F466532
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 586 | 272 | 571 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100061618|Ga0070665_1000616182 |
| Length | 305 |
| Sequence | MKASSILETIGNTPHIRVNRLFGDAEVWIKSERTNPGGSIKDRIALAMIEAAEASGDLKPGGTIIEPTSGNTGVGLAMVAAVKGYRLILVMPESMSVERRRLMLAYGASFDLTPREKGMKGAIERALELVDQTPNSWMPQQFENPANIDVHVRTTAQEIAADFADAPIDVLITGVGTGGHITGVAQVLKQLWPQLKVYAVEPTLSHVISGGQPGPHPIQGIGAGFIPANLHTQLLDGVIQVDPADAKDYARRAASEEGVLVGISSGATLAAIAQKLKELPAGSRVLGFNYDTGERYLSVPDFLPE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 5 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 6 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 7 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 8 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 9 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 10 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 11 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 12 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 13 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 14 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 15 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 16 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 114 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 171 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 177 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 178 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 179 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 180 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 182 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 185 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 186 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 187 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 188 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 192 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 203 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 212 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 213 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 215 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 216 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 217 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 218 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 219 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 220 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 221 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 222 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 223 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 224 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 247 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 248 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 249 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 250 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 251 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 252 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 258 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 259 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 260 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 262 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 265 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 269 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 270 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 271 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 272 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.44 |
| Metatranscriptomes | 0 |
| Isolates | 2.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.39 |
| Nodule | 0.34 |
| Rhizoplane | 4.61 |
| Rhizosphere | 85.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1290167 | 2162886007 | Bacteria | 2108 |
| 2 | JGI24744J21845_10025542 | 3300002077 | Bacteria | 1151 |
| 3 | Ga0065704_10004249 | 3300005289 | Bacteria | 9032 |
| 4 | Ga0065712_10196714 | 3300005290 | Bacteria | 1125 |
| 5 | Ga0070658_10011079 | 3300005327 | Bacteria | 7229 |
| 6 | Ga0070658_10226082 | 3300005327 | Bacteria | 1584 |
| 7 | Ga0070676_10053682 | 3300005328 | Bacteria | 2375 |
| 8 | Ga0070676_10080888 | 3300005328 | Bacteria | 1971 |
| 9 | Ga0070676_10140985 | 3300005328 | Bacteria | 1534 |
| 10 | Ga0070683_100015058 | 3300005329 | Bacteria | 6785 |
| 11 | Ga0070683_100173049 | 3300005329 | Bacteria | 2049 |
| 12 | Ga0070690_100000651 | 3300005330 | Bacteria | 17695 |
| 13 | Ga0070690_100070631 | 3300005330 | Bacteria | 2268 |
| 14 | Ga0070690_100097736 | 3300005330 | Bacteria | 1943 |
| 15 | Ga0070690_100169986 | 3300005330 | Bacteria | 1499 |
| 16 | Ga0070670_100034239 | 3300005331 | Bacteria | 4371 |
| 17 | Ga0070670_100060997 | 3300005331 | Bacteria | 3238 |
| 18 | Ga0070670_100080639 | 3300005331 | Bacteria | 2796 |
| 19 | Ga0070670_100093079 | 3300005331 | Bacteria | 2592 |
| 20 | Ga0070677_10009793 | 3300005333 | Bacteria | 3260 |
| 21 | Ga0070677_10083012 | 3300005333 | Bacteria | 1375 |
| 22 | Ga0068869_100001401 | 3300005334 | Bacteria | 14244 |
| 23 | Ga0068869_100005873 | 3300005334 | Bacteria | 7751 |
| 24 | Ga0068869_100039477 | 3300005334 | Bacteria | 3370 |
| 25 | Ga0068869_100044338 | 3300005334 | Bacteria | 3198 |
| 26 | Ga0070680_100036578 | 3300005336 | Bacteria | 3966 |
| 27 | Ga0070682_100078844 | 3300005337 | Bacteria | 2126 |
| 28 | Ga0068868_100000439 | 3300005338 | Bacteria | 27952 |
| 29 | Ga0068868_100006871 | 3300005338 | Bacteria | 8081 |
| 30 | Ga0068868_100027204 | 3300005338 | Bacteria | 4362 |
| 31 | Ga0068868_100030921 | 3300005338 | Bacteria | 4108 |
| 32 | Ga0068868_100109092 | 3300005338 | Bacteria | 2247 |
| 33 | Ga0068868_100163336 | 3300005338 | Bacteria | 1841 |
| 34 | Ga0070660_100171670 | 3300005339 | Bacteria | 1752 |
| 35 | Ga0070689_100001789 | 3300005340 | Bacteria | 13808 |
| 36 | Ga0070689_100022218 | 3300005340 | Bacteria | 4735 |
| 37 | Ga0070689_100066063 | 3300005340 | Bacteria | 2818 |
| 38 | Ga0070689_100135304 | 3300005340 | Bacteria | 1979 |
| 39 | Ga0070691_10006175 | 3300005341 | Bacteria | 5467 |
| 40 | Ga0070687_100039502 | 3300005343 | Bacteria | 2372 |
| 41 | Ga0070687_100089292 | 3300005343 | Bacteria | 1701 |
| 42 | Ga0070687_100092633 | 3300005343 | Bacteria | 1675 |
| 43 | Ga0070661_100005385 | 3300005344 | Bacteria | 8821 |
| 44 | Ga0070661_100061902 | 3300005344 | Bacteria | 2747 |
| 45 | Ga0070661_100087494 | 3300005344 | Bacteria | 2304 |
| 46 | Ga0070669_100022578 | 3300005353 | Bacteria | 4499 |
| 47 | Ga0070675_100001927 | 3300005354 | Bacteria | 15350 |
| 48 | Ga0070675_100002165 | 3300005354 | Bacteria | 14527 |
| 49 | Ga0070675_100003623 | 3300005354 | Bacteria | 11751 |
| 50 | Ga0070675_100020207 | 3300005354 | Bacteria | 5314 |
| 51 | Ga0070675_100046382 | 3300005354 | Bacteria | 3558 |
| 52 | Ga0070671_100031280 | 3300005355 | Bacteria | 4395 |
| 53 | Ga0070671_100039634 | 3300005355 | Bacteria | 3910 |
| 54 | Ga0070671_100041682 | 3300005355 | Bacteria | 3815 |
| 55 | Ga0070671_100098487 | 3300005355 | Bacteria | 2453 |
| 56 | Ga0070674_100014881 | 3300005356 | Bacteria | 4843 |
| 57 | Ga0070674_100037159 | 3300005356 | Bacteria | 3274 |
| 58 | Ga0070674_100040856 | 3300005356 | Bacteria | 3139 |
| 59 | Ga0070674_100159859 | 3300005356 | Bacteria | 1708 |
| 60 | Ga0070673_100013975 | 3300005364 | Bacteria | 5575 |
| 61 | Ga0070688_100011889 | 3300005365 | Bacteria | 4858 |
| 62 | Ga0070659_100022263 | 3300005366 | Bacteria | 4836 |
| 63 | Ga0070659_100068909 | 3300005366 | Bacteria | 2807 |
| 64 | Ga0070659_100236894 | 3300005366 | Bacteria | 1509 |
| 65 | Ga0070667_100000219 | 3300005367 | Bacteria | 66264 |
| 66 | Ga0070667_100100758 | 3300005367 | Bacteria | 2495 |
| 67 | Ga0070701_10001211 | 3300005438 | Bacteria | 9467 |
| 68 | Ga0070701_10169471 | 3300005438 | Bacteria | 1270 |
| 69 | Ga0070705_100031828 | 3300005440 | Bacteria | 2925 |
| 70 | Ga0070700_100000784 | 3300005441 | Bacteria | 15661 |
| 71 | Ga0070700_100003161 | 3300005441 | Bacteria | 8463 |
| 72 | Ga0070694_100040337 | 3300005444 | Bacteria | 3112 |
| 73 | Ga0070708_100160181 | 3300005445 | Bacteria | 2097 |
| 74 | Ga0070663_100000127 | 3300005455 | Bacteria | 35963 |
| 75 | Ga0070663_100038045 | 3300005455 | Bacteria | 3353 |
| 76 | Ga0070663_100198683 | 3300005455 | Bacteria | 1564 |
| 77 | Ga0070678_100016474 | 3300005456 | Bacteria | 4730 |
| 78 | Ga0070678_100021761 | 3300005456 | Bacteria | 4235 |
| 79 | Ga0070678_100175889 | 3300005456 | Bacteria | 1748 |
| 80 | Ga0070678_100196870 | 3300005456 | Bacteria | 1660 |
| 81 | Ga0070662_100054794 | 3300005457 | Bacteria | 2890 |
| 82 | Ga0070662_100062034 | 3300005457 | Bacteria | 2730 |
| 83 | Ga0068867_100000191 | 3300005459 | Bacteria | 40494 |
| 84 | Ga0068867_100002519 | 3300005459 | Bacteria | 12885 |
| 85 | Ga0068867_100086035 | 3300005459 | Bacteria | 2377 |
| 86 | Ga0068867_100114357 | 3300005459 | Bacteria | 2077 |
| 87 | Ga0070685_10017750 | 3300005466 | Bacteria | 3814 |
| 88 | Ga0070685_10024345 | 3300005466 | Bacteria | 3324 |
| 89 | Ga0070684_100034577 | 3300005535 | Bacteria | 4321 |
| 90 | Ga0070684_100172039 | 3300005535 | Bacteria | 1967 |
| 91 | Ga0068853_100009633 | 3300005539 | Bacteria | 7785 |
| 92 | Ga0068853_100038715 | 3300005539 | Bacteria | 4062 |
| 93 | Ga0070672_100000455 | 3300005543 | Bacteria | 23832 |
| 94 | Ga0070672_100002919 | 3300005543 | Bacteria | 10995 |
| 95 | Ga0070672_100005115 | 3300005543 | Bacteria | 8652 |
| 96 | Ga0070672_100103955 | 3300005543 | Bacteria | 2307 |
| 97 | Ga0070686_100000103 | 3300005544 | Bacteria | 58400 |
| 98 | Ga0070695_100019666 | 3300005545 | Bacteria | 4115 |
| 99 | Ga0070693_100015766 | 3300005547 | Bacteria | 3898 |
| 100 | Ga0070665_100011648 | 3300005548 | Bacteria | 8888 |
| 101 | Ga0070665_100061618 | 3300005548 | Bacteria | 3761 |
| 102 | Ga0070704_100024201 | 3300005549 | Bacteria | 3981 |
| 103 | Ga0068855_100041737 | 3300005563 | Bacteria | 5436 |
| 104 | Ga0068855_100168578 | 3300005563 | Bacteria | 2480 |
| 105 | Ga0070664_100026911 | 3300005564 | Bacteria | 4776 |
| 106 | Ga0070664_100095623 | 3300005564 | Bacteria | 2577 |
| 107 | Ga0070664_100161563 | 3300005564 | Bacteria | 1982 |
| 108 | Ga0068854_100095494 | 3300005578 | Bacteria | 2219 |
| 109 | Ga0068854_100153274 | 3300005578 | Bacteria | 1779 |
| 110 | Ga0068854_100296856 | 3300005578 | Bacteria | 1306 |
| 111 | Ga0068856_100014048 | 3300005614 | Bacteria | 7742 |
| 112 | Ga0068856_100267596 | 3300005614 | Bacteria | 1725 |
| 113 | Ga0068856_100289712 | 3300005614 | Bacteria | 1654 |
| 114 | Ga0070702_100000081 | 3300005615 | Bacteria | 27675 |
| 115 | Ga0070702_100116519 | 3300005615 | Bacteria | 1665 |
| 116 | Ga0068852_100010121 | 3300005616 | Bacteria | 7023 |
| 117 | Ga0068852_100014760 | 3300005616 | Bacteria | 6030 |
| 118 | Ga0068852_100048149 | 3300005616 | Bacteria | 3641 |
| 119 | Ga0068852_100205635 | 3300005616 | Bacteria | 1865 |
| 120 | Ga0068852_100381004 | 3300005616 | Bacteria | 1384 |
| 121 | Ga0068859_100000560 | 3300005617 | Bacteria | 36894 |
| 122 | Ga0068859_100034614 | 3300005617 | Bacteria | 5069 |
| 123 | Ga0068859_100042950 | 3300005617 | Bacteria | 4542 |
| 124 | Ga0068864_100000895 | 3300005618 | Bacteria | 25086 |
| 125 | Ga0068864_100017183 | 3300005618 | Bacteria | 6033 |
| 126 | Ga0068864_100017870 | 3300005618 | Bacteria | 5916 |
| 127 | Ga0068864_100021458 | 3300005618 | Bacteria | 5411 |
| 128 | Ga0068864_100021750 | 3300005618 | Bacteria | 5372 |
| 129 | Ga0068864_100025048 | 3300005618 | Bacteria | 5022 |
| 130 | Ga0068864_100027849 | 3300005618 | Bacteria | 4776 |
| 131 | Ga0068864_100045997 | 3300005618 | Bacteria | 3744 |
| 132 | Ga0068866_10000201 | 3300005718 | Bacteria | 28091 |
| 133 | Ga0068866_10005486 | 3300005718 | Bacteria | 5238 |
| 134 | Ga0068866_10015962 | 3300005718 | Bacteria | 3347 |
| 135 | Ga0068866_10151419 | 3300005718 | Bacteria | 1344 |
| 136 | Ga0068861_100002141 | 3300005719 | Bacteria | 12777 |
| 137 | Ga0068861_100032122 | 3300005719 | Bacteria | 3862 |
| 138 | Ga0068861_100087488 | 3300005719 | Bacteria | 2452 |
| 139 | Ga0068861_100175058 | 3300005719 | Bacteria | 1781 |
| 140 | Ga0068861_100245673 | 3300005719 | Bacteria | 1524 |
| 141 | Ga0068851_10013154 | 3300005834 | Bacteria | 3914 |
| 142 | Ga0068851_10082939 | 3300005834 | Bacteria | 1676 |
| 143 | Ga0068851_10138061 | 3300005834 | Bacteria | 1323 |
| 144 | Ga0068870_10002727 | 3300005840 | Bacteria | 7411 |
| 145 | Ga0068870_10019703 | 3300005840 | Bacteria | 3276 |
| 146 | Ga0068863_100030122 | 3300005841 | Bacteria | 5183 |
| 147 | Ga0068863_100070339 | 3300005841 | Bacteria | 3309 |
| 148 | Ga0068863_100094258 | 3300005841 | Bacteria | 2841 |
| 149 | Ga0068863_100231486 | 3300005841 | Bacteria | 1782 |
| 150 | Ga0068858_100000455 | 3300005842 | Bacteria | 42847 |
| 151 | Ga0068858_100000721 | 3300005842 | Bacteria | 34455 |
| 152 | Ga0068858_100009127 | 3300005842 | Bacteria | 9482 |
| 153 | Ga0068858_100039426 | 3300005842 | Bacteria | 4380 |
| 154 | Ga0068858_100101201 | 3300005842 | Bacteria | 2687 |
| 155 | Ga0068858_100216887 | 3300005842 | Bacteria | 1811 |
| 156 | Ga0068860_100000590 | 3300005843 | Bacteria | 43453 |
| 157 | Ga0068860_100001308 | 3300005843 | Bacteria | 27073 |
| 158 | Ga0068860_100007722 | 3300005843 | Bacteria | 10754 |
| 159 | Ga0068860_100147216 | 3300005843 | Bacteria | 2266 |
| 160 | Ga0068860_100338034 | 3300005843 | Bacteria | 1480 |
| 161 | Ga0068862_100003224 | 3300005844 | Bacteria | 14128 |
| 162 | Ga0068862_100026724 | 3300005844 | Bacteria | 4852 |
| 163 | Ga0068862_100095149 | 3300005844 | Bacteria | 2598 |
| 164 | Ga0068862_100154745 | 3300005844 | Bacteria | 2043 |
| 165 | Ga0068862_100158895 | 3300005844 | Bacteria | 2016 |
| 166 | Ga0068862_100188914 | 3300005844 | Bacteria | 1852 |
| 167 | Ga0075365_10009503 | 3300006038 | Bacteria | 5595 |
| 168 | Ga0075363_100206622 | 3300006048 | Bacteria | 1123 |
| 169 | Ga0075362_10189052 | 3300006177 | Bacteria | 1000 |
| 170 | Ga0075366_10006850 | 3300006195 | Bacteria | 6270 |
| 171 | Ga0075366_10019096 | 3300006195 | Bacteria | 3961 |
| 172 | Ga0075366_10032281 | 3300006195 | Bacteria | 3082 |
| 173 | Ga0075366_10075243 | 3300006195 | Bacteria | 2014 |
| 174 | Ga0097621_100007342 | 3300006237 | Bacteria | 7880 |
| 175 | Ga0097621_100029482 | 3300006237 | Bacteria | 4334 |
| 176 | Ga0097621_100037662 | 3300006237 | Bacteria | 3878 |
| 177 | Ga0097621_100158999 | 3300006237 | Bacteria | 1941 |
| 178 | Ga0097621_100172735 | 3300006237 | Bacteria | 1864 |
| 179 | Ga0068871_100003664 | 3300006358 | Bacteria | 10561 |
| 180 | Ga0068871_100005099 | 3300006358 | Bacteria | 9177 |
| 181 | Ga0068871_100026970 | 3300006358 | Bacteria | 4488 |
| 182 | Ga0068871_100033926 | 3300006358 | Bacteria | 4045 |
| 183 | Ga0068871_100322945 | 3300006358 | Bacteria | 1360 |
| 184 | Ga0075430_100109317 | 3300006846 | Bacteria | 2306 |
| 185 | Ga0075429_100001832 | 3300006880 | Bacteria | 17596 |
| 186 | Ga0068865_100000113 | 3300006881 | Bacteria | 41428 |
| 187 | Ga0068865_100005106 | 3300006881 | Bacteria | 7943 |
| 188 | Ga0068865_100009533 | 3300006881 | Bacteria | 6024 |
| 189 | Ga0068865_100039020 | 3300006881 | Bacteria | 3219 |
| 190 | Ga0097620_100000560 | 3300006931 | Bacteria | 36894 |
| 191 | Ga0097620_100034614 | 3300006931 | Bacteria | 5069 |
| 192 | Ga0097620_100042953 | 3300006931 | Bacteria | 4542 |
| 193 | Ga0079104_1000037 | 3300006946 | Bacteria | 189207 |
| 194 | Ga0105250_10005204 | 3300009092 | Bacteria | 5865 |
| 195 | Ga0105240_10006593 | 3300009093 | Bacteria | 17041 |
| 196 | Ga0105240_10412254 | 3300009093 | Bacteria | 1519 |
| 197 | Ga0111539_10150637 | 3300009094 | Bacteria | 2723 |
| 198 | Ga0111539_10156092 | 3300009094 | Bacteria | 2670 |
| 199 | Ga0105245_10000681 | 3300009098 | Bacteria | 30711 |
| 200 | Ga0105245_10119619 | 3300009098 | Bacteria | 2459 |
| 201 | Ga0114129_11057768 | 3300009147 | Bacteria | 1018 |
| 202 | Ga0105243_10001082 | 3300009148 | Bacteria | 24928 |
| 203 | Ga0105243_10087298 | 3300009148 | Bacteria | 2560 |
| 204 | Ga0105242_10000201 | 3300009176 | Bacteria | 46357 |
| 205 | Ga0105242_10059715 | 3300009176 | Bacteria | 3130 |
| 206 | Ga0105248_10000507 | 3300009177 | Bacteria | 44310 |
| 207 | Ga0105248_10006243 | 3300009177 | Bacteria | 13064 |
| 208 | Ga0105248_10015929 | 3300009177 | Bacteria | 8280 |
| 209 | Ga0105237_10000293 | 3300009545 | Bacteria | 69295 |
| 210 | Ga0105237_10060968 | 3300009545 | Bacteria | 3773 |
| 211 | Ga0105238_10002472 | 3300009551 | Bacteria | 18494 |
| 212 | Ga0105238_10056225 | 3300009551 | Bacteria | 3948 |
| 213 | Ga0105238_10546103 | 3300009551 | Bacteria | 1163 |
| 214 | Ga0105249_10155467 | 3300009553 | Bacteria | 2205 |
| 215 | Ga0105239_10002229 | 3300010375 | Bacteria | 24806 |
| 216 | Ga0105239_10041884 | 3300010375 | Bacteria | 5018 |
| 217 | Ga0105246_10137644 | 3300011119 | Bacteria | 1832 |
| 218 | Ga0157369_10045523 | 3300013105 | Bacteria | 4771 |
| 219 | Ga0157374_10007912 | 3300013296 | Bacteria | 9076 |
| 220 | Ga0157374_10044586 | 3300013296 | Bacteria | 4099 |
| 221 | Ga0157378_10000357 | 3300013297 | Bacteria | 44996 |
| 222 | Ga0157378_10004481 | 3300013297 | Bacteria | 12262 |
| 223 | Ga0157378_10091957 | 3300013297 | Bacteria | 2760 |
| 224 | Ga0157378_10185707 | 3300013297 | Bacteria | 1958 |
| 225 | Ga0163162_10010609 | 3300013306 | Bacteria | 8958 |
| 226 | Ga0163162_10032428 | 3300013306 | Bacteria | 5190 |
| 227 | Ga0163162_10050559 | 3300013306 | Bacteria | 4168 |
| 228 | Ga0157372_10060660 | 3300013307 | Bacteria | 4232 |
| 229 | Ga0157375_10036214 | 3300013308 | Bacteria | 4719 |
| 230 | Ga0157375_10068089 | 3300013308 | Bacteria | 3560 |
| 231 | Ga0157375_10072962 | 3300013308 | Bacteria | 3450 |
| 232 | Ga0157375_10090867 | 3300013308 | Bacteria | 3113 |
| 233 | Ga0157375_10107087 | 3300013308 | Bacteria | 2889 |
| 234 | Ga0157375_10161038 | 3300013308 | Bacteria | 2386 |
| 235 | Ga0163163_10010737 | 3300014325 | Bacteria | 8260 |
| 236 | Ga0163163_10100097 | 3300014325 | Bacteria | 2921 |
| 237 | Ga0157380_10051588 | 3300014326 | Bacteria | 3254 |
| 238 | Ga0157377_10000851 | 3300014745 | Bacteria | 12687 |
| 239 | Ga0157377_10021594 | 3300014745 | Bacteria | 3388 |
| 240 | Ga0157377_10170982 | 3300014745 | Bacteria | 1359 |
| 241 | Ga0157379_10007924 | 3300014968 | Bacteria | 9208 |
| 242 | Ga0157379_10016573 | 3300014968 | Bacteria | 6480 |
| 243 | Ga0157379_10054497 | 3300014968 | Bacteria | 3573 |
| 244 | Ga0157379_10086058 | 3300014968 | Bacteria | 2818 |
| 245 | Ga0157379_10135800 | 3300014968 | Bacteria | 2216 |
| 246 | Ga0157379_10145880 | 3300014968 | Bacteria | 2134 |
| 247 | Ga0157379_10307026 | 3300014968 | Bacteria | 1447 |
| 248 | Ga0157376_10006028 | 3300014969 | Bacteria | 8522 |
| 249 | Ga0157376_10037673 | 3300014969 | Bacteria | 3929 |
| 250 | Ga0157376_10070159 | 3300014969 | Bacteria | 2973 |
| 251 | Ga0157376_10249327 | 3300014969 | Bacteria | 1657 |
| 252 | Ga0157376_10366103 | 3300014969 | Bacteria | 1384 |
| 253 | Ga0163161_10006861 | 3300017792 | Bacteria | 7880 |
| 254 | Ga0163161_10114971 | 3300017792 | Bacteria | 2016 |
| 255 | Ga0163161_10257488 | 3300017792 | Bacteria | 1362 |
| 256 | Ga0213872_10000007 | 3300021361 | Bacteria | 228206 |
| 257 | Ga0213872_10001260 | 3300021361 | Bacteria | 17048 |
| 258 | Ga0207673_1003014 | 3300025290 | Bacteria | 1953 |
| 259 | Ga0207673_1006090 | 3300025290 | Bacteria | 1486 |
| 260 | Ga0209257_1040921 | 3300025304 | Bacteria | 1379 |
| 261 | Ga0207697_10004453 | 3300025315 | Bacteria | 6692 |
| 262 | Ga0207697_10013322 | 3300025315 | Bacteria | 3432 |
| 263 | Ga0207656_10017279 | 3300025321 | Bacteria | 2823 |
| 264 | Ga0207696_1006923 | 3300025711 | Bacteria | 4499 |
| 265 | Ga0207682_10000900 | 3300025893 | Bacteria | 13769 |
| 266 | Ga0207682_10003046 | 3300025893 | Bacteria | 7359 |
| 267 | Ga0207682_10101817 | 3300025893 | Bacteria | 1256 |
| 268 | Ga0207642_10028252 | 3300025899 | Bacteria | 2307 |
| 269 | Ga0207688_10012874 | 3300025901 | Bacteria | 4548 |
| 270 | Ga0207688_10019227 | 3300025901 | Bacteria | 3719 |
| 271 | Ga0207680_10001992 | 3300025903 | Bacteria | 9567 |
| 272 | Ga0207680_10014983 | 3300025903 | Bacteria | 4034 |
| 273 | Ga0207645_10086051 | 3300025907 | Bacteria | 2019 |
| 274 | Ga0207645_10099664 | 3300025907 | Bacteria | 1873 |
| 275 | Ga0207643_10002587 | 3300025908 | Bacteria | 9787 |
| 276 | Ga0207643_10005660 | 3300025908 | Bacteria | 6683 |
| 277 | Ga0207643_10037001 | 3300025908 | Bacteria | 2738 |
| 278 | Ga0207705_10013870 | 3300025909 | Bacteria | 5810 |
| 279 | Ga0207705_10120299 | 3300025909 | Bacteria | 1948 |
| 280 | Ga0207654_10252630 | 3300025911 | Bacteria | 1182 |
| 281 | Ga0207695_10028942 | 3300025913 | Bacteria | 6132 |
| 282 | Ga0207671_10012562 | 3300025914 | Bacteria | 6801 |
| 283 | Ga0207660_10230092 | 3300025917 | Bacteria | 1457 |
| 284 | Ga0207662_10057699 | 3300025918 | Bacteria | 2321 |
| 285 | Ga0207662_10101705 | 3300025918 | Bacteria | 1781 |
| 286 | Ga0207662_10188706 | 3300025918 | Bacteria | 1329 |
| 287 | Ga0207657_10011645 | 3300025919 | Bacteria | 8720 |
| 288 | Ga0207657_10097491 | 3300025919 | Bacteria | 2444 |
| 289 | Ga0207657_10115989 | 3300025919 | Bacteria | 2207 |
| 290 | Ga0207649_10030192 | 3300025920 | Bacteria | 3207 |
| 291 | Ga0207649_10328739 | 3300025920 | Bacteria | 1125 |
| 292 | Ga0207681_10002665 | 3300025923 | Bacteria | 11317 |
| 293 | Ga0207681_10038936 | 3300025923 | Bacteria | 3153 |
| 294 | Ga0207694_10028093 | 3300025924 | Bacteria | 4288 |
| 295 | Ga0207694_10066315 | 3300025924 | Bacteria | 2816 |
| 296 | Ga0207650_10001429 | 3300025925 | Bacteria | 17220 |
| 297 | Ga0207650_10056101 | 3300025925 | Bacteria | 2926 |
| 298 | Ga0207659_10006606 | 3300025926 | Bacteria | 7122 |
| 299 | Ga0207659_10042734 | 3300025926 | Bacteria | 3179 |
| 300 | Ga0207659_10069001 | 3300025926 | Bacteria | 2573 |
| 301 | Ga0207659_10154317 | 3300025926 | Bacteria | 1796 |
| 302 | Ga0207687_10005916 | 3300025927 | Bacteria | 8094 |
| 303 | Ga0207687_10065856 | 3300025927 | Bacteria | 2574 |
| 304 | Ga0207644_10012310 | 3300025931 | Bacteria | 5680 |
| 305 | Ga0207644_10036291 | 3300025931 | Bacteria | 3460 |
| 306 | Ga0207644_10107729 | 3300025931 | Bacteria | 2102 |
| 307 | Ga0207644_10155410 | 3300025931 | Bacteria | 1773 |
| 308 | Ga0207690_10242182 | 3300025932 | Bacteria | 1390 |
| 309 | Ga0207706_10001422 | 3300025933 | Bacteria | 23958 |
| 310 | Ga0207706_10009838 | 3300025933 | Bacteria | 8770 |
| 311 | Ga0207686_10000084 | 3300025934 | Bacteria | 79402 |
| 312 | Ga0207709_10001923 | 3300025935 | Bacteria | 13649 |
| 313 | Ga0207709_10004553 | 3300025935 | Bacteria | 7988 |
| 314 | Ga0207709_10142260 | 3300025935 | Bacteria | 1650 |
| 315 | Ga0207709_10177420 | 3300025935 | Bacteria | 1501 |
| 316 | Ga0207670_10109945 | 3300025936 | Bacteria | 1984 |
| 317 | Ga0207669_10029240 | 3300025937 | Bacteria | 3044 |
| 318 | Ga0207669_10095679 | 3300025937 | Bacteria | 1947 |
| 319 | Ga0207669_10155549 | 3300025937 | Bacteria | 1607 |
| 320 | Ga0207669_10162953 | 3300025937 | Bacteria | 1577 |
| 321 | Ga0207669_10337619 | 3300025937 | Bacteria | 1159 |
| 322 | Ga0207704_10000166 | 3300025938 | Bacteria | 34959 |
| 323 | Ga0207704_10028245 | 3300025938 | Bacteria | 3109 |
| 324 | Ga0207704_10028911 | 3300025938 | Bacteria | 3083 |
| 325 | Ga0207704_10058630 | 3300025938 | Bacteria | 2372 |
| 326 | Ga0207704_10079332 | 3300025938 | Bacteria | 2115 |
| 327 | Ga0207704_10143360 | 3300025938 | Bacteria | 1675 |
| 328 | Ga0207691_10000973 | 3300025940 | Bacteria | 28494 |
| 329 | Ga0207691_10001288 | 3300025940 | Bacteria | 25003 |
| 330 | Ga0207691_10016296 | 3300025940 | Bacteria | 7057 |
| 331 | Ga0207691_10016383 | 3300025940 | Bacteria | 7035 |
| 332 | Ga0207691_10086415 | 3300025940 | Bacteria | 2814 |
| 333 | Ga0207691_10097893 | 3300025940 | Bacteria | 2621 |
| 334 | Ga0207691_10316187 | 3300025940 | Bacteria | 1339 |
| 335 | Ga0207711_10014573 | 3300025941 | Bacteria | 6532 |
| 336 | Ga0207711_10038891 | 3300025941 | Bacteria | 4045 |
| 337 | Ga0207711_10067741 | 3300025941 | Bacteria | 3091 |
| 338 | Ga0207689_10000272 | 3300025942 | Bacteria | 46619 |
| 339 | Ga0207689_10000937 | 3300025942 | Bacteria | 28023 |
| 340 | Ga0207689_10001248 | 3300025942 | Bacteria | 24503 |
| 341 | Ga0207689_10079500 | 3300025942 | Bacteria | 2695 |
| 342 | Ga0207661_10029460 | 3300025944 | Bacteria | 4216 |
| 343 | Ga0207661_10211006 | 3300025944 | Bacteria | 1711 |
| 344 | Ga0207679_10015894 | 3300025945 | Bacteria | 4988 |
| 345 | Ga0207679_10104017 | 3300025945 | Bacteria | 2227 |
| 346 | Ga0207679_10185065 | 3300025945 | Bacteria | 1726 |
| 347 | Ga0207667_10041872 | 3300025949 | Bacteria | 4870 |
| 348 | Ga0207667_10113456 | 3300025949 | Bacteria | 2794 |
| 349 | Ga0207667_10563682 | 3300025949 | Bacteria | 1151 |
| 350 | Ga0207651_10003511 | 3300025960 | Bacteria | 7704 |
| 351 | Ga0207651_10037473 | 3300025960 | Bacteria | 3177 |
| 352 | Ga0207712_10104175 | 3300025961 | Bacteria | 2115 |
| 353 | Ga0207712_10153420 | 3300025961 | Bacteria | 1781 |
| 354 | Ga0207668_10000968 | 3300025972 | Bacteria | 17241 |
| 355 | Ga0207668_10133598 | 3300025972 | Bacteria | 1898 |
| 356 | Ga0207640_10006595 | 3300025981 | Bacteria | 6374 |
| 357 | Ga0207640_10021609 | 3300025981 | Bacteria | 3839 |
| 358 | Ga0207658_10001919 | 3300025986 | Bacteria | 15520 |
| 359 | Ga0207658_10006686 | 3300025986 | Bacteria | 7860 |
| 360 | Ga0207658_10091873 | 3300025986 | Bacteria | 2356 |
| 361 | Ga0207677_10033837 | 3300026023 | Bacteria | 3302 |
| 362 | Ga0207677_10088568 | 3300026023 | Bacteria | 2245 |
| 363 | Ga0207677_10314858 | 3300026023 | Bacteria | 1298 |
| 364 | Ga0207703_10000375 | 3300026035 | Bacteria | 47699 |
| 365 | Ga0207703_10015188 | 3300026035 | Bacteria | 6008 |
| 366 | Ga0207703_10019666 | 3300026035 | Bacteria | 5277 |
| 367 | Ga0207703_10026050 | 3300026035 | Bacteria | 4602 |
| 368 | Ga0207703_10070368 | 3300026035 | Bacteria | 2888 |
| 369 | Ga0207703_10314429 | 3300026035 | Bacteria | 1432 |
| 370 | Ga0207639_10091865 | 3300026041 | Bacteria | 2431 |
| 371 | Ga0207639_10252212 | 3300026041 | Bacteria | 1539 |
| 372 | Ga0207639_10352528 | 3300026041 | Bacteria | 1315 |
| 373 | Ga0207678_10000711 | 3300026067 | Bacteria | 30413 |
| 374 | Ga0207678_10003317 | 3300026067 | Bacteria | 14517 |
| 375 | Ga0207678_10009807 | 3300026067 | Bacteria | 8420 |
| 376 | Ga0207678_10317485 | 3300026067 | Bacteria | 1340 |
| 377 | Ga0207678_10338962 | 3300026067 | Bacteria | 1295 |
| 378 | Ga0207678_10528250 | 3300026067 | Bacteria | 1030 |
| 379 | Ga0207708_10000134 | 3300026075 | Bacteria | 58313 |
| 380 | Ga0207708_10000749 | 3300026075 | Bacteria | 24378 |
| 381 | Ga0207708_10010230 | 3300026075 | Bacteria | 6965 |
| 382 | Ga0207702_10010113 | 3300026078 | Bacteria | 7906 |
| 383 | Ga0207702_10089243 | 3300026078 | Bacteria | 2696 |
| 384 | Ga0207641_10019018 | 3300026088 | Bacteria | 5634 |
| 385 | Ga0207641_10510520 | 3300026088 | Bacteria | 1168 |
| 386 | Ga0207648_10000433 | 3300026089 | Bacteria | 46203 |
| 387 | Ga0207648_10000842 | 3300026089 | Bacteria | 34576 |
| 388 | Ga0207648_10002680 | 3300026089 | Bacteria | 18942 |
| 389 | Ga0207648_10005765 | 3300026089 | Bacteria | 12408 |
| 390 | Ga0207648_10011252 | 3300026089 | Bacteria | 8436 |
| 391 | Ga0207648_10051060 | 3300026089 | Bacteria | 3614 |
| 392 | Ga0207676_10010703 | 3300026095 | Bacteria | 6541 |
| 393 | Ga0207676_10010902 | 3300026095 | Bacteria | 6484 |
| 394 | Ga0207676_10024579 | 3300026095 | Bacteria | 4459 |
| 395 | Ga0207676_10048959 | 3300026095 | Bacteria | 3284 |
| 396 | Ga0207676_10051785 | 3300026095 | Bacteria | 3206 |
| 397 | Ga0207676_10062591 | 3300026095 | Bacteria | 2952 |
| 398 | Ga0207676_10517730 | 3300026095 | Bacteria | 1135 |
| 399 | Ga0207674_10026211 | 3300026116 | Bacteria | 6199 |
| 400 | Ga0207674_10328098 | 3300026116 | Bacteria | 1480 |
| 401 | Ga0207675_100000490 | 3300026118 | Bacteria | 38407 |
| 402 | Ga0207675_100001900 | 3300026118 | Bacteria | 20834 |
| 403 | Ga0207675_100002302 | 3300026118 | Bacteria | 18970 |
| 404 | Ga0207675_100026407 | 3300026118 | Bacteria | 5406 |
| 405 | Ga0207683_10005797 | 3300026121 | Bacteria | 10593 |
| 406 | Ga0207683_10011107 | 3300026121 | Bacteria | 7676 |
| 407 | Ga0207683_10012464 | 3300026121 | Bacteria | 7255 |
| 408 | Ga0207683_10083065 | 3300026121 | Bacteria | 2846 |
| 409 | Ga0207683_10166311 | 3300026121 | Bacteria | 1996 |
| 410 | Ga0207698_10002753 | 3300026142 | Bacteria | 10485 |
| 411 | Ga0207698_10037986 | 3300026142 | Bacteria | 3553 |
| 412 | Ga0207698_10247142 | 3300026142 | Bacteria | 1630 |
| 413 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 414 | Ga0209983_1018933 | 3300027665 | Bacteria | 1431 |
| 415 | Ga0207428_10177992 | 3300027907 | Bacteria | 1608 |
| 416 | Ga0268266_10164311 | 3300028379 | Bacteria | 2010 |
| 417 | Ga0268266_10429243 | 3300028379 | Bacteria | 1253 |
| 418 | Ga0268265_10005950 | 3300028380 | Bacteria | 8303 |
| 419 | Ga0268265_10010067 | 3300028380 | Bacteria | 6382 |
| 420 | Ga0268265_10010172 | 3300028380 | Bacteria | 6350 |
| 421 | Ga0268265_10135597 | 3300028380 | Bacteria | 2053 |
| 422 | Ga0268264_10000991 | 3300028381 | Bacteria | 28937 |
| 423 | Ga0268264_10004638 | 3300028381 | Bacteria | 11677 |
| 424 | Ga0268264_10016497 | 3300028381 | Bacteria | 6048 |
| 425 | Ga0307517_10000228 | 3300028786 | Bacteria | 94852 |
| 426 | Ga0307517_10194207 | 3300028786 | Bacteria | 1282 |
| 427 | Ga0307517_10197632 | 3300028786 | Bacteria | 1263 |
| 428 | Ga0307515_10027638 | 3300028794 | Bacteria | 9685 |
| 429 | Ga0307515_10304248 | 3300028794 | Bacteria | 1276 |
| 430 | Ga0307512_10071922 | 3300030522 | Bacteria | 2563 |
| 431 | Ga0265328_10020656 | 3300031239 | Bacteria | 2518 |
| 432 | Ga0265331_10001779 | 3300031250 | Bacteria | 15399 |
| 433 | Ga0265327_10000491 | 3300031251 | Bacteria | 69450 |
| 434 | Ga0307509_10004172 | 3300031507 | Bacteria | 21115 |
| 435 | Ga0307509_10007733 | 3300031507 | Bacteria | 13939 |
| 436 | Ga0307509_10017238 | 3300031507 | Bacteria | 8319 |
| 437 | Ga0307509_10062175 | 3300031507 | Bacteria | 3938 |
| 438 | Ga0307509_10143518 | 3300031507 | Bacteria | 2318 |
| 439 | Ga0307408_100004119 | 3300031548 | Bacteria | 9908 |
| 440 | Ga0307408_100113242 | 3300031548 | Bacteria | 2088 |
| 441 | Ga0307508_10000273 | 3300031616 | Bacteria | 63550 |
| 442 | Ga0307514_10000355 | 3300031649 | Bacteria | 106758 |
| 443 | Ga0307514_10094482 | 3300031649 | Bacteria | 2167 |
| 444 | Ga0316579_10001716 | 3300031691 | Bacteria | 8053 |
| 445 | Ga0316578_10014936 | 3300031728 | Bacteria | 4163 |
| 446 | Ga0307516_10004597 | 3300031730 | Bacteria | 16937 |
| 447 | Ga0307516_10171053 | 3300031730 | Bacteria | 1913 |
| 448 | Ga0307405_10005079 | 3300031731 | Bacteria | 6300 |
| 449 | Ga0307413_10103521 | 3300031824 | Bacteria | 1887 |
| 450 | Ga0307518_10030185 | 3300031838 | Bacteria | 3925 |
| 451 | Ga0307410_10008485 | 3300031852 | Bacteria | 5699 |
| 452 | Ga0307406_10003644 | 3300031901 | Bacteria | 8388 |
| 453 | Ga0307406_10127200 | 3300031901 | Bacteria | 1782 |
| 454 | Ga0307406_10194433 | 3300031901 | Bacteria | 1488 |
| 455 | Ga0307412_10005312 | 3300031911 | Bacteria | 7231 |
| 456 | Ga0307412_10152284 | 3300031911 | Bacteria | 1708 |
| 457 | Ga0307412_10172533 | 3300031911 | Bacteria | 1618 |
| 458 | Ga0307416_100174538 | 3300032002 | Bacteria | 2006 |
| 459 | Ga0307416_100326714 | 3300032002 | Bacteria | 1539 |
| 460 | Ga0307414_10019323 | 3300032004 | Bacteria | 4219 |
| 461 | Ga0307414_10137120 | 3300032004 | Bacteria | 1910 |
| 462 | Ga0307411_10001450 | 3300032005 | Bacteria | 9703 |
| 463 | Ga0307415_100006924 | 3300032126 | Bacteria | 6157 |
| 464 | Ga0307510_10000967 | 3300033180 | Bacteria | 30417 |
| 465 | Ga0307510_10032606 | 3300033180 | Bacteria | 5866 |
| 466 | Ga0307510_10140259 | 3300033180 | Bacteria | 2062 |
| 467 | Ga0373959_0013134 | 3300034820 | Bacteria | 1490 |
| 468 | Ga0373944_0003244 | 3300035089 | Bacteria | 4183 |
| 469 | Ga0373939_0000041 | 3300035114 | Bacteria | 45477 |
| 470 | Ga0373960_0000135 | 3300035121 | Bacteria | 12101 |
| 471 | Ga0373943_0130977 | 3300035170 | Bacteria | 1342 |
| 472 | Ga0373931_0000097 | 3300035691 | Bacteria | 40104 |
| 473 | Ga0373931_0000882 | 3300035691 | Bacteria | 12672 |
| 474 | Ga0373931_0056926 | 3300035691 | Bacteria | 2096 |
| 475 | Ga0373927_0089373 | 3300035695 | Bacteria | 2000 |
| 476 | Ga0373927_0119654 | 3300035695 | Bacteria | 1719 |
| 477 | Ga0373937_0186202 | 3300036401 | Bacteria | 1950 |
| 478 | Ga0316582_0011481 | 3300036647 | Bacteria | 4899 |
| 479 | Ga0373925_0015343 | 3300037068 | Bacteria | 5542 |
| 480 | Ga0373925_0027068 | 3300037068 | Bacteria | 4199 |
| 481 | Ga0373925_0073937 | 3300037068 | Bacteria | 2581 |
| 482 | Ga0373925_0157574 | 3300037068 | Bacteria | 1786 |
| 483 | Ga0395905_0001659 | 3300037471 | Bacteria | 26289 |
| 484 | Ga0395905_0002961 | 3300037471 | Bacteria | 18458 |
| 485 | Ga0395905_0053160 | 3300037471 | Bacteria | 3791 |
| 486 | Ga0395905_0242920 | 3300037471 | Bacteria | 1682 |
| 487 | Ga0436360_0026854 | 3300039438 | Bacteria | 1920 |
| 488 | Ga0436360_0702683 | 3300039438 | Bacteria | 9964 |
| 489 | Ga0436361_0021397 | 3300039447 | Bacteria | 46447 |
| 490 | Ga0436361_0163583 | 3300039447 | Bacteria | 173204 |
| 491 | Ga0436361_0480355 | 3300039447 | Bacteria | 4166 |
| 492 | Ga0436361_0515416 | 3300039447 | Bacteria | 1512 |
| 493 | Ga0436361_0694318 | 3300039447 | Bacteria | 14752 |
| 494 | Ga0451791_0028897 | 3300041451 | Bacteria | 1027 |
| 495 | Ga0451800_1657359 | 3300041459 | Bacteria | 1336 |
| 496 | Ga0450920_021836 | 3300042122 | Bacteria | 1238 |
| 497 | Ga0439434_0053546 | 3300042435 | Bacteria | 1254 |
| 498 | Ga0450918_000419 | 3300042531 | Bacteria | 9209 |
| 499 | Ga0450893_0009516 | 3300042532 | Bacteria | 1588 |
| 500 | Ga0451577_0003355 | 3300042876 | Bacteria | 17937 |
| 501 | Ga0451577_0011238 | 3300042876 | Bacteria | 8485 |
| 502 | Ga0453684_0098650 | 3300044712 | Bacteria | 3580 |
| 503 | Ga0453684_0105932 | 3300044712 | Bacteria | 3428 |
| 504 | Ga0466968_0029228 | 3300044735 | Bacteria | 2278 |
| 505 | Ga0451576_0045812 | 3300045051 | Bacteria | 4604 |
| 506 | Ga0466958_0034970 | 3300045836 | Bacteria | 3000 |
| 507 | Ga0495592_0000307 | 3300046454 | Bacteria | 41229 |
| 508 | Ga0495590_0001456 | 3300046457 | Bacteria | 10206 |
| 509 | Ga0495650_0005020 | 3300046471 | Bacteria | 8792 |
| 510 | Ga0495597_0000054 | 3300046542 | Bacteria | 95390 |
| 511 | Ga0495633_0001764 | 3300046558 | Bacteria | 16041 |
| 512 | Ga0495625_0082794 | 3300046660 | Bacteria | 2231 |
| 513 | Ga0495647_0048038 | 3300046681 | Bacteria | 1649 |
| 514 | Ga0495614_0018660 | 3300048089 | Bacteria | 3004 |
| 515 | Ga0496100_0119952 | 3300048903 | Bacteria | 1838 |
| 516 | Ga0496101_0035120 | 3300048904 | Bacteria | 3545 |
| 517 | Ga0496101_0138814 | 3300048904 | Bacteria | 1851 |
| 518 | Ga0496102_0012909 | 3300048905 | Bacteria | 7233 |
| 519 | Ga0496102_0352231 | 3300048905 | Bacteria | 1386 |
| 520 | Ga0496104_0077458 | 3300048907 | Bacteria | 3168 |
| 521 | Ga0496104_0362256 | 3300048907 | Bacteria | 1362 |
| 522 | Ga0496105_0031152 | 3300048908 | Bacteria | 4372 |
| 523 | Ga0496105_0220206 | 3300048908 | Bacteria | 1545 |
| 524 | Ga0496106_0023412 | 3300048909 | Bacteria | 4588 |
| 525 | Ga0496106_0063643 | 3300048909 | Bacteria | 2804 |
| 526 | Ga0496107_0073536 | 3300048910 | Bacteria | 2486 |
| 527 | Ga0496107_0241731 | 3300048910 | Bacteria | 1343 |
| 528 | Ga0496108_0096804 | 3300048911 | Bacteria | 2514 |
| 529 | Ga0496109_0027726 | 3300048912 | Bacteria | 5060 |
| 530 | Ga0496109_0084402 | 3300048912 | Bacteria | 2930 |
| 531 | Ga0496110_0058616 | 3300048913 | Bacteria | 3391 |
| 532 | Ga0496110_0110927 | 3300048913 | Bacteria | 2465 |
| 533 | Ga0496111_0111703 | 3300048914 | Bacteria | 2013 |
| 534 | Ga0496112_0110815 | 3300048915 | Bacteria | 2715 |
| 535 | Ga0496112_0394269 | 3300048915 | Bacteria | 1324 |
| 536 | Ga0496114_0035179 | 3300048917 | Bacteria | 4135 |
| 537 | Ga0496114_0172549 | 3300048917 | Bacteria | 1885 |
| 538 | Ga0496114_0466587 | 3300048917 | Bacteria | 1117 |
| 539 | Ga0496115_0038526 | 3300048918 | Bacteria | 3793 |
| 540 | Ga0496118_0180449 | 3300048921 | Bacteria | 1276 |
| 541 | Ga0496121_0001278 | 3300048924 | Bacteria | 43341 |
| 542 | Ga0496121_0040004 | 3300048924 | Bacteria | 4120 |
| 543 | Ga0496124_0000126 | 3300048927 | Bacteria | 159539 |
| 544 | Ga0496124_0074561 | 3300048927 | Bacteria | 2804 |
| 545 | Ga0496125_0003500 | 3300048928 | Bacteria | 18970 |
| 546 | Ga0496125_0107227 | 3300048928 | Bacteria | 2036 |
| 547 | Ga0496126_0029704 | 3300048929 | Bacteria | 5189 |
| 548 | Ga0501292_006324 | 3300049515 | Bacteria | 1679 |
| 549 | Ga0501034_0306624 | 3300049571 | Bacteria | 1523 |
| 550 | Ga0501043_0000012 | 3300049579 | Bacteria | 188907 |
| 551 | Ga0501046_0000030 | 3300049580 | Bacteria | 187803 |
| 552 | Ga0501047_0000049 | 3300049581 | Bacteria | 162513 |
| 553 | Ga0501048_0000082 | 3300049582 | Bacteria | 49693 |
| 554 | Ga0501198_000029 | 3300049649 | Bacteria | 61627 |
| 555 | Ga0501211_001400 | 3300049658 | Bacteria | 2581 |
| 556 | Ga0501222_000001 | 3300049662 | Bacteria | 307689 |
| 557 | Ga0501083_0010638 | 3300049744 | Bacteria | 6476 |
| 558 | Ga0501267_000300 | 3300049764 | Bacteria | 3641 |
| 559 | Ga0501044_0180647 | 3300049823 | Bacteria | 2077 |
| 560 | Ga0501045_0003743 | 3300049824 | Bacteria | 10463 |
| 561 | nmdc:mga0k408_158154_c1 | 3300050493 | Bacteria | 1350 |
| 562 | nmdc:mga0k408_42918_c1 | 3300050493 | Bacteria | 2605 |
| 563 | nmdc:mga0k408_50179_c1 | 3300050493 | Bacteria | 2415 |
| 564 | nmdc:mga09592_1124_c1 | 3300050508 | Bacteria | 21276 |
| 565 | nmdc:mga0qj67_290918_c1 | 3300050509 | Bacteria | 1324 |
| 566 | nmdc:mga08y16_41344_c1 | 3300050511 | Bacteria | 4829 |
| 567 | Ga0500644_0003021 | 3300053088 | Bacteria | 4172 |
| 568 | Ga0500559_0000636 | 3300053136 | Bacteria | 23688 |
| 569 | Ga0500622_0105998 | 3300053156 | Bacteria | 1378 |
| 570 | Ga0590071_028275 | 3300059421 | Bacteria | 1332 |
| 571 | Ga0590075_006183 | 3300059424 | Bacteria | 2838 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039447 | Ga0436361_0515416 | Ga0436361_0515416_230_1150 | 277 |
| 2 | 3300006358 | Ga0068871_100322945 | Ga0068871_1003229452 | 279 |
| 3 | 3300009545 | Ga0105237_10060968 | Ga0105237_100609683 | 279 |
| 4 | 3300039438 | Ga0436360_0026854 | Ga0436360_0026854_307_1227 | 279 |
| 5 | 3300025935 | Ga0207709_10177420 | Ga0207709_101774202 | 282 |
| 6 | 3300025940 | Ga0207691_10086415 | Ga0207691_100864151 | 282 |
| 7 | 3300037471 | Ga0395905_0242920 | Ga0395905_0242920_148_1065 | 283 |
| 8 | 3300046471 | Ga0495650_0005020 | Ga0495650_0005020_818_1738 | 284 |
| 9 | 3300048089 | Ga0495614_0018660 | Ga0495614_0018660_1983_2903 | 284 |
| 10 | 3300048921 | Ga0496118_0180449 | Ga0496118_0180449_272_1198 | 284 |
| 11 | 3300048924 | Ga0496121_0040004 | Ga0496121_0040004_2076_3002 | 284 |
| 12 | 3300048927 | Ga0496124_0000126 | Ga0496124_0000126_100213_101139 | 285 |
| 13 | 3300048928 | Ga0496125_0003500 | Ga0496125_0003500_16858_17784 | 285 |
| 14 | 3300005331 | Ga0070670_100080639 | Ga0070670_1000806393 | 286 |
| 15 | 3300026041 | Ga0207639_10352528 | Ga0207639_103525281 | 286 |
| 16 | 3300026089 | Ga0207648_10011252 | Ga0207648_100112525 | 286 |
| 17 | 3300006038 | Ga0075365_10009503 | Ga0075365_100095032 | 287 |
| 18 | 3300006195 | Ga0075366_10075243 | Ga0075366_100752432 | 287 |
| 19 | 3300032004 | Ga0307414_10137120 | Ga0307414_101371203 | 287 |
| 20 | 3300026121 | Ga0207683_10083065 | Ga0207683_100830651 | 290 |
| 21 | 3300005616 | Ga0068852_100381004 | Ga0068852_1003810042 | 291 |
| 22 | 3300005334 | Ga0068869_100039477 | Ga0068869_1000394773 | 292 |
| 23 | 3300005338 | Ga0068868_100163336 | Ga0068868_1001633362 | 292 |
| 24 | 3300005355 | Ga0070671_100039634 | Ga0070671_1000396342 | 292 |
| 25 | 3300005356 | Ga0070674_100159859 | Ga0070674_1001598592 | 292 |
| 26 | 3300005441 | Ga0070700_100003161 | Ga0070700_1000031613 | 292 |
| 27 | 3300005459 | Ga0068867_100086035 | Ga0068867_1000860351 | 292 |
| 28 | 3300005459 | Ga0068867_100114357 | Ga0068867_1001143572 | 292 |
| 29 | 3300005543 | Ga0070672_100002919 | Ga0070672_1000029194 | 292 |
| 30 | 3300005718 | Ga0068866_10005486 | Ga0068866_100054864 | 292 |
| 31 | 3300005719 | Ga0068861_100002141 | Ga0068861_10000214112 | 292 |
| 32 | 3300005843 | Ga0068860_100000590 | Ga0068860_10000059029 | 292 |
| 33 | 3300005844 | Ga0068862_100026724 | Ga0068862_1000267244 | 292 |
| 34 | 3300006881 | Ga0068865_100005106 | Ga0068865_1000051062 | 292 |
| 35 | 3300006881 | Ga0068865_100039020 | Ga0068865_1000390202 | 292 |
| 36 | 3300009148 | Ga0105243_10087298 | Ga0105243_100872982 | 292 |
| 37 | 3300009553 | Ga0105249_10155467 | Ga0105249_101554672 | 292 |
| 38 | 3300013297 | Ga0157378_10004481 | Ga0157378_100044816 | 292 |
| 39 | 3300013306 | Ga0163162_10010609 | Ga0163162_100106097 | 292 |
| 40 | 3300013308 | Ga0157375_10036214 | Ga0157375_100362143 | 292 |
| 41 | 3300017792 | Ga0163161_10114971 | Ga0163161_101149712 | 292 |
| 42 | 3300025899 | Ga0207642_10028252 | Ga0207642_100282522 | 292 |
| 43 | 3300025937 | Ga0207669_10095679 | Ga0207669_100956792 | 292 |
| 44 | 3300025938 | Ga0207704_10028911 | Ga0207704_100289111 | 292 |
| 45 | 3300025938 | Ga0207704_10079332 | Ga0207704_100793323 | 292 |
| 46 | 3300025940 | Ga0207691_10001288 | Ga0207691_1000128816 | 292 |
| 47 | 3300025942 | Ga0207689_10079500 | Ga0207689_100795003 | 292 |
| 48 | 3300025961 | Ga0207712_10104175 | Ga0207712_101041752 | 292 |
| 49 | 3300026023 | Ga0207677_10088568 | Ga0207677_100885682 | 292 |
| 50 | 3300026067 | Ga0207678_10528250 | Ga0207678_105282501 | 292 |
| 51 | 3300026075 | Ga0207708_10010230 | Ga0207708_100102308 | 292 |
| 52 | 3300026089 | Ga0207648_10000842 | Ga0207648_100008421 | 292 |
| 53 | 3300026089 | Ga0207648_10051060 | Ga0207648_100510602 | 292 |
| 54 | 3300026118 | Ga0207675_100001900 | Ga0207675_1000019003 | 292 |
| 55 | 3300028380 | Ga0268265_10005950 | Ga0268265_100059508 | 292 |
| 56 | 3300028381 | Ga0268264_10000991 | Ga0268264_1000099126 | 292 |
| 57 | 3300030522 | Ga0307512_10071922 | Ga0307512_100719223 | 292 |
| 58 | 3300031507 | Ga0307509_10007733 | Ga0307509_1000773311 | 292 |
| 59 | 3300031649 | Ga0307514_10094482 | Ga0307514_100944822 | 292 |
| 60 | 3300031838 | Ga0307518_10030185 | Ga0307518_100301855 | 292 |
| 61 | 3300033180 | Ga0307510_10000967 | Ga0307510_1000096721 | 292 |
| 62 | 3300005328 | Ga0070676_10053682 | Ga0070676_100536821 | 293 |
| 63 | 3300005331 | Ga0070670_100034239 | Ga0070670_1000342393 | 293 |
| 64 | 3300005338 | Ga0068868_100027204 | Ga0068868_1000272042 | 293 |
| 65 | 3300005356 | Ga0070674_100040856 | Ga0070674_1000408562 | 293 |
| 66 | 3300005456 | Ga0070678_100021761 | Ga0070678_1000217612 | 293 |
| 67 | 3300005543 | Ga0070672_100005115 | Ga0070672_1000051157 | 293 |
| 68 | 3300005618 | Ga0068864_100025048 | Ga0068864_1000250483 | 293 |
| 69 | 3300005841 | Ga0068863_100070339 | Ga0068863_1000703394 | 293 |
| 70 | 3300006237 | Ga0097621_100029482 | Ga0097621_1000294822 | 293 |
| 71 | 3300006358 | Ga0068871_100005099 | Ga0068871_1000050993 | 293 |
| 72 | 3300014745 | Ga0157377_10170982 | Ga0157377_101709822 | 293 |
| 73 | 3300014968 | Ga0157379_10307026 | Ga0157379_103070262 | 293 |
| 74 | 3300014969 | Ga0157376_10070159 | Ga0157376_100701593 | 293 |
| 75 | 3300017792 | Ga0163161_10257488 | Ga0163161_102574882 | 293 |
| 76 | 3300025893 | Ga0207682_10101817 | Ga0207682_101018171 | 293 |
| 77 | 3300025901 | Ga0207688_10019227 | Ga0207688_100192273 | 293 |
| 78 | 3300025909 | Ga0207705_10120299 | Ga0207705_101202992 | 293 |
| 79 | 3300025937 | Ga0207669_10162953 | Ga0207669_101629532 | 293 |
| 80 | 3300025940 | Ga0207691_10016383 | Ga0207691_100163837 | 293 |
| 81 | 3300026095 | Ga0207676_10024579 | Ga0207676_100245792 | 293 |
| 82 | 3300031548 | Ga0307408_100113242 | Ga0307408_1001132421 | 293 |
| 83 | 3300031731 | Ga0307405_10005079 | Ga0307405_100050794 | 293 |
| 84 | 3300031824 | Ga0307413_10103521 | Ga0307413_101035212 | 293 |
| 85 | 3300031852 | Ga0307410_10008485 | Ga0307410_100084854 | 293 |
| 86 | 3300031901 | Ga0307406_10127200 | Ga0307406_101272001 | 293 |
| 87 | 3300031911 | Ga0307412_10005312 | Ga0307412_100053128 | 293 |
| 88 | 3300032004 | Ga0307414_10019323 | Ga0307414_100193232 | 293 |
| 89 | 3300032005 | Ga0307411_10001450 | Ga0307411_100014509 | 293 |
| 90 | 3300032126 | Ga0307415_100006924 | Ga0307415_1000069244 | 293 |
| 91 | 3300044712 | Ga0453684_0105932 | Ga0453684_0105932_2162_3082 | 293 |
| 92 | 3300005618 | Ga0068864_100021750 | Ga0068864_1000217503 | 294 |
| 93 | 3300005841 | Ga0068863_100030122 | Ga0068863_1000301223 | 294 |
| 94 | 3300009098 | Ga0105245_10119619 | Ga0105245_101196193 | 294 |
| 95 | 3300025927 | Ga0207687_10065856 | Ga0207687_100658563 | 294 |
| 96 | 3300026095 | Ga0207676_10048959 | Ga0207676_100489593 | 294 |
| 97 | 3300028786 | Ga0307517_10000228 | Ga0307517_100002289 | 294 |
| 98 | 3300028786 | Ga0307517_10194207 | Ga0307517_101942071 | 294 |
| 99 | 3300028786 | Ga0307517_10197632 | Ga0307517_101976322 | 294 |
| 100 | 3300031507 | Ga0307509_10004172 | Ga0307509_100041726 | 294 |
| 101 | 3300031507 | Ga0307509_10017238 | Ga0307509_100172382 | 294 |
| 102 | 3300031616 | Ga0307508_10000273 | Ga0307508_1000027341 | 294 |
| 103 | 3300033180 | Ga0307510_10032606 | Ga0307510_100326063 | 294 |
| 104 | 3300033180 | Ga0307510_10140259 | Ga0307510_101402592 | 294 |
| 105 | 3300035089 | Ga0373944_0003244 | Ga0373944_0003244_2036_2953 | 294 |
| 106 | 3300035695 | Ga0373927_0089373 | Ga0373927_0089373_171_1088 | 294 |
| 107 | 3300037068 | Ga0373925_0015343 | Ga0373925_0015343_795_1712 | 294 |
| 108 | 3300046660 | Ga0495625_0082794 | Ga0495625_0082794_253_1173 | 294 |
| 109 | 3300053088 | Ga0500644_0003021 | Ga0500644_0003021_782_1702 | 294 |
| 110 | 3300053136 | Ga0500559_0000636 | Ga0500559_0000636_16729_17649 | 294 |
| 111 | 3300053156 | Ga0500622_0105998 | Ga0500622_0105998_280_1200 | 294 |
| 112 | 3300005290 | Ga0065712_10196714 | Ga0065712_101967141 | 295 |
| 113 | 3300005331 | Ga0070670_100093079 | Ga0070670_1000930792 | 295 |
| 114 | 3300005338 | Ga0068868_100030921 | Ga0068868_1000309212 | 295 |
| 115 | 3300005343 | Ga0070687_100089292 | Ga0070687_1000892922 | 295 |
| 116 | 3300005353 | Ga0070669_100022578 | Ga0070669_1000225782 | 295 |
| 117 | 3300005354 | Ga0070675_100001927 | Ga0070675_1000019279 | 295 |
| 118 | 3300005355 | Ga0070671_100031280 | Ga0070671_1000312804 | 295 |
| 119 | 3300005356 | Ga0070674_100014881 | Ga0070674_1000148813 | 295 |
| 120 | 3300005364 | Ga0070673_100013975 | Ga0070673_1000139753 | 295 |
| 121 | 3300005367 | Ga0070667_100000219 | Ga0070667_10000021954 | 295 |
| 122 | 3300005455 | Ga0070663_100198683 | Ga0070663_1001986832 | 295 |
| 123 | 3300005459 | Ga0068867_100002519 | Ga0068867_1000025194 | 295 |
| 124 | 3300005543 | Ga0070672_100000455 | Ga0070672_1000004554 | 295 |
| 125 | 3300005617 | Ga0068859_100034614 | Ga0068859_1000346143 | 295 |
| 126 | 3300005618 | Ga0068864_100017870 | Ga0068864_1000178703 | 295 |
| 127 | 3300005719 | Ga0068861_100087488 | Ga0068861_1000874882 | 295 |
| 128 | 3300005834 | Ga0068851_10082939 | Ga0068851_100829392 | 295 |
| 129 | 3300005840 | Ga0068870_10019703 | Ga0068870_100197032 | 295 |
| 130 | 3300005842 | Ga0068858_100009127 | Ga0068858_1000091277 | 295 |
| 131 | 3300005843 | Ga0068860_100007722 | Ga0068860_1000077227 | 295 |
| 132 | 3300006237 | Ga0097621_100037662 | Ga0097621_1000376623 | 295 |
| 133 | 3300006881 | Ga0068865_100009533 | Ga0068865_1000095336 | 295 |
| 134 | 3300006931 | Ga0097620_100034614 | Ga0097620_1000346143 | 295 |
| 135 | 3300013306 | Ga0163162_10050559 | Ga0163162_100505593 | 295 |
| 136 | 3300013308 | Ga0157375_10090867 | Ga0157375_100908672 | 295 |
| 137 | 3300014326 | Ga0157380_10051588 | Ga0157380_100515884 | 295 |
| 138 | 3300014968 | Ga0157379_10086058 | Ga0157379_100860581 | 295 |
| 139 | 3300017792 | Ga0163161_10006861 | Ga0163161_100068615 | 295 |
| 140 | 3300025290 | Ga0207673_1006090 | Ga0207673_10060901 | 295 |
| 141 | 3300025315 | Ga0207697_10013322 | Ga0207697_100133224 | 295 |
| 142 | 3300025893 | Ga0207682_10003046 | Ga0207682_100030464 | 295 |
| 143 | 3300025903 | Ga0207680_10014983 | Ga0207680_100149833 | 295 |
| 144 | 3300025908 | Ga0207643_10037001 | Ga0207643_100370012 | 295 |
| 145 | 3300025918 | Ga0207662_10057699 | Ga0207662_100576992 | 295 |
| 146 | 3300025923 | Ga0207681_10002665 | Ga0207681_100026653 | 295 |
| 147 | 3300025925 | Ga0207650_10001429 | Ga0207650_1000142913 | 295 |
| 148 | 3300025926 | Ga0207659_10006606 | Ga0207659_100066064 | 295 |
| 149 | 3300025931 | Ga0207644_10012310 | Ga0207644_100123104 | 295 |
| 150 | 3300025937 | Ga0207669_10029240 | Ga0207669_100292402 | 295 |
| 151 | 3300025938 | Ga0207704_10058630 | Ga0207704_100586302 | 295 |
| 152 | 3300025938 | Ga0207704_10143360 | Ga0207704_101433602 | 295 |
| 153 | 3300025940 | Ga0207691_10000973 | Ga0207691_100009739 | 295 |
| 154 | 3300025960 | Ga0207651_10003511 | Ga0207651_100035113 | 295 |
| 155 | 3300025986 | Ga0207658_10001919 | Ga0207658_100019198 | 295 |
| 156 | 3300026035 | Ga0207703_10026050 | Ga0207703_100260503 | 295 |
| 157 | 3300026067 | Ga0207678_10338962 | Ga0207678_103389622 | 295 |
| 158 | 3300026089 | Ga0207648_10005765 | Ga0207648_100057655 | 295 |
| 159 | 3300026095 | Ga0207676_10010902 | Ga0207676_100109023 | 295 |
| 160 | 3300026121 | Ga0207683_10011107 | Ga0207683_100111074 | 295 |
| 161 | 3300028381 | Ga0268264_10016497 | Ga0268264_100164974 | 295 |
| 162 | 3300006195 | Ga0075366_10032281 | Ga0075366_100322812 | 296 |
| 163 | 3300037068 | Ga0373925_0027068 | Ga0373925_0027068_2600_3520 | 296 |
| 164 | 3300041451 | Ga0451791_0028897 | Ga0451791_0028897_20_940 | 296 |
| 165 | 3300049649 | Ga0501198_000029 | Ga0501198_000029_59211_60131 | 296 |
| 166 | 3300049662 | Ga0501222_000001 | Ga0501222_000001_60087_61007 | 296 |
| 167 | 3300050493 | nmdc:mga0k408_50179_c1 | nmdc:mga0k408_50179_c1_37_1086 | 296 |
| 168 | 3300006195 | Ga0075366_10019096 | Ga0075366_100190963 | 297 |
| 169 | 3300045051 | Ga0451576_0045812 | Ga0451576_0045812_3089_4006 | 297 |
| 170 | 3300005548 | Ga0070665_100011648 | Ga0070665_1000116488 | 298 |
| 171 | 3300006195 | Ga0075366_10006850 | Ga0075366_100068502 | 298 |
| 172 | 3300009176 | Ga0105242_10000201 | Ga0105242_1000020122 | 298 |
| 173 | 3300013297 | Ga0157378_10185707 | Ga0157378_101857072 | 298 |
| 174 | 3300025961 | Ga0207712_10153420 | Ga0207712_101534202 | 298 |
| 175 | 3300026035 | Ga0207703_10314429 | Ga0207703_103144292 | 298 |
| 176 | 3300031901 | Ga0307406_10194433 | Ga0307406_101944332 | 298 |
| 177 | 3300031911 | Ga0307412_10152284 | Ga0307412_101522841 | 298 |
| 178 | 3300050493 | nmdc:mga0k408_42918_c1 | nmdc:mga0k408_42918_c1_1162_2085 | 298 |
| 179 | 3300028794 | Ga0307515_10304248 | Ga0307515_103042481 | 299 |
| 180 | 3300035114 | Ga0373939_0000041 | Ga0373939_0000041_29301_30218 | 299 |
| 181 | 3300035121 | Ga0373960_0000135 | Ga0373960_0000135_5693_6610 | 299 |
| 182 | 3300035691 | Ga0373931_0000097 | Ga0373931_0000097_37163_38080 | 299 |
| 183 | 3300039447 | Ga0436361_0480355 | Ga0436361_0480355_1851_2777 | 299 |
| 184 | iso_pu_bacteria | 2547132374 | 2548499252 | 300 |
| 185 | iso_pu_bacteria | 2585428062 | 2587758242 | 300 |
| 186 | iso_pu_bacteria | 2643221544 | 2643743256 | 300 |
| 187 | iso_pu_bacteria | 2643221570 | 2643866089 | 300 |
| 188 | iso_pu_bacteria | 2643221585 | 2643932722 | 300 |
| 189 | iso_pu_bacteria | 2643221644 | 2644245216 | 300 |
| 190 | iso_pu_bacteria | 2643221652 | 2644292903 | 300 |
| 191 | iso_pu_bacteria | 2643221654 | 2644305704 | 300 |
| 192 | iso_pu_bacteria | 2643221656 | 2644313972 | 300 |
| 193 | iso_pu_bacteria | 2643221717 | 2644647916 | 300 |
| 194 | iso_pu_bacteria | 2721755523 | 2722885718 | 300 |
| 195 | iso_pu_bacteria | 2738541337 | 2739056124 | 300 |
| 196 | iso_pu_bacteria | 2738543012 | 2739241971 | 300 |
| 197 | iso_pu_bacteria | 2816332133 | 2816470727 | 300 |
| 198 | iso_pu_bacteria | 2839138175 | 2839143944 | 300 |
| 199 | 3300005356 | Ga0070674_100037159 | Ga0070674_1000371593 | 302 |
| 200 | 3300005844 | Ga0068862_100095149 | Ga0068862_1000951491 | 302 |
| 201 | 3300025923 | Ga0207681_10038936 | Ga0207681_100389363 | 302 |
| 202 | 3300025937 | Ga0207669_10337619 | Ga0207669_103376192 | 302 |
| 203 | 3300025972 | Ga0207668_10000968 | Ga0207668_100009687 | 302 |
| 204 | 3300028380 | Ga0268265_10010172 | Ga0268265_100101727 | 302 |
| 205 | 3300039438 | Ga0436360_0702683 | Ga0436360_0702683_1765_2679 | 302 |
| 206 | 3300044735 | Ga0466968_0029228 | Ga0466968_0029228_809_1723 | 302 |
| 207 | 3300005616 | Ga0068852_100014760 | Ga0068852_1000147603 | 303 |
| 208 | 3300006048 | Ga0075363_100206622 | Ga0075363_1002066221 | 303 |
| 209 | 3300009094 | Ga0111539_10156092 | Ga0111539_101560926 | 303 |
| 210 | 3300009551 | Ga0105238_10546103 | Ga0105238_105461032 | 303 |
| 211 | 3300025949 | Ga0207667_10041872 | Ga0207667_100418722 | 303 |
| 212 | 3300026142 | Ga0207698_10037986 | Ga0207698_100379864 | 303 |
| 213 | 3300027907 | Ga0207428_10177992 | Ga0207428_101779921 | 303 |
| 214 | 3300031239 | Ga0265328_10020656 | Ga0265328_100206562 | 303 |
| 215 | 3300031250 | Ga0265331_10001779 | Ga0265331_100017794 | 303 |
| 216 | 3300031251 | Ga0265327_10000491 | Ga0265327_1000049134 | 303 |
| 217 | 3300031507 | Ga0307509_10143518 | Ga0307509_101435181 | 303 |
| 218 | 3300031730 | Ga0307516_10004597 | Ga0307516_1000459712 | 303 |
| 219 | 3300032002 | Ga0307416_100174538 | Ga0307416_1001745381 | 303 |
| 220 | 3300034820 | Ga0373959_0013134 | Ga0373959_0013134_53_973 | 303 |
| 221 | 3300037471 | Ga0395905_0002961 | Ga0395905_0002961_8938_9864 | 303 |
| 222 | 3300041459 | Ga0451800_1657359 | Ga0451800_1657359_334_1248 | 303 |
| 223 | 3300042122 | Ga0450920_021836 | Ga0450920_021836_70_984 | 303 |
| 224 | 3300045836 | Ga0466958_0034970 | Ga0466958_0034970_1543_2460 | 303 |
| 225 | 3300050511 | nmdc:mga08y16_41344_c1 | nmdc:mga08y16_41344_c1_3487_4407 | 303 |
| 226 | 3300002077 | JGI24744J21845_10025542 | JGI24744J21845_100255421 | 304 |
| 227 | 3300005327 | Ga0070658_10011079 | Ga0070658_100110793 | 304 |
| 228 | 3300005327 | Ga0070658_10226082 | Ga0070658_102260821 | 304 |
| 229 | 3300005328 | Ga0070676_10080888 | Ga0070676_100808882 | 304 |
| 230 | 3300005328 | Ga0070676_10140985 | Ga0070676_101409852 | 304 |
| 231 | 3300005329 | Ga0070683_100015058 | Ga0070683_1000150586 | 304 |
| 232 | 3300005329 | Ga0070683_100173049 | Ga0070683_1001730492 | 304 |
| 233 | 3300005330 | Ga0070690_100000651 | Ga0070690_10000065113 | 304 |
| 234 | 3300005330 | Ga0070690_100070631 | Ga0070690_1000706312 | 304 |
| 235 | 3300005330 | Ga0070690_100097736 | Ga0070690_1000977362 | 304 |
| 236 | 3300005330 | Ga0070690_100169986 | Ga0070690_1001699862 | 304 |
| 237 | 3300005331 | Ga0070670_100060997 | Ga0070670_1000609972 | 304 |
| 238 | 3300005333 | Ga0070677_10009793 | Ga0070677_100097932 | 304 |
| 239 | 3300005333 | Ga0070677_10083012 | Ga0070677_100830121 | 304 |
| 240 | 3300005334 | Ga0068869_100001401 | Ga0068869_1000014017 | 304 |
| 241 | 3300005334 | Ga0068869_100005873 | Ga0068869_1000058733 | 304 |
| 242 | 3300005334 | Ga0068869_100044338 | Ga0068869_1000443382 | 304 |
| 243 | 3300005336 | Ga0070680_100036578 | Ga0070680_1000365785 | 304 |
| 244 | 3300005337 | Ga0070682_100078844 | Ga0070682_1000788443 | 304 |
| 245 | 3300005338 | Ga0068868_100000439 | Ga0068868_10000043910 | 304 |
| 246 | 3300005338 | Ga0068868_100006871 | Ga0068868_1000068717 | 304 |
| 247 | 3300005338 | Ga0068868_100109092 | Ga0068868_1001090922 | 304 |
| 248 | 3300005339 | Ga0070660_100171670 | Ga0070660_1001716702 | 304 |
| 249 | 3300005340 | Ga0070689_100001789 | Ga0070689_1000017899 | 304 |
| 250 | 3300005340 | Ga0070689_100022218 | Ga0070689_1000222183 | 304 |
| 251 | 3300005340 | Ga0070689_100066063 | Ga0070689_1000660632 | 304 |
| 252 | 3300005340 | Ga0070689_100135304 | Ga0070689_1001353042 | 304 |
| 253 | 3300005341 | Ga0070691_10006175 | Ga0070691_100061751 | 304 |
| 254 | 3300005343 | Ga0070687_100039502 | Ga0070687_1000395022 | 304 |
| 255 | 3300005343 | Ga0070687_100092633 | Ga0070687_1000926332 | 304 |
| 256 | 3300005344 | Ga0070661_100005385 | Ga0070661_1000053857 | 304 |
| 257 | 3300005344 | Ga0070661_100061902 | Ga0070661_1000619023 | 304 |
| 258 | 3300005344 | Ga0070661_100087494 | Ga0070661_1000874943 | 304 |
| 259 | 3300005354 | Ga0070675_100002165 | Ga0070675_1000021658 | 304 |
| 260 | 3300005354 | Ga0070675_100003623 | Ga0070675_1000036232 | 304 |
| 261 | 3300005354 | Ga0070675_100020207 | Ga0070675_1000202073 | 304 |
| 262 | 3300005354 | Ga0070675_100046382 | Ga0070675_1000463823 | 304 |
| 263 | 3300005355 | Ga0070671_100041682 | Ga0070671_1000416824 | 304 |
| 264 | 3300005355 | Ga0070671_100098487 | Ga0070671_1000984874 | 304 |
| 265 | 3300005365 | Ga0070688_100011889 | Ga0070688_1000118895 | 304 |
| 266 | 3300005366 | Ga0070659_100022263 | Ga0070659_1000222632 | 304 |
| 267 | 3300005366 | Ga0070659_100068909 | Ga0070659_1000689091 | 304 |
| 268 | 3300005366 | Ga0070659_100236894 | Ga0070659_1002368942 | 304 |
| 269 | 3300005367 | Ga0070667_100100758 | Ga0070667_1001007582 | 304 |
| 270 | 3300005438 | Ga0070701_10001211 | Ga0070701_100012114 | 304 |
| 271 | 3300005438 | Ga0070701_10169471 | Ga0070701_101694712 | 304 |
| 272 | 3300005440 | Ga0070705_100031828 | Ga0070705_1000318283 | 304 |
| 273 | 3300005441 | Ga0070700_100000784 | Ga0070700_10000078419 | 304 |
| 274 | 3300005444 | Ga0070694_100040337 | Ga0070694_1000403372 | 304 |
| 275 | 3300005445 | Ga0070708_100160181 | Ga0070708_1001601812 | 304 |
| 276 | 3300005455 | Ga0070663_100000127 | Ga0070663_10000012725 | 304 |
| 277 | 3300005455 | Ga0070663_100038045 | Ga0070663_1000380453 | 304 |
| 278 | 3300005456 | Ga0070678_100016474 | Ga0070678_1000164743 | 304 |
| 279 | 3300005456 | Ga0070678_100175889 | Ga0070678_1001758891 | 304 |
| 280 | 3300005456 | Ga0070678_100196870 | Ga0070678_1001968702 | 304 |
| 281 | 3300005457 | Ga0070662_100054794 | Ga0070662_1000547942 | 304 |
| 282 | 3300005457 | Ga0070662_100062034 | Ga0070662_1000620343 | 304 |
| 283 | 3300005459 | Ga0068867_100000191 | Ga0068867_10000019122 | 304 |
| 284 | 3300005466 | Ga0070685_10017750 | Ga0070685_100177502 | 304 |
| 285 | 3300005466 | Ga0070685_10024345 | Ga0070685_100243453 | 304 |
| 286 | 3300005535 | Ga0070684_100034577 | Ga0070684_1000345773 | 304 |
| 287 | 3300005535 | Ga0070684_100172039 | Ga0070684_1001720392 | 304 |
| 288 | 3300005539 | Ga0068853_100009633 | Ga0068853_1000096337 | 304 |
| 289 | 3300005539 | Ga0068853_100038715 | Ga0068853_1000387153 | 304 |
| 290 | 3300005543 | Ga0070672_100103955 | Ga0070672_1001039552 | 304 |
| 291 | 3300005544 | Ga0070686_100000103 | Ga0070686_10000010321 | 304 |
| 292 | 3300005545 | Ga0070695_100019666 | Ga0070695_1000196663 | 304 |
| 293 | 3300005547 | Ga0070693_100015766 | Ga0070693_1000157661 | 304 |
| 294 | 3300005549 | Ga0070704_100024201 | Ga0070704_1000242012 | 304 |
| 295 | 3300005563 | Ga0068855_100041737 | Ga0068855_1000417374 | 304 |
| 296 | 3300005563 | Ga0068855_100168578 | Ga0068855_1001685782 | 304 |
| 297 | 3300005564 | Ga0070664_100026911 | Ga0070664_1000269113 | 304 |
| 298 | 3300005564 | Ga0070664_100095623 | Ga0070664_1000956232 | 304 |
| 299 | 3300005564 | Ga0070664_100161563 | Ga0070664_1001615633 | 304 |
| 300 | 3300005578 | Ga0068854_100095494 | Ga0068854_1000954943 | 304 |
| 301 | 3300005578 | Ga0068854_100153274 | Ga0068854_1001532741 | 304 |
| 302 | 3300005578 | Ga0068854_100296856 | Ga0068854_1002968562 | 304 |
| 303 | 3300005614 | Ga0068856_100014048 | Ga0068856_1000140482 | 304 |
| 304 | 3300005614 | Ga0068856_100267596 | Ga0068856_1002675963 | 304 |
| 305 | 3300005614 | Ga0068856_100289712 | Ga0068856_1002897122 | 304 |
| 306 | 3300005615 | Ga0070702_100000081 | Ga0070702_10000008121 | 304 |
| 307 | 3300005615 | Ga0070702_100116519 | Ga0070702_1001165191 | 304 |
| 308 | 3300005616 | Ga0068852_100010121 | Ga0068852_1000101217 | 304 |
| 309 | 3300005616 | Ga0068852_100048149 | Ga0068852_1000481493 | 304 |
| 310 | 3300005616 | Ga0068852_100205635 | Ga0068852_1002056352 | 304 |
| 311 | 3300005617 | Ga0068859_100000560 | Ga0068859_10000056024 | 304 |
| 312 | 3300005617 | Ga0068859_100042950 | Ga0068859_1000429502 | 304 |
| 313 | 3300005618 | Ga0068864_100000895 | Ga0068864_10000089511 | 304 |
| 314 | 3300005618 | Ga0068864_100017183 | Ga0068864_1000171833 | 304 |
| 315 | 3300005618 | Ga0068864_100021458 | Ga0068864_1000214583 | 304 |
| 316 | 3300005618 | Ga0068864_100027849 | Ga0068864_1000278494 | 304 |
| 317 | 3300005618 | Ga0068864_100045997 | Ga0068864_1000459973 | 304 |
| 318 | 3300005718 | Ga0068866_10000201 | Ga0068866_1000020123 | 304 |
| 319 | 3300005718 | Ga0068866_10015962 | Ga0068866_100159622 | 304 |
| 320 | 3300005718 | Ga0068866_10151419 | Ga0068866_101514192 | 304 |
| 321 | 3300005719 | Ga0068861_100032122 | Ga0068861_1000321222 | 304 |
| 322 | 3300005719 | Ga0068861_100175058 | Ga0068861_1001750582 | 304 |
| 323 | 3300005719 | Ga0068861_100245673 | Ga0068861_1002456732 | 304 |
| 324 | 3300005834 | Ga0068851_10013154 | Ga0068851_100131543 | 304 |
| 325 | 3300005834 | Ga0068851_10138061 | Ga0068851_101380612 | 304 |
| 326 | 3300005840 | Ga0068870_10002727 | Ga0068870_100027272 | 304 |
| 327 | 3300005841 | Ga0068863_100094258 | Ga0068863_1000942583 | 304 |
| 328 | 3300005841 | Ga0068863_100231486 | Ga0068863_1002314862 | 304 |
| 329 | 3300005842 | Ga0068858_100000455 | Ga0068858_10000045520 | 304 |
| 330 | 3300005842 | Ga0068858_100000721 | Ga0068858_1000007217 | 304 |
| 331 | 3300005842 | Ga0068858_100039426 | Ga0068858_1000394262 | 304 |
| 332 | 3300005842 | Ga0068858_100101201 | Ga0068858_1001012011 | 304 |
| 333 | 3300005842 | Ga0068858_100216887 | Ga0068858_1002168872 | 304 |
| 334 | 3300005843 | Ga0068860_100001308 | Ga0068860_10000130817 | 304 |
| 335 | 3300005843 | Ga0068860_100147216 | Ga0068860_1001472163 | 304 |
| 336 | 3300005843 | Ga0068860_100338034 | Ga0068860_1003380342 | 304 |
| 337 | 3300005844 | Ga0068862_100003224 | Ga0068862_1000032243 | 304 |
| 338 | 3300005844 | Ga0068862_100154745 | Ga0068862_1001547452 | 304 |
| 339 | 3300005844 | Ga0068862_100158895 | Ga0068862_1001588952 | 304 |
| 340 | 3300005844 | Ga0068862_100188914 | Ga0068862_1001889143 | 304 |
| 341 | 3300006177 | Ga0075362_10189052 | Ga0075362_101890521 | 304 |
| 342 | 3300006237 | Ga0097621_100007342 | Ga0097621_1000073427 | 304 |
| 343 | 3300006237 | Ga0097621_100158999 | Ga0097621_1001589992 | 304 |
| 344 | 3300006237 | Ga0097621_100172735 | Ga0097621_1001727353 | 304 |
| 345 | 3300006358 | Ga0068871_100003664 | Ga0068871_1000036648 | 304 |
| 346 | 3300006358 | Ga0068871_100026970 | Ga0068871_1000269703 | 304 |
| 347 | 3300006358 | Ga0068871_100033926 | Ga0068871_1000339262 | 304 |
| 348 | 3300006846 | Ga0075430_100109317 | Ga0075430_1001093172 | 304 |
| 349 | 3300006880 | Ga0075429_100001832 | Ga0075429_1000018328 | 304 |
| 350 | 3300006881 | Ga0068865_100000113 | Ga0068865_10000011320 | 304 |
| 351 | 3300006931 | Ga0097620_100000560 | Ga0097620_10000056024 | 304 |
| 352 | 3300006931 | Ga0097620_100042953 | Ga0097620_1000429532 | 304 |
| 353 | 3300006946 | Ga0079104_1000037 | Ga0079104_10000378 | 304 |
| 354 | 3300009092 | Ga0105250_10005204 | Ga0105250_100052043 | 304 |
| 355 | 3300009093 | Ga0105240_10006593 | Ga0105240_1000659313 | 304 |
| 356 | 3300009093 | Ga0105240_10412254 | Ga0105240_104122542 | 304 |
| 357 | 3300009094 | Ga0111539_10150637 | Ga0111539_101506374 | 304 |
| 358 | 3300009098 | Ga0105245_10000681 | Ga0105245_100006818 | 304 |
| 359 | 3300009147 | Ga0114129_11057768 | Ga0114129_110577681 | 304 |
| 360 | 3300009148 | Ga0105243_10001082 | Ga0105243_1000108219 | 304 |
| 361 | 3300009176 | Ga0105242_10059715 | Ga0105242_100597153 | 304 |
| 362 | 3300009177 | Ga0105248_10000507 | Ga0105248_100005071 | 304 |
| 363 | 3300009177 | Ga0105248_10006243 | Ga0105248_100062437 | 304 |
| 364 | 3300009177 | Ga0105248_10015929 | Ga0105248_100159294 | 304 |
| 365 | 3300009545 | Ga0105237_10000293 | Ga0105237_1000029318 | 304 |
| 366 | 3300009551 | Ga0105238_10002472 | Ga0105238_100024725 | 304 |
| 367 | 3300009551 | Ga0105238_10056225 | Ga0105238_100562252 | 304 |
| 368 | 3300010375 | Ga0105239_10002229 | Ga0105239_1000222912 | 304 |
| 369 | 3300010375 | Ga0105239_10041884 | Ga0105239_100418844 | 304 |
| 370 | 3300011119 | Ga0105246_10137644 | Ga0105246_101376442 | 304 |
| 371 | 3300013105 | Ga0157369_10045523 | Ga0157369_100455234 | 304 |
| 372 | 3300013296 | Ga0157374_10007912 | Ga0157374_100079128 | 304 |
| 373 | 3300013296 | Ga0157374_10044586 | Ga0157374_100445864 | 304 |
| 374 | 3300013297 | Ga0157378_10000357 | Ga0157378_1000035724 | 304 |
| 375 | 3300013297 | Ga0157378_10091957 | Ga0157378_100919574 | 304 |
| 376 | 3300013306 | Ga0163162_10032428 | Ga0163162_100324284 | 304 |
| 377 | 3300013307 | Ga0157372_10060660 | Ga0157372_100606602 | 304 |
| 378 | 3300013308 | Ga0157375_10068089 | Ga0157375_100680892 | 304 |
| 379 | 3300013308 | Ga0157375_10072962 | Ga0157375_100729623 | 304 |
| 380 | 3300013308 | Ga0157375_10107087 | Ga0157375_101070874 | 304 |
| 381 | 3300013308 | Ga0157375_10161038 | Ga0157375_101610382 | 304 |
| 382 | 3300014325 | Ga0163163_10010737 | Ga0163163_100107371 | 304 |
| 383 | 3300014325 | Ga0163163_10100097 | Ga0163163_101000972 | 304 |
| 384 | 3300014745 | Ga0157377_10000851 | Ga0157377_100008517 | 304 |
| 385 | 3300014745 | Ga0157377_10021594 | Ga0157377_100215942 | 304 |
| 386 | 3300014968 | Ga0157379_10007924 | Ga0157379_100079245 | 304 |
| 387 | 3300014968 | Ga0157379_10016573 | Ga0157379_100165733 | 304 |
| 388 | 3300014968 | Ga0157379_10054497 | Ga0157379_100544972 | 304 |
| 389 | 3300014968 | Ga0157379_10135800 | Ga0157379_101358003 | 304 |
| 390 | 3300014968 | Ga0157379_10145880 | Ga0157379_101458802 | 304 |
| 391 | 3300014969 | Ga0157376_10006028 | Ga0157376_100060288 | 304 |
| 392 | 3300014969 | Ga0157376_10037673 | Ga0157376_100376732 | 304 |
| 393 | 3300014969 | Ga0157376_10249327 | Ga0157376_102493273 | 304 |
| 394 | 3300014969 | Ga0157376_10366103 | Ga0157376_103661032 | 304 |
| 395 | 3300021361 | Ga0213872_10000007 | Ga0213872_10000007196 | 304 |
| 396 | 3300021361 | Ga0213872_10001260 | Ga0213872_100012609 | 304 |
| 397 | 3300025290 | Ga0207673_1003014 | Ga0207673_10030142 | 304 |
| 398 | 3300025304 | Ga0209257_1040921 | Ga0209257_10409211 | 304 |
| 399 | 3300025315 | Ga0207697_10004453 | Ga0207697_100044533 | 304 |
| 400 | 3300025321 | Ga0207656_10017279 | Ga0207656_100172792 | 304 |
| 401 | 3300025711 | Ga0207696_1006923 | Ga0207696_10069233 | 304 |
| 402 | 3300025893 | Ga0207682_10000900 | Ga0207682_1000090011 | 304 |
| 403 | 3300025901 | Ga0207688_10012874 | Ga0207688_100128743 | 304 |
| 404 | 3300025903 | Ga0207680_10001992 | Ga0207680_100019929 | 304 |
| 405 | 3300025907 | Ga0207645_10086051 | Ga0207645_100860512 | 304 |
| 406 | 3300025907 | Ga0207645_10099664 | Ga0207645_100996642 | 304 |
| 407 | 3300025908 | Ga0207643_10002587 | Ga0207643_100025875 | 304 |
| 408 | 3300025908 | Ga0207643_10005660 | Ga0207643_100056607 | 304 |
| 409 | 3300025909 | Ga0207705_10013870 | Ga0207705_100138705 | 304 |
| 410 | 3300025911 | Ga0207654_10252630 | Ga0207654_102526302 | 304 |
| 411 | 3300025913 | Ga0207695_10028942 | Ga0207695_100289421 | 304 |
| 412 | 3300025914 | Ga0207671_10012562 | Ga0207671_100125623 | 304 |
| 413 | 3300025917 | Ga0207660_10230092 | Ga0207660_102300922 | 304 |
| 414 | 3300025918 | Ga0207662_10101705 | Ga0207662_101017052 | 304 |
| 415 | 3300025918 | Ga0207662_10188706 | Ga0207662_101887061 | 304 |
| 416 | 3300025919 | Ga0207657_10011645 | Ga0207657_100116458 | 304 |
| 417 | 3300025919 | Ga0207657_10097491 | Ga0207657_100974912 | 304 |
| 418 | 3300025919 | Ga0207657_10115989 | Ga0207657_101159892 | 304 |
| 419 | 3300025920 | Ga0207649_10030192 | Ga0207649_100301922 | 304 |
| 420 | 3300025920 | Ga0207649_10328739 | Ga0207649_103287392 | 304 |
| 421 | 3300025924 | Ga0207694_10028093 | Ga0207694_100280933 | 304 |
| 422 | 3300025924 | Ga0207694_10066315 | Ga0207694_100663152 | 304 |
| 423 | 3300025925 | Ga0207650_10056101 | Ga0207650_100561014 | 304 |
| 424 | 3300025926 | Ga0207659_10042734 | Ga0207659_100427342 | 304 |
| 425 | 3300025926 | Ga0207659_10069001 | Ga0207659_100690014 | 304 |
| 426 | 3300025926 | Ga0207659_10154317 | Ga0207659_101543172 | 304 |
| 427 | 3300025927 | Ga0207687_10005916 | Ga0207687_100059168 | 304 |
| 428 | 3300025931 | Ga0207644_10036291 | Ga0207644_100362913 | 304 |
| 429 | 3300025931 | Ga0207644_10107729 | Ga0207644_101077292 | 304 |
| 430 | 3300025931 | Ga0207644_10155410 | Ga0207644_101554102 | 304 |
| 431 | 3300025932 | Ga0207690_10242182 | Ga0207690_102421822 | 304 |
| 432 | 3300025933 | Ga0207706_10001422 | Ga0207706_100014227 | 304 |
| 433 | 3300025933 | Ga0207706_10009838 | Ga0207706_100098384 | 304 |
| 434 | 3300025934 | Ga0207686_10000084 | Ga0207686_100000848 | 304 |
| 435 | 3300025935 | Ga0207709_10001923 | Ga0207709_100019233 | 304 |
| 436 | 3300025935 | Ga0207709_10004553 | Ga0207709_100045534 | 304 |
| 437 | 3300025935 | Ga0207709_10142260 | Ga0207709_101422602 | 304 |
| 438 | 3300025936 | Ga0207670_10109945 | Ga0207670_101099452 | 304 |
| 439 | 3300025937 | Ga0207669_10155549 | Ga0207669_101555493 | 304 |
| 440 | 3300025938 | Ga0207704_10000166 | Ga0207704_1000016623 | 304 |
| 441 | 3300025938 | Ga0207704_10028245 | Ga0207704_100282452 | 304 |
| 442 | 3300025940 | Ga0207691_10016296 | Ga0207691_100162965 | 304 |
| 443 | 3300025940 | Ga0207691_10097893 | Ga0207691_100978931 | 304 |
| 444 | 3300025940 | Ga0207691_10316187 | Ga0207691_103161871 | 304 |
| 445 | 3300025941 | Ga0207711_10014573 | Ga0207711_100145733 | 304 |
| 446 | 3300025941 | Ga0207711_10038891 | Ga0207711_100388915 | 304 |
| 447 | 3300025941 | Ga0207711_10067741 | Ga0207711_100677414 | 304 |
| 448 | 3300025942 | Ga0207689_10000272 | Ga0207689_1000027223 | 304 |
| 449 | 3300025942 | Ga0207689_10000937 | Ga0207689_1000093710 | 304 |
| 450 | 3300025942 | Ga0207689_10001248 | Ga0207689_1000124819 | 304 |
| 451 | 3300025944 | Ga0207661_10029460 | Ga0207661_100294603 | 304 |
| 452 | 3300025944 | Ga0207661_10211006 | Ga0207661_102110061 | 304 |
| 453 | 3300025945 | Ga0207679_10015894 | Ga0207679_100158943 | 304 |
| 454 | 3300025945 | Ga0207679_10104017 | Ga0207679_101040172 | 304 |
| 455 | 3300025945 | Ga0207679_10185065 | Ga0207679_101850651 | 304 |
| 456 | 3300025949 | Ga0207667_10113456 | Ga0207667_101134562 | 304 |
| 457 | 3300025949 | Ga0207667_10563682 | Ga0207667_105636821 | 304 |
| 458 | 3300025960 | Ga0207651_10037473 | Ga0207651_100374733 | 304 |
| 459 | 3300025972 | Ga0207668_10133598 | Ga0207668_101335982 | 304 |
| 460 | 3300025981 | Ga0207640_10006595 | Ga0207640_100065953 | 304 |
| 461 | 3300025981 | Ga0207640_10021609 | Ga0207640_100216092 | 304 |
| 462 | 3300025986 | Ga0207658_10006686 | Ga0207658_100066867 | 304 |
| 463 | 3300025986 | Ga0207658_10091873 | Ga0207658_100918732 | 304 |
| 464 | 3300026023 | Ga0207677_10033837 | Ga0207677_100338373 | 304 |
| 465 | 3300026023 | Ga0207677_10314858 | Ga0207677_103148581 | 304 |
| 466 | 3300026035 | Ga0207703_10000375 | Ga0207703_1000037529 | 304 |
| 467 | 3300026035 | Ga0207703_10015188 | Ga0207703_100151883 | 304 |
| 468 | 3300026035 | Ga0207703_10019666 | Ga0207703_100196662 | 304 |
| 469 | 3300026035 | Ga0207703_10070368 | Ga0207703_100703682 | 304 |
| 470 | 3300026041 | Ga0207639_10091865 | Ga0207639_100918651 | 304 |
| 471 | 3300026041 | Ga0207639_10252212 | Ga0207639_102522122 | 304 |
| 472 | 3300026067 | Ga0207678_10000711 | Ga0207678_1000071125 | 304 |
| 473 | 3300026067 | Ga0207678_10003317 | Ga0207678_100033175 | 304 |
| 474 | 3300026067 | Ga0207678_10009807 | Ga0207678_100098072 | 304 |
| 475 | 3300026067 | Ga0207678_10317485 | Ga0207678_103174851 | 304 |
| 476 | 3300026075 | Ga0207708_10000134 | Ga0207708_1000013422 | 304 |
| 477 | 3300026075 | Ga0207708_10000749 | Ga0207708_100007493 | 304 |
| 478 | 3300026078 | Ga0207702_10010113 | Ga0207702_100101136 | 304 |
| 479 | 3300026078 | Ga0207702_10089243 | Ga0207702_100892432 | 304 |
| 480 | 3300026088 | Ga0207641_10019018 | Ga0207641_100190187 | 304 |
| 481 | 3300026088 | Ga0207641_10510520 | Ga0207641_105105201 | 304 |
| 482 | 3300026089 | Ga0207648_10000433 | Ga0207648_1000043324 | 304 |
| 483 | 3300026089 | Ga0207648_10002680 | Ga0207648_1000268016 | 304 |
| 484 | 3300026095 | Ga0207676_10010703 | Ga0207676_100107032 | 304 |
| 485 | 3300026095 | Ga0207676_10051785 | Ga0207676_100517854 | 304 |
| 486 | 3300026095 | Ga0207676_10062591 | Ga0207676_100625912 | 304 |
| 487 | 3300026095 | Ga0207676_10517730 | Ga0207676_105177302 | 304 |
| 488 | 3300026116 | Ga0207674_10026211 | Ga0207674_100262112 | 304 |
| 489 | 3300026116 | Ga0207674_10328098 | Ga0207674_103280982 | 304 |
| 490 | 3300026118 | Ga0207675_100000490 | Ga0207675_10000049017 | 304 |
| 491 | 3300026118 | Ga0207675_100002302 | Ga0207675_1000023027 | 304 |
| 492 | 3300026118 | Ga0207675_100026407 | Ga0207675_1000264075 | 304 |
| 493 | 3300026121 | Ga0207683_10005797 | Ga0207683_100057976 | 304 |
| 494 | 3300026121 | Ga0207683_10012464 | Ga0207683_100124646 | 304 |
| 495 | 3300026121 | Ga0207683_10166311 | Ga0207683_101663112 | 304 |
| 496 | 3300026142 | Ga0207698_10002753 | Ga0207698_100027535 | 304 |
| 497 | 3300026142 | Ga0207698_10247142 | Ga0207698_102471421 | 304 |
| 498 | 3300027111 | Ga0209281_1000002 | Ga0209281_1000002792 | 304 |
| 499 | 3300027665 | Ga0209983_1018933 | Ga0209983_10189332 | 304 |
| 500 | 3300028379 | Ga0268266_10164311 | Ga0268266_101643113 | 304 |
| 501 | 3300028379 | Ga0268266_10429243 | Ga0268266_104292431 | 304 |
| 502 | 3300028380 | Ga0268265_10010067 | Ga0268265_100100673 | 304 |
| 503 | 3300028380 | Ga0268265_10135597 | Ga0268265_101355972 | 304 |
| 504 | 3300028381 | Ga0268264_10004638 | Ga0268264_100046388 | 304 |
| 505 | 3300028794 | Ga0307515_10027638 | Ga0307515_100276387 | 304 |
| 506 | 3300031507 | Ga0307509_10062175 | Ga0307509_100621753 | 304 |
| 507 | 3300031548 | Ga0307408_100004119 | Ga0307408_1000041195 | 304 |
| 508 | 3300031649 | Ga0307514_10000355 | Ga0307514_1000035577 | 304 |
| 509 | 3300031691 | Ga0316579_10001716 | Ga0316579_100017162 | 304 |
| 510 | 3300031728 | Ga0316578_10014936 | Ga0316578_100149361 | 304 |
| 511 | 3300031730 | Ga0307516_10171053 | Ga0307516_101710531 | 304 |
| 512 | 3300031901 | Ga0307406_10003644 | Ga0307406_100036444 | 304 |
| 513 | 3300031911 | Ga0307412_10172533 | Ga0307412_101725332 | 304 |
| 514 | 3300032002 | Ga0307416_100326714 | Ga0307416_1003267142 | 304 |
| 515 | 3300035170 | Ga0373943_0130977 | Ga0373943_0130977_240_1160 | 304 |
| 516 | 3300035691 | Ga0373931_0000882 | Ga0373931_0000882_8602_9522 | 304 |
| 517 | 3300035691 | Ga0373931_0056926 | Ga0373931_0056926_555_1475 | 304 |
| 518 | 3300035695 | Ga0373927_0119654 | Ga0373927_0119654_646_1563 | 304 |
| 519 | 3300036401 | Ga0373937_0186202 | Ga0373937_0186202_758_1678 | 304 |
| 520 | 3300036647 | Ga0316582_0011481 | Ga0316582_0011481_1330_2250 | 304 |
| 521 | 3300037068 | Ga0373925_0073937 | Ga0373925_0073937_474_1391 | 304 |
| 522 | 3300037068 | Ga0373925_0157574 | Ga0373925_0157574_591_1511 | 304 |
| 523 | 3300037471 | Ga0395905_0001659 | Ga0395905_0001659_15935_16852 | 304 |
| 524 | 3300037471 | Ga0395905_0053160 | Ga0395905_0053160_1805_2728 | 304 |
| 525 | 3300039447 | Ga0436361_0021397 | Ga0436361_0021397_39063_39980 | 304 |
| 526 | 3300039447 | Ga0436361_0163583 | Ga0436361_0163583_30820_31734 | 304 |
| 527 | 3300039447 | Ga0436361_0694318 | Ga0436361_0694318_10264_11190 | 304 |
| 528 | 3300042435 | Ga0439434_0053546 | Ga0439434_0053546_271_1197 | 304 |
| 529 | 3300042531 | Ga0450918_000419 | Ga0450918_000419_2316_3236 | 304 |
| 530 | 3300042532 | Ga0450893_0009516 | Ga0450893_0009516_330_1256 | 304 |
| 531 | 3300042876 | Ga0451577_0003355 | Ga0451577_0003355_15406_16368 | 304 |
| 532 | 3300042876 | Ga0451577_0011238 | Ga0451577_0011238_7378_8298 | 304 |
| 533 | 3300044712 | Ga0453684_0098650 | Ga0453684_0098650_1222_2139 | 304 |
| 534 | 3300046454 | Ga0495592_0000307 | Ga0495592_0000307_30761_31681 | 304 |
| 535 | 3300046457 | Ga0495590_0001456 | Ga0495590_0001456_342_1259 | 304 |
| 536 | 3300046542 | Ga0495597_0000054 | Ga0495597_0000054_70949_71866 | 304 |
| 537 | 3300046558 | Ga0495633_0001764 | Ga0495633_0001764_220_1137 | 304 |
| 538 | 3300046681 | Ga0495647_0048038 | Ga0495647_0048038_350_1267 | 304 |
| 539 | 3300048903 | Ga0496100_0119952 | Ga0496100_0119952_279_1199 | 304 |
| 540 | 3300048904 | Ga0496101_0035120 | Ga0496101_0035120_2523_3443 | 304 |
| 541 | 3300048904 | Ga0496101_0138814 | Ga0496101_0138814_867_1787 | 304 |
| 542 | 3300048905 | Ga0496102_0012909 | Ga0496102_0012909_203_1123 | 304 |
| 543 | 3300048905 | Ga0496102_0352231 | Ga0496102_0352231_329_1249 | 304 |
| 544 | 3300048907 | Ga0496104_0077458 | Ga0496104_0077458_1946_2866 | 304 |
| 545 | 3300048907 | Ga0496104_0362256 | Ga0496104_0362256_394_1314 | 304 |
| 546 | 3300048908 | Ga0496105_0031152 | Ga0496105_0031152_2633_3550 | 304 |
| 547 | 3300048908 | Ga0496105_0220206 | Ga0496105_0220206_595_1515 | 304 |
| 548 | 3300048909 | Ga0496106_0023412 | Ga0496106_0023412_2076_2996 | 304 |
| 549 | 3300048909 | Ga0496106_0063643 | Ga0496106_0063643_1607_2527 | 304 |
| 550 | 3300048910 | Ga0496107_0073536 | Ga0496107_0073536_1537_2457 | 304 |
| 551 | 3300048910 | Ga0496107_0241731 | Ga0496107_0241731_352_1272 | 304 |
| 552 | 3300048911 | Ga0496108_0096804 | Ga0496108_0096804_595_1515 | 304 |
| 553 | 3300048912 | Ga0496109_0027726 | Ga0496109_0027726_2308_3228 | 304 |
| 554 | 3300048912 | Ga0496109_0084402 | Ga0496109_0084402_437_1357 | 304 |
| 555 | 3300048913 | Ga0496110_0058616 | Ga0496110_0058616_1780_2700 | 304 |
| 556 | 3300048913 | Ga0496110_0110927 | Ga0496110_0110927_58_978 | 304 |
| 557 | 3300048914 | Ga0496111_0111703 | Ga0496111_0111703_754_1674 | 304 |
| 558 | 3300048915 | Ga0496112_0110815 | Ga0496112_0110815_1274_2194 | 304 |
| 559 | 3300048915 | Ga0496112_0394269 | Ga0496112_0394269_119_1036 | 304 |
| 560 | 3300048917 | Ga0496114_0035179 | Ga0496114_0035179_2644_3564 | 304 |
| 561 | 3300048917 | Ga0496114_0172549 | Ga0496114_0172549_353_1270 | 304 |
| 562 | 3300048917 | Ga0496114_0466587 | Ga0496114_0466587_149_1069 | 304 |
| 563 | 3300048918 | Ga0496115_0038526 | Ga0496115_0038526_1833_2753 | 304 |
| 564 | 3300049515 | Ga0501292_006324 | Ga0501292_006324_351_1271 | 304 |
| 565 | 3300049571 | Ga0501034_0306624 | Ga0501034_0306624_133_1050 | 304 |
| 566 | 3300049579 | Ga0501043_0000012 | Ga0501043_0000012_89050_89970 | 304 |
| 567 | 3300049580 | Ga0501046_0000030 | Ga0501046_0000030_89022_89942 | 304 |
| 568 | 3300049581 | Ga0501047_0000049 | Ga0501047_0000049_63719_64639 | 304 |
| 569 | 3300049582 | Ga0501048_0000082 | Ga0501048_0000082_40381_41301 | 304 |
| 570 | 3300049658 | Ga0501211_001400 | Ga0501211_001400_1552_2466 | 304 |
| 571 | 3300049744 | Ga0501083_0010638 | Ga0501083_0010638_2724_3644 | 304 |
| 572 | 3300049764 | Ga0501267_000300 | Ga0501267_000300_934_1848 | 304 |
| 573 | 3300049823 | Ga0501044_0180647 | Ga0501044_0180647_912_1832 | 304 |
| 574 | 3300049824 | Ga0501045_0003743 | Ga0501045_0003743_6530_7450 | 304 |
| 575 | 3300050493 | nmdc:mga0k408_158154_c1 | nmdc:mga0k408_158154_c1_25_945 | 304 |
| 576 | 3300050508 | nmdc:mga09592_1124_c1 | nmdc:mga09592_1124_c1_18888_19808 | 304 |
| 577 | 3300050509 | nmdc:mga0qj67_290918_c1 | nmdc:mga0qj67_290918_c1_164_1084 | 304 |
| 578 | 3300059421 | Ga0590071_028275 | Ga0590071_028275_187_1113 | 304 |
| 579 | 3300059424 | Ga0590075_006183 | Ga0590075_006183_617_1543 | 304 |
| 580 | 2162886007 | SwRhRL2b_contig_1290167 | SwRhRL2b_0183.00003660 | 305 |
| 581 | 3300005289 | Ga0065704_10004249 | Ga0065704_100042497 | 305 |
| 582 | 3300005548 | Ga0070665_100061618 | Ga0070665_1000616182 | 305 |
| 583 | 3300048924 | Ga0496121_0001278 | Ga0496121_0001278_31884_32801 | 305 |
| 584 | 3300048927 | Ga0496124_0074561 | Ga0496124_0074561_508_1425 | 305 |
| 585 | 3300048928 | Ga0496125_0107227 | Ga0496125_0107227_121_1038 | 305 |
| 586 | 3300048929 | Ga0496126_0029704 | Ga0496126_0029704_2270_3187 | 305 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3x43-assembly2.cif.gz_H | crystal structure of o-ureido-l-serine synthase | 0.9587 | 1 | 298 |
| 3x44-assembly1.cif.gz_A | crystal structure of o-ureido-l-serine-bound k43a mutant of o-ureido-l-serine synthase | 0.957 | 1 | 299 |
| 1o58-assembly1.cif.gz_D | crystal structure of o-acetylserine sulfhydrylase (tm0665) from thermotoga maritima at 1.80 a resolution | 0.9564 | 6 | 299 |
| 3fca-assembly1.cif.gz_A | genetic incorporation of a metal-ion chelating amino acid into proteins as biophysical probe | 0.9542 | 5 | 299 |
| 1o58-assembly1.cif.gz_B | crystal structure of o-acetylserine sulfhydrylase (tm0665) from thermotoga maritima at 1.80 a resolution | 0.9525 | 6 | 299 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0V4_40_140_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9667 | 43 | 143 | 3.40.50.1100 |
| 5b1iC02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9605 | 42 | 139 | 3.40.50.1100 |
| af_K7L749_14_232_2.10.25.10 | Mainly Beta;Ribbon;Laminin;Laminin | 0.958 | 10 | 233 | 2.10.25.10 |
| 3dkiB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9547 | 42 | 151 | 3.40.50.1100 |
| 1j6nA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9532 | 156 | 299 | 3.40.50.1100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y4J7I4-F1-model_v4 | deleted | 0.9897 | 41 | 183 |
|
| AF-A0A257NPR7-F1-model_v4 | Cysteine synthase (EC 2.5.1.47) | 0.9834 | 1 | 305 |
GO:0004124
GO:0006535 |
| AF-A0A3M6QIX4-F1-model_v4 | Cysteine synthase (EC 2.5.1.47) | 0.9822 | 1 | 305 |
GO:0004124
GO:0006535 |
| AF-A0A7Y0NM23-F1-model_v4 | deleted | 0.9819 | 1 | 303 |
|
| AF-A0A259KJR6-F1-model_v4 | Cysteine synthase (EC 2.5.1.47) | 0.9818 | 1 | 305 |
GO:0004124
GO:0006535 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar