_011431_93_1058 321
535 3300049667 Ga0501230_000349 Ga0501230_000349_2052_3017 321
536 3300049668 Ga0501233_000192 Ga0501233_000192_1108_2073 321
537 3300049668 Ga0501233_002483 Ga0501233_002483_1861_2826 321
538 3300049668 Ga0501233_006880 Ga0501233_006880_74_1039 321
539 3300049669 Ga0501235_001929 Ga0501235_001929_762_1727 321
540 3300049669 Ga0501235_002948 Ga0501235_002948_2147_3112 321
541 3300049669 Ga0501235_003278 Ga0501235_003278_2051_3016 321
542 3300049669 Ga0501235_031424 Ga0501235_031424_201_1166 321
543 3300049670 Ga0501236_009690 Ga0501236_009690_176_1141 321
544 3300049671 Ga0501238_009752 Ga0501238_009752_194_1159 321
545 3300049672 Ga0501239_005766 Ga0501239_005766_186_1151 321
546 3300049675 Ga0501243_010844 Ga0501243_010844_410_1375 321
547 3300049679 Ga0501249_009141 Ga0501249_009141_680_1645 321
548 3300049679 Ga0501249_019403 Ga0501249_019403_365_1330 321
549 3300049680 Ga0501250_004171 Ga0501250_004171_242_1207 321
550 3300049683 Ga0501253_011320 Ga0501253_011320_216_1181 321
551 3300049686 Ga0501257_026688 Ga0501257_026688_68_1033 321
552 3300049704 Ga0501221_002516 Ga0501221_002516_793_1758 321
553 3300049705 Ga0501225_0000268 Ga0501225_0000268_15025_15990 321
554 3300049705 Ga0501225_0004226 Ga0501225_0004226_1704_2669 321
555 3300049705 Ga0501225_0005467 Ga0501225_0005467_2156_3121 321
556 3300049705 Ga0501225_0006095 Ga0501225_0006095_2519_3484 321
557 3300049707 Ga0501234_001450 Ga0501234_001450_594_1559 321
558 3300049707 Ga0501234_005632 Ga0501234_005632_457_1422 321
559 3300049708 Ga0501245_001321 Ga0501245_001321_581_1546 321
560 3300049708 Ga0501245_002728 Ga0501245_002728_857_1822 321
561 3300049765 Ga0501268_003559 Ga0501268_003559_456_1421 321
562 3300049770 Ga0501273_003459 Ga0501273_003459_248_1213 321
563 3300049779 Ga0501283_005574 Ga0501283_005574_458_1423 321
564 3300049853 Ga0501226_000293 Ga0501226_000293_3379_4344 321
565 3300049853 Ga0501226_005688 Ga0501226_005688_225_1190 321
566 3300050507 nmdc:mga05p37_164959_c1 nmdc:mga05p37_164959_c1_350_1315 321
567 3300050507 nmdc:mga05p37_333934_c1 nmdc:mga05p37_333934_c1_239_1204 321
568 3300050507 nmdc:mga05p37_502271_c1 nmdc:mga05p37_502271_c1_280_1245 321
569 3300050507 nmdc:mga05p37_77487_c1 nmdc:mga05p37_77487_c1_1087_2052 321
570 3300050507 nmdc:mga05p37_79525_c1 nmdc:mga05p37_79525_c1_1319_2284 321
571 3300050507 nmdc:mga05p37_8649_c1 nmdc:mga05p37_8649_c1_2944_3909 321
572 3300050508 nmdc:mga09592_186542_c1 nmdc:mga09592_186542_c1_708_1673 321
573 3300050509 nmdc:mga0qj67_147620_c1 nmdc:mga0qj67_147620_c1_63_1028 321
574 3300050510 nmdc:mga06r32_262372_c1 nmdc:mga06r32_262372_c1_242_1207 321
575 3300050510 nmdc:mga06r32_93133_c2 nmdc:mga06r32_93133_c2_540_1505 321
576 3300050511 nmdc:mga08y16_15940_c1 nmdc:mga08y16_15940_c1_669_1634 321
577 3300050511 nmdc:mga08y16_1742_c1 nmdc:mga08y16_1742_c1_5153_6118 321
578 3300050511 nmdc:mga08y16_48572_c1 nmdc:mga08y16_48572_c1_657_1622 321
579 3300050512 nmdc:mga0n895_234759_c1 nmdc:mga0n895_234759_c1_822_1787 321
580 3300050513 nmdc:mga0rr50_62702_c1 nmdc:mga0rr50_62702_c1_512_1477 321
581 3300050515 nmdc:mga0a205_158248_c1 nmdc:mga0a205_158248_c1_1020_1985 321
582 3300050515 nmdc:mga0a205_245170_c1 nmdc:mga0a205_245170_c1_22_987 321
583 3300050515 nmdc:mga0a205_36293_c1 nmdc:mga0a205_36293_c1_3368_4333 321
584 3300050515 nmdc:mga0a205_49497_c1 nmdc:mga0a205_49497_c1_88_1053 321
585 3300050515 nmdc:mga0a205_53651_c1 nmdc:mga0a205_53651_c1_86_1051 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

140

267

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8312 147 257
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8303 147 253
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.8271 147 249
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8163 147 253
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.8157 147 255
ID Description Score Start End Superfamily
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8303 145 246 1.20.81.30
3c1qB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8113 147 248 1.20.81.30
af_P36646_52_165_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8102 147 255 1.20.81.30
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7759 154 277 1.20.81.30
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7537 154 277 1.20.81.30
ID Description Score Start End GO Terms
AF-A0A661RPX5-F1-model_v4 deleted 0.8434 5 245
AF-A0A661RPX5-F1-model_v4 deleted 0.808 5 245
AF-A0A7C3HXL6-F1-model_v4 Type II secretion system F family protein 0.7356 66 321 GO:0005886
AF-A0A521U6W8-F1-model_v4 Secretion system protein 0.7335 61 321 GO:0005886
AF-A0A7C6LIE8-F1-model_v4 deleted 0.7325 74 321

Feature Viewer

pLDDT pTM Quality
75.89 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map