F466532

General Info

Members Datasets Scaffolds Average Seq Length
586 272 571 302

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100061618|Ga0070665_1000616182
Length 305
Sequence MKASSILETIGNTPHIRVNRLFGDAEVWIKSERTNPGGSIKDRIALAMIEAAEASGDLKPGGTIIEPTSGNTGVGLAMVAAVKGYRLILVMPESMSVERRRLMLAYGASFDLTPREKGMKGAIERALELVDQTPNSWMPQQFENPANIDVHVRTTAQEIAADFADAPIDVLITGVGTGGHITGVAQVLKQLWPQLKVYAVEPTLSHVISGGQPGPHPIQGIGAGFIPANLHTQLLDGVIQVDPADAKDYARRAASEEGVLVGISSGATLAAIAQKLKELPAGSRVLGFNYDTGERYLSVPDFLPE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
5 2643221570 Acidovorax sp. Root568 Isolate Unclassified
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
8 2643221652 Acidovorax sp. Root402 Isolate Unclassified
9 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
10 2643221656 Pelomonas sp. Root405 Isolate Unclassified
11 2643221717 Acidovorax sp. Root267 Isolate Unclassified
12 2721755523 Delftia sp. HK171 Isolate Unclassified
13 2738541337 Pelomonas sp. BT06 Isolate Unclassified
14 2738543012 Acidovorax sp. CF301 Isolate Unclassified
15 2816332133 Acidovorax radicis 2721A Isolate Unclassified
16 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
171 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
179 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
186 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
187 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
201 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
214 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
215 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
216 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
217 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
218 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
219 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
228 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
258 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
259 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
269 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
270 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
271 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
272 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 0
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.39
Nodule 0.34
Rhizoplane 4.61
Rhizosphere 85.67
Stem 0
Stem Tuber 0
Unclassified 7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1290167 2162886007 Bacteria 2108
2 JGI24744J21845_10025542 3300002077 Bacteria 1151
3 Ga0065704_10004249 3300005289 Bacteria 9032
4 Ga0065712_10196714 3300005290 Bacteria 1125
5 Ga0070658_10011079 3300005327 Bacteria 7229
6 Ga0070658_10226082 3300005327 Bacteria 1584
7 Ga0070676_10053682 3300005328 Bacteria 2375
8 Ga0070676_10080888 3300005328 Bacteria 1971
9 Ga0070676_10140985 3300005328 Bacteria 1534
10 Ga0070683_100015058 3300005329 Bacteria 6785
11 Ga0070683_100173049 3300005329 Bacteria 2049
12 Ga0070690_100000651 3300005330 Bacteria 17695
13 Ga0070690_100070631 3300005330 Bacteria 2268
14 Ga0070690_100097736 3300005330 Bacteria 1943
15 Ga0070690_100169986 3300005330 Bacteria 1499
16 Ga0070670_100034239 3300005331 Bacteria 4371
17 Ga0070670_100060997 3300005331 Bacteria 3238
18 Ga0070670_100080639 3300005331 Bacteria 2796
19 Ga0070670_100093079 3300005331 Bacteria 2592
20 Ga0070677_10009793 3300005333 Bacteria 3260
21 Ga0070677_10083012 3300005333 Bacteria 1375
22 Ga0068869_100001401 3300005334 Bacteria 14244
23 Ga0068869_100005873 3300005334 Bacteria 7751
24 Ga0068869_100039477 3300005334 Bacteria 3370
25 Ga0068869_100044338 3300005334 Bacteria 3198
26 Ga0070680_100036578 3300005336 Bacteria 3966
27 Ga0070682_100078844 3300005337 Bacteria 2126
28 Ga0068868_100000439 3300005338 Bacteria 27952
29 Ga0068868_100006871 3300005338 Bacteria 8081
30 Ga0068868_100027204 3300005338 Bacteria 4362
31 Ga0068868_100030921 3300005338 Bacteria 4108
32 Ga0068868_100109092 3300005338 Bacteria 2247
33 Ga0068868_100163336 3300005338 Bacteria 1841
34 Ga0070660_100171670 3300005339 Bacteria 1752
35 Ga0070689_100001789 3300005340 Bacteria 13808
36 Ga0070689_100022218 3300005340 Bacteria 4735
37 Ga0070689_100066063 3300005340 Bacteria 2818
38 Ga0070689_100135304 3300005340 Bacteria 1979
39 Ga0070691_10006175 3300005341 Bacteria 5467
40 Ga0070687_100039502 3300005343 Bacteria 2372
41 Ga0070687_100089292 3300005343 Bacteria 1701
42 Ga0070687_100092633 3300005343 Bacteria 1675
43 Ga0070661_100005385 3300005344 Bacteria 8821
44 Ga0070661_100061902 3300005344 Bacteria 2747
45 Ga0070661_100087494 3300005344 Bacteria 2304
46 Ga0070669_100022578 3300005353 Bacteria 4499
47 Ga0070675_100001927 3300005354 Bacteria 15350
48 Ga0070675_100002165 3300005354 Bacteria 14527
49 Ga0070675_100003623 3300005354 Bacteria 11751
50 Ga0070675_100020207 3300005354 Bacteria 5314
51 Ga0070675_100046382 3300005354 Bacteria 3558
52 Ga0070671_100031280 3300005355 Bacteria 4395
53 Ga0070671_100039634 3300005355 Bacteria 3910
54 Ga0070671_100041682 3300005355 Bacteria 3815
55 Ga0070671_100098487 3300005355 Bacteria 2453
56 Ga0070674_100014881 3300005356 Bacteria 4843
57 Ga0070674_100037159 3300005356 Bacteria 3274
58 Ga0070674_100040856 3300005356 Bacteria 3139
59 Ga0070674_100159859 3300005356 Bacteria 1708
60 Ga0070673_100013975 3300005364 Bacteria 5575
61 Ga0070688_100011889 3300005365 Bacteria 4858
62 Ga0070659_100022263 3300005366 Bacteria 4836
63 Ga0070659_100068909 3300005366 Bacteria 2807
64 Ga0070659_100236894 3300005366 Bacteria 1509
65 Ga0070667_100000219 3300005367 Bacteria 66264
66 Ga0070667_100100758 3300005367 Bacteria 2495
67 Ga0070701_10001211 3300005438 Bacteria 9467
68 Ga0070701_10169471 3300005438 Bacteria 1270
69 Ga0070705_100031828 3300005440 Bacteria 2925
70 Ga0070700_100000784 3300005441 Bacteria 15661
71 Ga0070700_100003161 3300005441 Bacteria 8463
72 Ga0070694_100040337 3300005444 Bacteria 3112
73 Ga0070708_100160181 3300005445 Bacteria 2097
74 Ga0070663_100000127 3300005455 Bacteria 35963
75 Ga0070663_100038045 3300005455 Bacteria 3353
76 Ga0070663_100198683 3300005455 Bacteria 1564
77 Ga0070678_100016474 3300005456 Bacteria 4730
78 Ga0070678_100021761 3300005456 Bacteria 4235
79 Ga0070678_100175889 3300005456 Bacteria 1748
80 Ga0070678_100196870 3300005456 Bacteria 1660
81 Ga0070662_100054794 3300005457 Bacteria 2890
82 Ga0070662_100062034 3300005457 Bacteria 2730
83 Ga0068867_100000191 3300005459 Bacteria 40494
84 Ga0068867_100002519 3300005459 Bacteria 12885
85 Ga0068867_100086035 3300005459 Bacteria 2377
86 Ga0068867_100114357 3300005459 Bacteria 2077
87 Ga0070685_10017750 3300005466 Bacteria 3814
88 Ga0070685_10024345 3300005466 Bacteria 3324
89 Ga0070684_100034577 3300005535 Bacteria 4321
90 Ga0070684_100172039 3300005535 Bacteria 1967
91 Ga0068853_100009633 3300005539 Bacteria 7785
92 Ga0068853_100038715 3300005539 Bacteria 4062
93 Ga0070672_100000455 3300005543 Bacteria 23832
94 Ga0070672_100002919 3300005543 Bacteria 10995
95 Ga0070672_100005115 3300005543 Bacteria 8652
96 Ga0070672_100103955 3300005543 Bacteria 2307
97 Ga0070686_100000103 3300005544 Bacteria 58400
98 Ga0070695_100019666 3300005545 Bacteria 4115
99 Ga0070693_100015766 3300005547 Bacteria 3898
100 Ga0070665_100011648 3300005548 Bacteria 8888
101 Ga0070665_100061618 3300005548 Bacteria 3761
102 Ga0070704_100024201 3300005549 Bacteria 3981
103 Ga0068855_100041737 3300005563 Bacteria 5436
104 Ga0068855_100168578 3300005563 Bacteria 2480
105 Ga0070664_100026911 3300005564 Bacteria 4776
106 Ga0070664_100095623 3300005564 Bacteria 2577
107 Ga0070664_100161563 3300005564 Bacteria 1982
108 Ga0068854_100095494 3300005578 Bacteria 2219
109 Ga0068854_100153274 3300005578 Bacteria 1779
110 Ga0068854_100296856 3300005578 Bacteria 1306
111 Ga0068856_100014048 3300005614 Bacteria 7742
112 Ga0068856_100267596 3300005614 Bacteria 1725
113 Ga0068856_100289712 3300005614 Bacteria 1654
114 Ga0070702_100000081 3300005615 Bacteria 27675
115 Ga0070702_100116519 3300005615 Bacteria 1665
116 Ga0068852_100010121 3300005616 Bacteria 7023
117 Ga0068852_100014760 3300005616 Bacteria 6030
118 Ga0068852_100048149 3300005616 Bacteria 3641
119 Ga0068852_100205635 3300005616 Bacteria 1865
120 Ga0068852_100381004 3300005616 Bacteria 1384
121 Ga0068859_100000560 3300005617 Bacteria 36894
122 Ga0068859_100034614 3300005617 Bacteria 5069
123 Ga0068859_100042950 3300005617 Bacteria 4542
124 Ga0068864_100000895 3300005618 Bacteria 25086
125 Ga0068864_100017183 3300005618 Bacteria 6033
126 Ga0068864_100017870 3300005618 Bacteria 5916
127 Ga0068864_100021458 3300005618 Bacteria 5411
128 Ga0068864_100021750 3300005618 Bacteria 5372
129 Ga0068864_100025048 3300005618 Bacteria 5022
130 Ga0068864_100027849 3300005618 Bacteria 4776
131 Ga0068864_100045997 3300005618 Bacteria 3744
132 Ga0068866_10000201 3300005718 Bacteria 28091
133 Ga0068866_10005486 3300005718 Bacteria 5238
134 Ga0068866_10015962 3300005718 Bacteria 3347
135 Ga0068866_10151419 3300005718 Bacteria 1344
136 Ga0068861_100002141 3300005719 Bacteria 12777
137 Ga0068861_100032122 3300005719 Bacteria 3862
138 Ga0068861_100087488 3300005719 Bacteria 2452
139 Ga0068861_100175058 3300005719 Bacteria 1781
140 Ga0068861_100245673 3300005719 Bacteria 1524
141 Ga0068851_10013154 3300005834 Bacteria 3914
142 Ga0068851_10082939 3300005834 Bacteria 1676
143 Ga0068851_10138061 3300005834 Bacteria 1323
144 Ga0068870_10002727 3300005840 Bacteria 7411
145 Ga0068870_10019703 3300005840 Bacteria 3276
146 Ga0068863_100030122 3300005841 Bacteria 5183
147 Ga0068863_100070339 3300005841 Bacteria 3309
148 Ga0068863_100094258 3300005841 Bacteria 2841
149 Ga0068863_100231486 3300005841 Bacteria 1782
150 Ga0068858_100000455 3300005842 Bacteria 42847
151 Ga0068858_100000721 3300005842 Bacteria 34455
152 Ga0068858_100009127 3300005842 Bacteria 9482
153 Ga0068858_100039426 3300005842 Bacteria 4380
154 Ga0068858_100101201 3300005842 Bacteria 2687
155 Ga0068858_100216887 3300005842 Bacteria 1811
156 Ga0068860_100000590 3300005843 Bacteria 43453
157 Ga0068860_100001308 3300005843 Bacteria 27073
158 Ga0068860_100007722 3300005843 Bacteria 10754
159 Ga0068860_100147216 3300005843 Bacteria 2266
160 Ga0068860_100338034 3300005843 Bacteria 1480
161 Ga0068862_100003224 3300005844 Bacteria 14128
162 Ga0068862_100026724 3300005844 Bacteria 4852
163 Ga0068862_100095149 3300005844 Bacteria 2598
164 Ga0068862_100154745 3300005844 Bacteria 2043
165 Ga0068862_100158895 3300005844 Bacteria 2016
166 Ga0068862_100188914 3300005844 Bacteria 1852
167 Ga0075365_10009503 3300006038 Bacteria 5595
168 Ga0075363_100206622 3300006048 Bacteria 1123
169 Ga0075362_10189052 3300006177 Bacteria 1000
170 Ga0075366_10006850 3300006195 Bacteria 6270
171 Ga0075366_10019096 3300006195 Bacteria 3961
172 Ga0075366_10032281 3300006195 Bacteria 3082
173 Ga0075366_10075243 3300006195 Bacteria 2014
174 Ga0097621_100007342 3300006237 Bacteria 7880
175 Ga0097621_100029482 3300006237 Bacteria 4334
176 Ga0097621_100037662 3300006237 Bacteria 3878
177 Ga0097621_100158999 3300006237 Bacteria 1941
178 Ga0097621_100172735 3300006237 Bacteria 1864
179 Ga0068871_100003664 3300006358 Bacteria 10561
180 Ga0068871_100005099 3300006358 Bacteria 9177
181 Ga0068871_100026970 3300006358 Bacteria 4488
182 Ga0068871_100033926 3300006358 Bacteria 4045
183 Ga0068871_100322945 3300006358 Bacteria 1360
184 Ga0075430_100109317 3300006846 Bacteria 2306
185 Ga0075429_100001832 3300006880 Bacteria 17596
186 Ga0068865_100000113 3300006881 Bacteria 41428
187 Ga0068865_100005106 3300006881 Bacteria 7943
188 Ga0068865_100009533 3300006881 Bacteria 6024
189 Ga0068865_100039020 3300006881 Bacteria 3219
190 Ga0097620_100000560 3300006931 Bacteria 36894
191 Ga0097620_100034614 3300006931 Bacteria 5069
192 Ga0097620_100042953 3300006931 Bacteria 4542
193 Ga0079104_1000037 3300006946 Bacteria 189207
194 Ga0105250_10005204 3300009092 Bacteria 5865
195 Ga0105240_10006593 3300009093 Bacteria 17041
196 Ga0105240_10412254 3300009093 Bacteria 1519
197 Ga0111539_10150637 3300009094 Bacteria 2723
198 Ga0111539_10156092 3300009094 Bacteria 2670
199 Ga0105245_10000681 3300009098 Bacteria 30711
200 Ga0105245_10119619 3300009098 Bacteria 2459
201 Ga0114129_11057768 3300009147 Bacteria 1018
202 Ga0105243_10001082 3300009148 Bacteria 24928
203 Ga0105243_10087298 3300009148 Bacteria 2560
204 Ga0105242_10000201 3300009176 Bacteria 46357
205 Ga0105242_10059715 3300009176 Bacteria 3130
206 Ga0105248_10000507 3300009177 Bacteria 44310
207 Ga0105248_10006243 3300009177 Bacteria 13064
208 Ga0105248_10015929 3300009177 Bacteria 8280
209 Ga0105237_10000293 3300009545 Bacteria 69295
210 Ga0105237_10060968 3300009545 Bacteria 3773
211 Ga0105238_10002472 3300009551 Bacteria 18494
212 Ga0105238_10056225 3300009551 Bacteria 3948
213 Ga0105238_10546103 3300009551 Bacteria 1163
214 Ga0105249_10155467 3300009553 Bacteria 2205
215 Ga0105239_10002229 3300010375 Bacteria 24806
216 Ga0105239_10041884 3300010375 Bacteria 5018
217 Ga0105246_10137644 3300011119 Bacteria 1832
218 Ga0157369_10045523 3300013105 Bacteria 4771
219 Ga0157374_10007912 3300013296 Bacteria 9076
220 Ga0157374_10044586 3300013296 Bacteria 4099
221 Ga0157378_10000357 3300013297 Bacteria 44996
222 Ga0157378_10004481 3300013297 Bacteria 12262
223 Ga0157378_10091957 3300013297 Bacteria 2760
224 Ga0157378_10185707 3300013297 Bacteria 1958
225 Ga0163162_10010609 3300013306 Bacteria 8958
226 Ga0163162_10032428 3300013306 Bacteria 5190
227 Ga0163162_10050559 3300013306 Bacteria 4168
228 Ga0157372_10060660 3300013307 Bacteria 4232
229 Ga0157375_10036214 3300013308 Bacteria 4719
230 Ga0157375_10068089 3300013308 Bacteria 3560
231 Ga0157375_10072962 3300013308 Bacteria 3450
232 Ga0157375_10090867 3300013308 Bacteria 3113
233 Ga0157375_10107087 3300013308 Bacteria 2889
234 Ga0157375_10161038 3300013308 Bacteria 2386
235 Ga0163163_10010737 3300014325 Bacteria 8260
236 Ga0163163_10100097 3300014325 Bacteria 2921
237 Ga0157380_10051588 3300014326 Bacteria 3254
238 Ga0157377_10000851 3300014745 Bacteria 12687
239 Ga0157377_10021594 3300014745 Bacteria 3388
240 Ga0157377_10170982 3300014745 Bacteria 1359
241 Ga0157379_10007924 3300014968 Bacteria 9208
242 Ga0157379_10016573 3300014968 Bacteria 6480
243 Ga0157379_10054497 3300014968 Bacteria 3573
244 Ga0157379_10086058 3300014968 Bacteria 2818
245 Ga0157379_10135800 3300014968 Bacteria 2216
246 Ga0157379_10145880 3300014968 Bacteria 2134
247 Ga0157379_10307026 3300014968 Bacteria 1447
248 Ga0157376_10006028 3300014969 Bacteria 8522
249 Ga0157376_10037673 3300014969 Bacteria 3929
250 Ga0157376_10070159 3300014969 Bacteria 2973
251 Ga0157376_10249327 3300014969 Bacteria 1657
252 Ga0157376_10366103 3300014969 Bacteria 1384
253 Ga0163161_10006861 3300017792 Bacteria 7880
254 Ga0163161_10114971 3300017792 Bacteria 2016
255 Ga0163161_10257488 3300017792 Bacteria 1362
256 Ga0213872_10000007 3300021361 Bacteria 228206
257 Ga0213872_10001260 3300021361 Bacteria 17048
258 Ga0207673_1003014 3300025290 Bacteria 1953
259 Ga0207673_1006090 3300025290 Bacteria 1486
260 Ga0209257_1040921 3300025304 Bacteria 1379
261 Ga0207697_10004453 3300025315 Bacteria 6692
262 Ga0207697_10013322 3300025315 Bacteria 3432
263 Ga0207656_10017279 3300025321 Bacteria 2823
264 Ga0207696_1006923 3300025711 Bacteria 4499
265 Ga0207682_10000900 3300025893 Bacteria 13769
266 Ga0207682_10003046 3300025893 Bacteria 7359
267 Ga0207682_10101817 3300025893 Bacteria 1256
268 Ga0207642_10028252 3300025899 Bacteria 2307
269 Ga0207688_10012874 3300025901 Bacteria 4548
270 Ga0207688_10019227 3300025901 Bacteria 3719
271 Ga0207680_10001992 3300025903 Bacteria 9567
272 Ga0207680_10014983 3300025903 Bacteria 4034
273 Ga0207645_10086051 3300025907 Bacteria 2019
274 Ga0207645_10099664 3300025907 Bacteria 1873
275 Ga0207643_10002587 3300025908 Bacteria 9787
276 Ga0207643_10005660 3300025908 Bacteria 6683
277 Ga0207643_10037001 3300025908 Bacteria 2738
278 Ga0207705_10013870 3300025909 Bacteria 5810
279 Ga0207705_10120299 3300025909 Bacteria 1948
280 Ga0207654_10252630 3300025911 Bacteria 1182
281 Ga0207695_10028942 3300025913 Bacteria 6132
282 Ga0207671_10012562 3300025914 Bacteria 6801
283 Ga0207660_10230092 3300025917 Bacteria 1457
284 Ga0207662_10057699 3300025918 Bacteria 2321
285 Ga0207662_10101705 3300025918 Bacteria 1781
286 Ga0207662_10188706 3300025918 Bacteria 1329
287 Ga0207657_10011645 3300025919 Bacteria 8720
288 Ga0207657_10097491 3300025919 Bacteria 2444
289 Ga0207657_10115989 3300025919 Bacteria 2207
290 Ga0207649_10030192 3300025920 Bacteria 3207
291 Ga0207649_10328739 3300025920 Bacteria 1125
292 Ga0207681_10002665 3300025923 Bacteria 11317
293 Ga0207681_10038936 3300025923 Bacteria 3153
294 Ga0207694_10028093 3300025924 Bacteria 4288
295 Ga0207694_10066315 3300025924 Bacteria 2816
296 Ga0207650_10001429 3300025925 Bacteria 17220
297 Ga0207650_10056101 3300025925 Bacteria 2926
298 Ga0207659_10006606 3300025926 Bacteria 7122
299 Ga0207659_10042734 3300025926 Bacteria 3179
300 Ga0207659_10069001 3300025926 Bacteria 2573
301 Ga0207659_10154317 3300025926 Bacteria 1796
302 Ga0207687_10005916 3300025927 Bacteria 8094
303 Ga0207687_10065856 3300025927 Bacteria 2574
304 Ga0207644_10012310 3300025931 Bacteria 5680
305 Ga0207644_10036291 3300025931 Bacteria 3460
306 Ga0207644_10107729 3300025931 Bacteria 2102
307 Ga0207644_10155410 3300025931 Bacteria 1773
308 Ga0207690_10242182 3300025932 Bacteria 1390
309 Ga0207706_10001422 3300025933 Bacteria 23958
310 Ga0207706_10009838 3300025933 Bacteria 8770
311 Ga0207686_10000084 3300025934 Bacteria 79402
312 Ga0207709_10001923 3300025935 Bacteria 13649
313 Ga0207709_10004553 3300025935 Bacteria 7988
314 Ga0207709_10142260 3300025935 Bacteria 1650
315 Ga0207709_10177420 3300025935 Bacteria 1501
316 Ga0207670_10109945 3300025936 Bacteria 1984
317 Ga0207669_10029240 3300025937 Bacteria 3044
318 Ga0207669_10095679 3300025937 Bacteria 1947
319 Ga0207669_10155549 3300025937 Bacteria 1607
320 Ga0207669_10162953 3300025937 Bacteria 1577
321 Ga0207669_10337619 3300025937 Bacteria 1159
322 Ga0207704_10000166 3300025938 Bacteria 34959
323 Ga0207704_10028245 3300025938 Bacteria 3109
324 Ga0207704_10028911 3300025938 Bacteria 3083
325 Ga0207704_10058630 3300025938 Bacteria 2372
326 Ga0207704_10079332 3300025938 Bacteria 2115
327 Ga0207704_10143360 3300025938 Bacteria 1675
328 Ga0207691_10000973 3300025940 Bacteria 28494
329 Ga0207691_10001288 3300025940 Bacteria 25003
330 Ga0207691_10016296 3300025940 Bacteria 7057
331 Ga0207691_10016383 3300025940 Bacteria 7035
332 Ga0207691_10086415 3300025940 Bacteria 2814
333 Ga0207691_10097893 3300025940 Bacteria 2621
334 Ga0207691_10316187 3300025940 Bacteria 1339
335 Ga0207711_10014573 3300025941 Bacteria 6532
336 Ga0207711_10038891 3300025941 Bacteria 4045
337 Ga0207711_10067741 3300025941 Bacteria 3091
338 Ga0207689_10000272 3300025942 Bacteria 46619
339 Ga0207689_10000937 3300025942 Bacteria 28023
340 Ga0207689_10001248 3300025942 Bacteria 24503
341 Ga0207689_10079500 3300025942 Bacteria 2695
342 Ga0207661_10029460 3300025944 Bacteria 4216
343 Ga0207661_10211006 3300025944 Bacteria 1711
344 Ga0207679_10015894 3300025945 Bacteria 4988
345 Ga0207679_10104017 3300025945 Bacteria 2227
346 Ga0207679_10185065 3300025945 Bacteria 1726
347 Ga0207667_10041872 3300025949 Bacteria 4870
348 Ga0207667_10113456 3300025949 Bacteria 2794
349 Ga0207667_10563682 3300025949 Bacteria 1151
350 Ga0207651_10003511 3300025960 Bacteria 7704
351 Ga0207651_10037473 3300025960 Bacteria 3177
352 Ga0207712_10104175 3300025961 Bacteria 2115
353 Ga0207712_10153420 3300025961 Bacteria 1781
354 Ga0207668_10000968 3300025972 Bacteria 17241
355 Ga0207668_10133598 3300025972 Bacteria 1898
356 Ga0207640_10006595 3300025981 Bacteria 6374
357 Ga0207640_10021609 3300025981 Bacteria 3839
358 Ga0207658_10001919 3300025986 Bacteria 15520
359 Ga0207658_10006686 3300025986 Bacteria 7860
360 Ga0207658_10091873 3300025986 Bacteria 2356
361 Ga0207677_10033837 3300026023 Bacteria 3302
362 Ga0207677_10088568 3300026023 Bacteria 2245
363 Ga0207677_10314858 3300026023 Bacteria 1298
364 Ga0207703_10000375 3300026035 Bacteria 47699
365 Ga0207703_10015188 3300026035 Bacteria 6008
366 Ga0207703_10019666 3300026035 Bacteria 5277
367 Ga0207703_10026050 3300026035 Bacteria 4602
368 Ga0207703_10070368 3300026035 Bacteria 2888
369 Ga0207703_10314429 3300026035 Bacteria 1432
370 Ga0207639_10091865 3300026041 Bacteria 2431
371 Ga0207639_10252212 3300026041 Bacteria 1539
372 Ga0207639_10352528 3300026041 Bacteria 1315
373 Ga0207678_10000711 3300026067 Bacteria 30413
374 Ga0207678_10003317 3300026067 Bacteria 14517
375 Ga0207678_10009807 3300026067 Bacteria 8420
376 Ga0207678_10317485 3300026067 Bacteria 1340
377 Ga0207678_10338962 3300026067 Bacteria 1295
378 Ga0207678_10528250 3300026067 Bacteria 1030
379 Ga0207708_10000134 3300026075 Bacteria 58313
380 Ga0207708_10000749 3300026075 Bacteria 24378
381 Ga0207708_10010230 3300026075 Bacteria 6965
382 Ga0207702_10010113 3300026078 Bacteria 7906
383 Ga0207702_10089243 3300026078 Bacteria 2696
384 Ga0207641_10019018 3300026088 Bacteria 5634
385 Ga0207641_10510520 3300026088 Bacteria 1168
386 Ga0207648_10000433 3300026089 Bacteria 46203
387 Ga0207648_10000842 3300026089 Bacteria 34576
388 Ga0207648_10002680 3300026089 Bacteria 18942
389 Ga0207648_10005765 3300026089 Bacteria 12408
390 Ga0207648_10011252 3300026089 Bacteria 8436
391 Ga0207648_10051060 3300026089 Bacteria 3614
392 Ga0207676_10010703 3300026095 Bacteria 6541
393 Ga0207676_10010902 3300026095 Bacteria 6484
394 Ga0207676_10024579 3300026095 Bacteria 4459
395 Ga0207676_10048959 3300026095 Bacteria 3284
396 Ga0207676_10051785 3300026095 Bacteria 3206
397 Ga0207676_10062591 3300026095 Bacteria 2952
398 Ga0207676_10517730 3300026095 Bacteria 1135
399 Ga0207674_10026211 3300026116 Bacteria 6199
400 Ga0207674_10328098 3300026116 Bacteria 1480
401 Ga0207675_100000490 3300026118 Bacteria 38407
402 Ga0207675_100001900 3300026118 Bacteria 20834
403 Ga0207675_100002302 3300026118 Bacteria 18970
404 Ga0207675_100026407 3300026118 Bacteria 5406
405 Ga0207683_10005797 3300026121 Bacteria 10593
406 Ga0207683_10011107 3300026121 Bacteria 7676
407 Ga0207683_10012464 3300026121 Bacteria 7255
408 Ga0207683_10083065 3300026121 Bacteria 2846
409 Ga0207683_10166311 3300026121 Bacteria 1996
410 Ga0207698_10002753 3300026142 Bacteria 10485
411 Ga0207698_10037986 3300026142 Bacteria 3553
412 Ga0207698_10247142 3300026142 Bacteria 1630
413 Ga0209281_1000002 3300027111 Bacteria 1924012
414 Ga0209983_1018933 3300027665 Bacteria 1431
415 Ga0207428_10177992 3300027907 Bacteria 1608
416 Ga0268266_10164311 3300028379 Bacteria 2010
417 Ga0268266_10429243 3300028379 Bacteria 1253
418 Ga0268265_10005950 3300028380 Bacteria 8303
419 Ga0268265_10010067 3300028380 Bacteria 6382
420 Ga0268265_10010172 3300028380 Bacteria 6350
421 Ga0268265_10135597 3300028380 Bacteria 2053
422 Ga0268264_10000991 3300028381 Bacteria 28937
423 Ga0268264_10004638 3300028381 Bacteria 11677
424 Ga0268264_10016497 3300028381 Bacteria 6048
425 Ga0307517_10000228 3300028786 Bacteria 94852
426 Ga0307517_10194207 3300028786 Bacteria 1282
427 Ga0307517_10197632 3300028786 Bacteria 1263
428 Ga0307515_10027638 3300028794 Bacteria 9685
429 Ga0307515_10304248 3300028794 Bacteria 1276
430 Ga0307512_10071922 3300030522 Bacteria 2563
431 Ga0265328_10020656 3300031239 Bacteria 2518
432 Ga0265331_10001779 3300031250 Bacteria 15399
433 Ga0265327_10000491 3300031251 Bacteria 69450
434 Ga0307509_10004172 3300031507 Bacteria 21115
435 Ga0307509_10007733 3300031507 Bacteria 13939
436 Ga0307509_10017238 3300031507 Bacteria 8319
437 Ga0307509_10062175 3300031507 Bacteria 3938
438 Ga0307509_10143518 3300031507 Bacteria 2318
439 Ga0307408_100004119 3300031548 Bacteria 9908
440 Ga0307408_100113242 3300031548 Bacteria 2088
441 Ga0307508_10000273 3300031616 Bacteria 63550
442 Ga0307514_10000355 3300031649 Bacteria 106758
443 Ga0307514_10094482 3300031649 Bacteria 2167
444 Ga0316579_10001716 3300031691 Bacteria 8053
445 Ga0316578_10014936 3300031728 Bacteria 4163
446 Ga0307516_10004597 3300031730 Bacteria 16937
447 Ga0307516_10171053 3300031730 Bacteria 1913
448 Ga0307405_10005079 3300031731 Bacteria 6300
449 Ga0307413_10103521 3300031824 Bacteria 1887
450 Ga0307518_10030185 3300031838 Bacteria 3925
451 Ga0307410_10008485 3300031852 Bacteria 5699
452 Ga0307406_10003644 3300031901 Bacteria 8388
453 Ga0307406_10127200 3300031901 Bacteria 1782
454 Ga0307406_10194433 3300031901 Bacteria 1488
455 Ga0307412_10005312 3300031911 Bacteria 7231
456 Ga0307412_10152284 3300031911 Bacteria 1708
457 Ga0307412_10172533 3300031911 Bacteria 1618
458 Ga0307416_100174538 3300032002 Bacteria 2006
459 Ga0307416_100326714 3300032002 Bacteria 1539
460 Ga0307414_10019323 3300032004 Bacteria 4219
461 Ga0307414_10137120 3300032004 Bacteria 1910
462 Ga0307411_10001450 3300032005 Bacteria 9703
463 Ga0307415_100006924 3300032126 Bacteria 6157
464 Ga0307510_10000967 3300033180 Bacteria 30417
465 Ga0307510_10032606 3300033180 Bacteria 5866
466 Ga0307510_10140259 3300033180 Bacteria 2062
467 Ga0373959_0013134 3300034820 Bacteria 1490
468 Ga0373944_0003244 3300035089 Bacteria 4183
469 Ga0373939_0000041 3300035114 Bacteria 45477
470 Ga0373960_0000135 3300035121 Bacteria 12101
471 Ga0373943_0130977 3300035170 Bacteria 1342
472 Ga0373931_0000097 3300035691 Bacteria 40104
473 Ga0373931_0000882 3300035691 Bacteria 12672
474 Ga0373931_0056926 3300035691 Bacteria 2096
475 Ga0373927_0089373 3300035695 Bacteria 2000
476 Ga0373927_0119654 3300035695 Bacteria 1719
477 Ga0373937_0186202 3300036401 Bacteria 1950
478 Ga0316582_0011481 3300036647 Bacteria 4899
479 Ga0373925_0015343 3300037068 Bacteria 5542
480 Ga0373925_0027068 3300037068 Bacteria 4199
481 Ga0373925_0073937 3300037068 Bacteria 2581
482 Ga0373925_0157574 3300037068 Bacteria 1786
483 Ga0395905_0001659 3300037471 Bacteria 26289
484 Ga0395905_0002961 3300037471 Bacteria 18458
485 Ga0395905_0053160 3300037471 Bacteria 3791
486 Ga0395905_0242920 3300037471 Bacteria 1682
487 Ga0436360_0026854 3300039438 Bacteria 1920
488 Ga0436360_0702683 3300039438 Bacteria 9964
489 Ga0436361_0021397 3300039447 Bacteria 46447
490 Ga0436361_0163583 3300039447 Bacteria 173204
491 Ga0436361_0480355 3300039447 Bacteria 4166
492 Ga0436361_0515416 3300039447 Bacteria 1512
493 Ga0436361_0694318 3300039447 Bacteria 14752
494 Ga0451791_0028897 3300041451 Bacteria 1027
495 Ga0451800_1657359 3300041459 Bacteria 1336
496 Ga0450920_021836 3300042122 Bacteria 1238
497 Ga0439434_0053546 3300042435 Bacteria 1254
498 Ga0450918_000419 3300042531 Bacteria 9209
499 Ga0450893_0009516 3300042532 Bacteria 1588
500 Ga0451577_0003355 3300042876 Bacteria 17937
501 Ga0451577_0011238 3300042876 Bacteria 8485
502 Ga0453684_0098650 3300044712 Bacteria 3580
503 Ga0453684_0105932 3300044712 Bacteria 3428
504 Ga0466968_0029228 3300044735 Bacteria 2278
505 Ga0451576_0045812 3300045051 Bacteria 4604
506 Ga0466958_0034970 3300045836 Bacteria 3000
507 Ga0495592_0000307 3300046454 Bacteria 41229
508 Ga0495590_0001456 3300046457 Bacteria 10206
509 Ga0495650_0005020 3300046471 Bacteria 8792
510 Ga0495597_0000054 3300046542 Bacteria 95390
511 Ga0495633_0001764 3300046558 Bacteria 16041
512 Ga0495625_0082794 3300046660 Bacteria 2231
513 Ga0495647_0048038 3300046681 Bacteria 1649
514 Ga0495614_0018660 3300048089 Bacteria 3004
515 Ga0496100_0119952 3300048903 Bacteria 1838
516 Ga0496101_0035120 3300048904 Bacteria 3545
517 Ga0496101_0138814 3300048904 Bacteria 1851
518 Ga0496102_0012909 3300048905 Bacteria 7233
519 Ga0496102_0352231 3300048905 Bacteria 1386
520 Ga0496104_0077458 3300048907 Bacteria 3168
521 Ga0496104_0362256 3300048907 Bacteria 1362
522 Ga0496105_0031152 3300048908 Bacteria 4372
523 Ga0496105_0220206 3300048908 Bacteria 1545
524 Ga0496106_0023412 3300048909 Bacteria 4588
525 Ga0496106_0063643 3300048909 Bacteria 2804
526 Ga0496107_0073536 3300048910 Bacteria 2486
527 Ga0496107_0241731 3300048910 Bacteria 1343
528 Ga0496108_0096804 3300048911 Bacteria 2514
529 Ga0496109_0027726 3300048912 Bacteria 5060
530 Ga0496109_0084402 3300048912 Bacteria 2930
531 Ga0496110_0058616 3300048913 Bacteria 3391
532 Ga0496110_0110927 3300048913 Bacteria 2465
533 Ga0496111_0111703 3300048914 Bacteria 2013
534 Ga0496112_0110815 3300048915 Bacteria 2715
535 Ga0496112_0394269 3300048915 Bacteria 1324
536 Ga0496114_0035179 3300048917 Bacteria 4135
537 Ga0496114_0172549 3300048917 Bacteria 1885
538 Ga0496114_0466587 3300048917 Bacteria 1117
539 Ga0496115_0038526 3300048918 Bacteria 3793
540 Ga0496118_0180449 3300048921 Bacteria 1276
541 Ga0496121_0001278 3300048924 Bacteria 43341
542 Ga0496121_0040004 3300048924 Bacteria 4120
543 Ga0496124_0000126 3300048927 Bacteria 159539
544 Ga0496124_0074561 3300048927 Bacteria 2804
545 Ga0496125_0003500 3300048928 Bacteria 18970
546 Ga0496125_0107227 3300048928 Bacteria 2036
547 Ga0496126_0029704 3300048929 Bacteria 5189
548 Ga0501292_006324 3300049515 Bacteria 1679
549 Ga0501034_0306624 3300049571 Bacteria 1523
550 Ga0501043_0000012 3300049579 Bacteria 188907
551 Ga0501046_0000030 3300049580 Bacteria 187803
552 Ga0501047_0000049 3300049581 Bacteria 162513
553 Ga0501048_0000082 3300049582 Bacteria 49693
554 Ga0501198_000029 3300049649 Bacteria 61627
555 Ga0501211_001400 3300049658 Bacteria 2581
556 Ga0501222_000001 3300049662 Bacteria 307689
557 Ga0501083_0010638 3300049744 Bacteria 6476
558 Ga0501267_000300 3300049764 Bacteria 3641
559 Ga0501044_0180647 3300049823 Bacteria 2077
560 Ga0501045_0003743 3300049824 Bacteria 10463
561 nmdc:mga0k408_158154_c1 3300050493 Bacteria 1350
562 nmdc:mga0k408_42918_c1 3300050493 Bacteria 2605
563 nmdc:mga0k408_50179_c1 3300050493 Bacteria 2415
564 nmdc:mga09592_1124_c1 3300050508 Bacteria 21276
565 nmdc:mga0qj67_290918_c1 3300050509 Bacteria 1324
566 nmdc:mga08y16_41344_c1 3300050511 Bacteria 4829
567 Ga0500644_0003021 3300053088 Bacteria 4172
568 Ga0500559_0000636 3300053136 Bacteria 23688
569 Ga0500622_0105998 3300053156 Bacteria 1378
570 Ga0590071_028275 3300059421 Bacteria 1332
571 Ga0590075_006183 3300059424 Bacteria 2838

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0515416 Ga0436361_0515416_230_1150 277
2 3300006358 Ga0068871_100322945 Ga0068871_1003229452 279
3 3300009545 Ga0105237_10060968 Ga0105237_100609683 279
4 3300039438 Ga0436360_0026854 Ga0436360_0026854_307_1227 279
5 3300025935 Ga0207709_10177420 Ga0207709_101774202 282
6 3300025940 Ga0207691_10086415 Ga0207691_100864151 282
7 3300037471 Ga0395905_0242920 Ga0395905_0242920_148_1065 283
8 3300046471 Ga0495650_0005020 Ga0495650_0005020_818_1738 284
9 3300048089 Ga0495614_0018660 Ga0495614_0018660_1983_2903 284
10 3300048921 Ga0496118_0180449 Ga0496118_0180449_272_1198 284
11 3300048924 Ga0496121_0040004 Ga0496121_0040004_2076_3002 284
12 3300048927 Ga0496124_0000126 Ga0496124_0000126_100213_101139 285
13 3300048928 Ga0496125_0003500 Ga0496125_0003500_16858_17784 285
14 3300005331 Ga0070670_100080639 Ga0070670_1000806393 286
15 3300026041 Ga0207639_10352528 Ga0207639_103525281 286
16 3300026089 Ga0207648_10011252 Ga0207648_100112525 286
17 3300006038 Ga0075365_10009503 Ga0075365_100095032 287
18 3300006195 Ga0075366_10075243 Ga0075366_100752432 287
19 3300032004 Ga0307414_10137120 Ga0307414_101371203 287
20 3300026121 Ga0207683_10083065 Ga0207683_100830651 290
21 3300005616 Ga0068852_100381004 Ga0068852_1003810042 291
22 3300005334 Ga0068869_100039477 Ga0068869_1000394773 292
23 3300005338 Ga0068868_100163336 Ga0068868_1001633362 292
24 3300005355 Ga0070671_100039634 Ga0070671_1000396342 292
25 3300005356 Ga0070674_100159859 Ga0070674_1001598592 292
26 3300005441 Ga0070700_100003161 Ga0070700_1000031613 292
27 3300005459 Ga0068867_100086035 Ga0068867_1000860351 292
28 3300005459 Ga0068867_100114357 Ga0068867_1001143572 292
29 3300005543 Ga0070672_100002919 Ga0070672_1000029194 292
30 3300005718 Ga0068866_10005486 Ga0068866_100054864 292
31 3300005719 Ga0068861_100002141 Ga0068861_10000214112 292
32 3300005843 Ga0068860_100000590 Ga0068860_10000059029 292
33 3300005844 Ga0068862_100026724 Ga0068862_1000267244 292
34 3300006881 Ga0068865_100005106 Ga0068865_1000051062 292
35 3300006881 Ga0068865_100039020 Ga0068865_1000390202 292
36 3300009148 Ga0105243_10087298 Ga0105243_100872982 292
37 3300009553 Ga0105249_10155467 Ga0105249_101554672 292
38 3300013297 Ga0157378_10004481 Ga0157378_100044816 292
39 3300013306 Ga0163162_10010609 Ga0163162_100106097 292
40 3300013308 Ga0157375_10036214 Ga0157375_100362143 292
41 3300017792 Ga0163161_10114971 Ga0163161_101149712 292
42 3300025899 Ga0207642_10028252 Ga0207642_100282522 292
43 3300025937 Ga0207669_10095679 Ga0207669_100956792 292
44 3300025938 Ga0207704_10028911 Ga0207704_100289111 292
45 3300025938 Ga0207704_10079332 Ga0207704_100793323 292
46 3300025940 Ga0207691_10001288 Ga0207691_1000128816 292
47 3300025942 Ga0207689_10079500 Ga0207689_100795003 292
48 3300025961 Ga0207712_10104175 Ga0207712_101041752 292
49 3300026023 Ga0207677_10088568 Ga0207677_100885682 292
50 3300026067 Ga0207678_10528250 Ga0207678_105282501 292
51 3300026075 Ga0207708_10010230 Ga0207708_100102308 292
52 3300026089 Ga0207648_10000842 Ga0207648_100008421 292
53 3300026089 Ga0207648_10051060 Ga0207648_100510602 292
54 3300026118 Ga0207675_100001900 Ga0207675_1000019003 292
55 3300028380 Ga0268265_10005950 Ga0268265_100059508 292
56 3300028381 Ga0268264_10000991 Ga0268264_1000099126 292
57 3300030522 Ga0307512_10071922 Ga0307512_100719223 292
58 3300031507 Ga0307509_10007733 Ga0307509_1000773311 292
59 3300031649 Ga0307514_10094482 Ga0307514_100944822 292
60 3300031838 Ga0307518_10030185 Ga0307518_100301855 292
61 3300033180 Ga0307510_10000967 Ga0307510_1000096721 292
62 3300005328 Ga0070676_10053682 Ga0070676_100536821 293
63 3300005331 Ga0070670_100034239 Ga0070670_1000342393 293
64 3300005338 Ga0068868_100027204 Ga0068868_1000272042 293
65 3300005356 Ga0070674_100040856 Ga0070674_1000408562 293
66 3300005456 Ga0070678_100021761 Ga0070678_1000217612 293
67 3300005543 Ga0070672_100005115 Ga0070672_1000051157 293
68 3300005618 Ga0068864_100025048 Ga0068864_1000250483 293
69 3300005841 Ga0068863_100070339 Ga0068863_1000703394 293
70 3300006237 Ga0097621_100029482 Ga0097621_1000294822 293
71 3300006358 Ga0068871_100005099 Ga0068871_1000050993 293
72 3300014745 Ga0157377_10170982 Ga0157377_101709822 293
73 3300014968 Ga0157379_10307026 Ga0157379_103070262 293
74 3300014969 Ga0157376_10070159 Ga0157376_100701593 293
75 3300017792 Ga0163161_10257488 Ga0163161_102574882 293
76 3300025893 Ga0207682_10101817 Ga0207682_101018171 293
77 3300025901 Ga0207688_10019227 Ga0207688_100192273 293
78 3300025909 Ga0207705_10120299 Ga0207705_101202992 293
79 3300025937 Ga0207669_10162953 Ga0207669_101629532 293
80 3300025940 Ga0207691_10016383 Ga0207691_100163837 293
81 3300026095 Ga0207676_10024579 Ga0207676_100245792 293
82 3300031548 Ga0307408_100113242 Ga0307408_1001132421 293
83 3300031731 Ga0307405_10005079 Ga0307405_100050794 293
84 3300031824 Ga0307413_10103521 Ga0307413_101035212 293
85 3300031852 Ga0307410_10008485 Ga0307410_100084854 293
86 3300031901 Ga0307406_10127200 Ga0307406_101272001 293
87 3300031911 Ga0307412_10005312 Ga0307412_100053128 293
88 3300032004 Ga0307414_10019323 Ga0307414_100193232 293
89 3300032005 Ga0307411_10001450 Ga0307411_100014509 293
90 3300032126 Ga0307415_100006924 Ga0307415_1000069244 293
91 3300044712 Ga0453684_0105932 Ga0453684_0105932_2162_3082 293
92 3300005618 Ga0068864_100021750 Ga0068864_1000217503 294
93 3300005841 Ga0068863_100030122 Ga0068863_1000301223 294
94 3300009098 Ga0105245_10119619 Ga0105245_101196193 294
95 3300025927 Ga0207687_10065856 Ga0207687_100658563 294
96 3300026095 Ga0207676_10048959 Ga0207676_100489593 294
97 3300028786 Ga0307517_10000228 Ga0307517_100002289 294
98 3300028786 Ga0307517_10194207 Ga0307517_101942071 294
99 3300028786 Ga0307517_10197632 Ga0307517_101976322 294
100 3300031507 Ga0307509_10004172 Ga0307509_100041726 294
101 3300031507 Ga0307509_10017238 Ga0307509_100172382 294
102 3300031616 Ga0307508_10000273 Ga0307508_1000027341 294
103 3300033180 Ga0307510_10032606 Ga0307510_100326063 294
104 3300033180 Ga0307510_10140259 Ga0307510_101402592 294
105 3300035089 Ga0373944_0003244 Ga0373944_0003244_2036_2953 294
106 3300035695 Ga0373927_0089373 Ga0373927_0089373_171_1088 294
107 3300037068 Ga0373925_0015343 Ga0373925_0015343_795_1712 294
108 3300046660 Ga0495625_0082794 Ga0495625_0082794_253_1173 294
109 3300053088 Ga0500644_0003021 Ga0500644_0003021_782_1702 294
110 3300053136 Ga0500559_0000636 Ga0500559_0000636_16729_17649 294
111 3300053156 Ga0500622_0105998 Ga0500622_0105998_280_1200 294
112 3300005290 Ga0065712_10196714 Ga0065712_101967141 295
113 3300005331 Ga0070670_100093079 Ga0070670_1000930792 295
114 3300005338 Ga0068868_100030921 Ga0068868_1000309212 295
115 3300005343 Ga0070687_100089292 Ga0070687_1000892922 295
116 3300005353 Ga0070669_100022578 Ga0070669_1000225782 295
117 3300005354 Ga0070675_100001927 Ga0070675_1000019279 295
118 3300005355 Ga0070671_100031280 Ga0070671_1000312804 295
119 3300005356 Ga0070674_100014881 Ga0070674_1000148813 295
120 3300005364 Ga0070673_100013975 Ga0070673_1000139753 295
121 3300005367 Ga0070667_100000219 Ga0070667_10000021954 295
122 3300005455 Ga0070663_100198683 Ga0070663_1001986832 295
123 3300005459 Ga0068867_100002519 Ga0068867_1000025194 295
124 3300005543 Ga0070672_100000455 Ga0070672_1000004554 295
125 3300005617 Ga0068859_100034614 Ga0068859_1000346143 295
126 3300005618 Ga0068864_100017870 Ga0068864_1000178703 295
127 3300005719 Ga0068861_100087488 Ga0068861_1000874882 295
128 3300005834 Ga0068851_10082939 Ga0068851_100829392 295
129 3300005840 Ga0068870_10019703 Ga0068870_100197032 295
130 3300005842 Ga0068858_100009127 Ga0068858_1000091277 295
131 3300005843 Ga0068860_100007722 Ga0068860_1000077227 295
132 3300006237 Ga0097621_100037662 Ga0097621_1000376623 295
133 3300006881 Ga0068865_100009533 Ga0068865_1000095336 295
134 3300006931 Ga0097620_100034614 Ga0097620_1000346143 295
135 3300013306 Ga0163162_10050559 Ga0163162_100505593 295
136 3300013308 Ga0157375_10090867 Ga0157375_100908672 295
137 3300014326 Ga0157380_10051588 Ga0157380_100515884 295
138 3300014968 Ga0157379_10086058 Ga0157379_100860581 295
139 3300017792 Ga0163161_10006861 Ga0163161_100068615 295
140 3300025290 Ga0207673_1006090 Ga0207673_10060901 295
141 3300025315 Ga0207697_10013322 Ga0207697_100133224 295
142 3300025893 Ga0207682_10003046 Ga0207682_100030464 295
143 3300025903 Ga0207680_10014983 Ga0207680_100149833 295
144 3300025908 Ga0207643_10037001 Ga0207643_100370012 295
145 3300025918 Ga0207662_10057699 Ga0207662_100576992 295
146 3300025923 Ga0207681_10002665 Ga0207681_100026653 295
147 3300025925 Ga0207650_10001429 Ga0207650_1000142913 295
148 3300025926 Ga0207659_10006606 Ga0207659_100066064 295
149 3300025931 Ga0207644_10012310 Ga0207644_100123104 295
150 3300025937 Ga0207669_10029240 Ga0207669_100292402 295
151 3300025938 Ga0207704_10058630 Ga0207704_100586302 295
152 3300025938 Ga0207704_10143360 Ga0207704_101433602 295
153 3300025940 Ga0207691_10000973 Ga0207691_100009739 295
154 3300025960 Ga0207651_10003511 Ga0207651_100035113 295
155 3300025986 Ga0207658_10001919 Ga0207658_100019198 295
156 3300026035 Ga0207703_10026050 Ga0207703_100260503 295
157 3300026067 Ga0207678_10338962 Ga0207678_103389622 295
158 3300026089 Ga0207648_10005765 Ga0207648_100057655 295
159 3300026095 Ga0207676_10010902 Ga0207676_100109023 295
160 3300026121 Ga0207683_10011107 Ga0207683_100111074 295
161 3300028381 Ga0268264_10016497 Ga0268264_100164974 295
162 3300006195 Ga0075366_10032281 Ga0075366_100322812 296
163 3300037068 Ga0373925_0027068 Ga0373925_0027068_2600_3520 296
164 3300041451 Ga0451791_0028897 Ga0451791_0028897_20_940 296
165 3300049649 Ga0501198_000029 Ga0501198_000029_59211_60131 296
166 3300049662 Ga0501222_000001 Ga0501222_000001_60087_61007 296
167 3300050493 nmdc:mga0k408_50179_c1 nmdc:mga0k408_50179_c1_37_1086 296
168 3300006195 Ga0075366_10019096 Ga0075366_100190963 297
169 3300045051 Ga0451576_0045812 Ga0451576_0045812_3089_4006 297
170 3300005548 Ga0070665_100011648 Ga0070665_1000116488 298
171 3300006195 Ga0075366_10006850 Ga0075366_100068502 298
172 3300009176 Ga0105242_10000201 Ga0105242_1000020122 298
173 3300013297 Ga0157378_10185707 Ga0157378_101857072 298
174 3300025961 Ga0207712_10153420 Ga0207712_101534202 298
175 3300026035 Ga0207703_10314429 Ga0207703_103144292 298
176 3300031901 Ga0307406_10194433 Ga0307406_101944332 298
177 3300031911 Ga0307412_10152284 Ga0307412_101522841 298
178 3300050493 nmdc:mga0k408_42918_c1 nmdc:mga0k408_42918_c1_1162_2085 298
179 3300028794 Ga0307515_10304248 Ga0307515_103042481 299
180 3300035114 Ga0373939_0000041 Ga0373939_0000041_29301_30218 299
181 3300035121 Ga0373960_0000135 Ga0373960_0000135_5693_6610 299
182 3300035691 Ga0373931_0000097 Ga0373931_0000097_37163_38080 299
183 3300039447 Ga0436361_0480355 Ga0436361_0480355_1851_2777 299
184 iso_pu_bacteria 2547132374 2548499252 300
185 iso_pu_bacteria 2585428062 2587758242 300
186 iso_pu_bacteria 2643221544 2643743256 300
187 iso_pu_bacteria 2643221570 2643866089 300
188 iso_pu_bacteria 2643221585 2643932722 300
189 iso_pu_bacteria 2643221644 2644245216 300
190 iso_pu_bacteria 2643221652 2644292903 300
191 iso_pu_bacteria 2643221654 2644305704 300
192 iso_pu_bacteria 2643221656 2644313972 300
193 iso_pu_bacteria 2643221717 2644647916 300
194 iso_pu_bacteria 2721755523 2722885718 300
195 iso_pu_bacteria 2738541337 2739056124 300
196 iso_pu_bacteria 2738543012 2739241971 300
197 iso_pu_bacteria 2816332133 2816470727 300
198 iso_pu_bacteria 2839138175 2839143944 300
199 3300005356 Ga0070674_100037159 Ga0070674_1000371593 302
200 3300005844 Ga0068862_100095149 Ga0068862_1000951491 302
201 3300025923 Ga0207681_10038936 Ga0207681_100389363 302
202 3300025937 Ga0207669_10337619 Ga0207669_103376192 302
203 3300025972 Ga0207668_10000968 Ga0207668_100009687 302
204 3300028380 Ga0268265_10010172 Ga0268265_100101727 302
205 3300039438 Ga0436360_0702683 Ga0436360_0702683_1765_2679 302
206 3300044735 Ga0466968_0029228 Ga0466968_0029228_809_1723 302
207 3300005616 Ga0068852_100014760 Ga0068852_1000147603 303
208 3300006048 Ga0075363_100206622 Ga0075363_1002066221 303
209 3300009094 Ga0111539_10156092 Ga0111539_101560926 303
210 3300009551 Ga0105238_10546103 Ga0105238_105461032 303
211 3300025949 Ga0207667_10041872 Ga0207667_100418722 303
212 3300026142 Ga0207698_10037986 Ga0207698_100379864 303
213 3300027907 Ga0207428_10177992 Ga0207428_101779921 303
214 3300031239 Ga0265328_10020656 Ga0265328_100206562 303
215 3300031250 Ga0265331_10001779 Ga0265331_100017794 303
216 3300031251 Ga0265327_10000491 Ga0265327_1000049134 303
217 3300031507 Ga0307509_10143518 Ga0307509_101435181 303
218 3300031730 Ga0307516_10004597 Ga0307516_1000459712 303
219 3300032002 Ga0307416_100174538 Ga0307416_1001745381 303
220 3300034820 Ga0373959_0013134 Ga0373959_0013134_53_973 303
221 3300037471 Ga0395905_0002961 Ga0395905_0002961_8938_9864 303
222 3300041459 Ga0451800_1657359 Ga0451800_1657359_334_1248 303
223 3300042122 Ga0450920_021836 Ga0450920_021836_70_984 303
224 3300045836 Ga0466958_0034970 Ga0466958_0034970_1543_2460 303
225 3300050511 nmdc:mga08y16_41344_c1 nmdc:mga08y16_41344_c1_3487_4407 303
226 3300002077 JGI24744J21845_10025542 JGI24744J21845_100255421 304
227 3300005327 Ga0070658_10011079 Ga0070658_100110793 304
228 3300005327 Ga0070658_10226082 Ga0070658_102260821 304
229 3300005328 Ga0070676_10080888 Ga0070676_100808882 304
230 3300005328 Ga0070676_10140985 Ga0070676_101409852 304
231 3300005329 Ga0070683_100015058 Ga0070683_1000150586 304
232 3300005329 Ga0070683_100173049 Ga0070683_1001730492 304
233 3300005330 Ga0070690_100000651 Ga0070690_10000065113 304
234 3300005330 Ga0070690_100070631 Ga0070690_1000706312 304
235 3300005330 Ga0070690_100097736 Ga0070690_1000977362 304
236 3300005330 Ga0070690_100169986 Ga0070690_1001699862 304
237 3300005331 Ga0070670_100060997 Ga0070670_1000609972 304
238 3300005333 Ga0070677_10009793 Ga0070677_100097932 304
239 3300005333 Ga0070677_10083012 Ga0070677_100830121 304
240 3300005334 Ga0068869_100001401 Ga0068869_1000014017 304
241 3300005334 Ga0068869_100005873 Ga0068869_1000058733 304
242 3300005334 Ga0068869_100044338 Ga0068869_1000443382 304
243 3300005336 Ga0070680_100036578 Ga0070680_1000365785 304
244 3300005337 Ga0070682_100078844 Ga0070682_1000788443 304
245 3300005338 Ga0068868_100000439 Ga0068868_10000043910 304
246 3300005338 Ga0068868_100006871 Ga0068868_1000068717 304
247 3300005338 Ga0068868_100109092 Ga0068868_1001090922 304
248 3300005339 Ga0070660_100171670 Ga0070660_1001716702 304
249 3300005340 Ga0070689_100001789 Ga0070689_1000017899 304
250 3300005340 Ga0070689_100022218 Ga0070689_1000222183 304
251 3300005340 Ga0070689_100066063 Ga0070689_1000660632 304
252 3300005340 Ga0070689_100135304 Ga0070689_1001353042 304
253 3300005341 Ga0070691_10006175 Ga0070691_100061751 304
254 3300005343 Ga0070687_100039502 Ga0070687_1000395022 304
255 3300005343 Ga0070687_100092633 Ga0070687_1000926332 304
256 3300005344 Ga0070661_100005385 Ga0070661_1000053857 304
257 3300005344 Ga0070661_100061902 Ga0070661_1000619023 304
258 3300005344 Ga0070661_100087494 Ga0070661_1000874943 304
259 3300005354 Ga0070675_100002165 Ga0070675_1000021658 304
260 3300005354 Ga0070675_100003623 Ga0070675_1000036232 304
261 3300005354 Ga0070675_100020207 Ga0070675_1000202073 304
262 3300005354 Ga0070675_100046382 Ga0070675_1000463823 304
263 3300005355 Ga0070671_100041682 Ga0070671_1000416824 304
264 3300005355 Ga0070671_100098487 Ga0070671_1000984874 304
265 3300005365 Ga0070688_100011889 Ga0070688_1000118895 304
266 3300005366 Ga0070659_100022263 Ga0070659_1000222632 304
267 3300005366 Ga0070659_100068909 Ga0070659_1000689091 304
268 3300005366 Ga0070659_100236894 Ga0070659_1002368942 304
269 3300005367 Ga0070667_100100758 Ga0070667_1001007582 304
270 3300005438 Ga0070701_10001211 Ga0070701_100012114 304
271 3300005438 Ga0070701_10169471 Ga0070701_101694712 304
272 3300005440 Ga0070705_100031828 Ga0070705_1000318283 304
273 3300005441 Ga0070700_100000784 Ga0070700_10000078419 304
274 3300005444 Ga0070694_100040337 Ga0070694_1000403372 304
275 3300005445 Ga0070708_100160181 Ga0070708_1001601812 304
276 3300005455 Ga0070663_100000127 Ga0070663_10000012725 304
277 3300005455 Ga0070663_100038045 Ga0070663_1000380453 304
278 3300005456 Ga0070678_100016474 Ga0070678_1000164743 304
279 3300005456 Ga0070678_100175889 Ga0070678_1001758891 304
280 3300005456 Ga0070678_100196870 Ga0070678_1001968702 304
281 3300005457 Ga0070662_100054794 Ga0070662_1000547942 304
282 3300005457 Ga0070662_100062034 Ga0070662_1000620343 304
283 3300005459 Ga0068867_100000191 Ga0068867_10000019122 304
284 3300005466 Ga0070685_10017750 Ga0070685_100177502 304
285 3300005466 Ga0070685_10024345 Ga0070685_100243453 304
286 3300005535 Ga0070684_100034577 Ga0070684_1000345773 304
287 3300005535 Ga0070684_100172039 Ga0070684_1001720392 304
288 3300005539 Ga0068853_100009633 Ga0068853_1000096337 304
289 3300005539 Ga0068853_100038715 Ga0068853_1000387153 304
290 3300005543 Ga0070672_100103955 Ga0070672_1001039552 304
291 3300005544 Ga0070686_100000103 Ga0070686_10000010321 304
292 3300005545 Ga0070695_100019666 Ga0070695_1000196663 304
293 3300005547 Ga0070693_100015766 Ga0070693_1000157661 304
294 3300005549 Ga0070704_100024201 Ga0070704_1000242012 304
295 3300005563 Ga0068855_100041737 Ga0068855_1000417374 304
296 3300005563 Ga0068855_100168578 Ga0068855_1001685782 304
297 3300005564 Ga0070664_100026911 Ga0070664_1000269113 304
298 3300005564 Ga0070664_100095623 Ga0070664_1000956232 304
299 3300005564 Ga0070664_100161563 Ga0070664_1001615633 304
300 3300005578 Ga0068854_100095494 Ga0068854_1000954943 304
301 3300005578 Ga0068854_100153274 Ga0068854_1001532741 304
302 3300005578 Ga0068854_100296856 Ga0068854_1002968562 304
303 3300005614 Ga0068856_100014048 Ga0068856_1000140482 304
304 3300005614 Ga0068856_100267596 Ga0068856_1002675963 304
305 3300005614 Ga0068856_100289712 Ga0068856_1002897122 304
306 3300005615 Ga0070702_100000081 Ga0070702_10000008121 304
307 3300005615 Ga0070702_100116519 Ga0070702_1001165191 304
308 3300005616 Ga0068852_100010121 Ga0068852_1000101217 304
309 3300005616 Ga0068852_100048149 Ga0068852_1000481493 304
310 3300005616 Ga0068852_100205635 Ga0068852_1002056352 304
311 3300005617 Ga0068859_100000560 Ga0068859_10000056024 304
312 3300005617 Ga0068859_100042950 Ga0068859_1000429502 304
313 3300005618 Ga0068864_100000895 Ga0068864_10000089511 304
314 3300005618 Ga0068864_100017183 Ga0068864_1000171833 304
315 3300005618 Ga0068864_100021458 Ga0068864_1000214583 304
316 3300005618 Ga0068864_100027849 Ga0068864_1000278494 304
317 3300005618 Ga0068864_100045997 Ga0068864_1000459973 304
318 3300005718 Ga0068866_10000201 Ga0068866_1000020123 304
319 3300005718 Ga0068866_10015962 Ga0068866_100159622 304
320 3300005718 Ga0068866_10151419 Ga0068866_101514192 304
321 3300005719 Ga0068861_100032122 Ga0068861_1000321222 304
322 3300005719 Ga0068861_100175058 Ga0068861_1001750582 304
323 3300005719 Ga0068861_100245673 Ga0068861_1002456732 304
324 3300005834 Ga0068851_10013154 Ga0068851_100131543 304
325 3300005834 Ga0068851_10138061 Ga0068851_101380612 304
326 3300005840 Ga0068870_10002727 Ga0068870_100027272 304
327 3300005841 Ga0068863_100094258 Ga0068863_1000942583 304
328 3300005841 Ga0068863_100231486 Ga0068863_1002314862 304
329 3300005842 Ga0068858_100000455 Ga0068858_10000045520 304
330 3300005842 Ga0068858_100000721 Ga0068858_1000007217 304
331 3300005842 Ga0068858_100039426 Ga0068858_1000394262 304
332 3300005842 Ga0068858_100101201 Ga0068858_1001012011 304
333 3300005842 Ga0068858_100216887 Ga0068858_1002168872 304
334 3300005843 Ga0068860_100001308 Ga0068860_10000130817 304
335 3300005843 Ga0068860_100147216 Ga0068860_1001472163 304
336 3300005843 Ga0068860_100338034 Ga0068860_1003380342 304
337 3300005844 Ga0068862_100003224 Ga0068862_1000032243 304
338 3300005844 Ga0068862_100154745 Ga0068862_1001547452 304
339 3300005844 Ga0068862_100158895 Ga0068862_1001588952 304
340 3300005844 Ga0068862_100188914 Ga0068862_1001889143 304
341 3300006177 Ga0075362_10189052 Ga0075362_101890521 304
342 3300006237 Ga0097621_100007342 Ga0097621_1000073427 304
343 3300006237 Ga0097621_100158999 Ga0097621_1001589992 304
344 3300006237 Ga0097621_100172735 Ga0097621_1001727353 304
345 3300006358 Ga0068871_100003664 Ga0068871_1000036648 304
346 3300006358 Ga0068871_100026970 Ga0068871_1000269703 304
347 3300006358 Ga0068871_100033926 Ga0068871_1000339262 304
348 3300006846 Ga0075430_100109317 Ga0075430_1001093172 304
349 3300006880 Ga0075429_100001832 Ga0075429_1000018328 304
350 3300006881 Ga0068865_100000113 Ga0068865_10000011320 304
351 3300006931 Ga0097620_100000560 Ga0097620_10000056024 304
352 3300006931 Ga0097620_100042953 Ga0097620_1000429532 304
353 3300006946 Ga0079104_1000037 Ga0079104_10000378 304
354 3300009092 Ga0105250_10005204 Ga0105250_100052043 304
355 3300009093 Ga0105240_10006593 Ga0105240_1000659313 304
356 3300009093 Ga0105240_10412254 Ga0105240_104122542 304
357 3300009094 Ga0111539_10150637 Ga0111539_101506374 304
358 3300009098 Ga0105245_10000681 Ga0105245_100006818 304
359 3300009147 Ga0114129_11057768 Ga0114129_110577681 304
360 3300009148 Ga0105243_10001082 Ga0105243_1000108219 304
361 3300009176 Ga0105242_10059715 Ga0105242_100597153 304
362 3300009177 Ga0105248_10000507 Ga0105248_100005071 304
363 3300009177 Ga0105248_10006243 Ga0105248_100062437 304
364 3300009177 Ga0105248_10015929 Ga0105248_100159294 304
365 3300009545 Ga0105237_10000293 Ga0105237_1000029318 304
366 3300009551 Ga0105238_10002472 Ga0105238_100024725 304
367 3300009551 Ga0105238_10056225 Ga0105238_100562252 304
368 3300010375 Ga0105239_10002229 Ga0105239_1000222912 304
369 3300010375 Ga0105239_10041884 Ga0105239_100418844 304
370 3300011119 Ga0105246_10137644 Ga0105246_101376442 304
371 3300013105 Ga0157369_10045523 Ga0157369_100455234 304
372 3300013296 Ga0157374_10007912 Ga0157374_100079128 304
373 3300013296 Ga0157374_10044586 Ga0157374_100445864 304
374 3300013297 Ga0157378_10000357 Ga0157378_1000035724 304
375 3300013297 Ga0157378_10091957 Ga0157378_100919574 304
376 3300013306 Ga0163162_10032428 Ga0163162_100324284 304
377 3300013307 Ga0157372_10060660 Ga0157372_100606602 304
378 3300013308 Ga0157375_10068089 Ga0157375_100680892 304
379 3300013308 Ga0157375_10072962 Ga0157375_100729623 304
380 3300013308 Ga0157375_10107087 Ga0157375_101070874 304
381 3300013308 Ga0157375_10161038 Ga0157375_101610382 304
382 3300014325 Ga0163163_10010737 Ga0163163_100107371 304
383 3300014325 Ga0163163_10100097 Ga0163163_101000972 304
384 3300014745 Ga0157377_10000851 Ga0157377_100008517 304
385 3300014745 Ga0157377_10021594 Ga0157377_100215942 304
386 3300014968 Ga0157379_10007924 Ga0157379_100079245 304
387 3300014968 Ga0157379_10016573 Ga0157379_100165733 304
388 3300014968 Ga0157379_10054497 Ga0157379_100544972 304
389 3300014968 Ga0157379_10135800 Ga0157379_101358003 304
390 3300014968 Ga0157379_10145880 Ga0157379_101458802 304
391 3300014969 Ga0157376_10006028 Ga0157376_100060288 304
392 3300014969 Ga0157376_10037673 Ga0157376_100376732 304
393 3300014969 Ga0157376_10249327 Ga0157376_102493273 304
394 3300014969 Ga0157376_10366103 Ga0157376_103661032 304
395 3300021361 Ga0213872_10000007 Ga0213872_10000007196 304
396 3300021361 Ga0213872_10001260 Ga0213872_100012609 304
397 3300025290 Ga0207673_1003014 Ga0207673_10030142 304
398 3300025304 Ga0209257_1040921 Ga0209257_10409211 304
399 3300025315 Ga0207697_10004453 Ga0207697_100044533 304
400 3300025321 Ga0207656_10017279 Ga0207656_100172792 304
401 3300025711 Ga0207696_1006923 Ga0207696_10069233 304
402 3300025893 Ga0207682_10000900 Ga0207682_1000090011 304
403 3300025901 Ga0207688_10012874 Ga0207688_100128743 304
404 3300025903 Ga0207680_10001992 Ga0207680_100019929 304
405 3300025907 Ga0207645_10086051 Ga0207645_100860512 304
406 3300025907 Ga0207645_10099664 Ga0207645_100996642 304
407 3300025908 Ga0207643_10002587 Ga0207643_100025875 304
408 3300025908 Ga0207643_10005660 Ga0207643_100056607 304
409 3300025909 Ga0207705_10013870 Ga0207705_100138705 304
410 3300025911 Ga0207654_10252630 Ga0207654_102526302 304
411 3300025913 Ga0207695_10028942 Ga0207695_100289421 304
412 3300025914 Ga0207671_10012562 Ga0207671_100125623 304
413 3300025917 Ga0207660_10230092 Ga0207660_102300922 304
414 3300025918 Ga0207662_10101705 Ga0207662_101017052 304
415 3300025918 Ga0207662_10188706 Ga0207662_101887061 304
416 3300025919 Ga0207657_10011645 Ga0207657_100116458 304
417 3300025919 Ga0207657_10097491 Ga0207657_100974912 304
418 3300025919 Ga0207657_10115989 Ga0207657_101159892 304
419 3300025920 Ga0207649_10030192 Ga0207649_100301922 304
420 3300025920 Ga0207649_10328739 Ga0207649_103287392 304
421 3300025924 Ga0207694_10028093 Ga0207694_100280933 304
422 3300025924 Ga0207694_10066315 Ga0207694_100663152 304
423 3300025925 Ga0207650_10056101 Ga0207650_100561014 304
424 3300025926 Ga0207659_10042734 Ga0207659_100427342 304
425 3300025926 Ga0207659_10069001 Ga0207659_100690014 304
426 3300025926 Ga0207659_10154317 Ga0207659_101543172 304
427 3300025927 Ga0207687_10005916 Ga0207687_100059168 304
428 3300025931 Ga0207644_10036291 Ga0207644_100362913 304
429 3300025931 Ga0207644_10107729 Ga0207644_101077292 304
430 3300025931 Ga0207644_10155410 Ga0207644_101554102 304
431 3300025932 Ga0207690_10242182 Ga0207690_102421822 304
432 3300025933 Ga0207706_10001422 Ga0207706_100014227 304
433 3300025933 Ga0207706_10009838 Ga0207706_100098384 304
434 3300025934 Ga0207686_10000084 Ga0207686_100000848 304
435 3300025935 Ga0207709_10001923 Ga0207709_100019233 304
436 3300025935 Ga0207709_10004553 Ga0207709_100045534 304
437 3300025935 Ga0207709_10142260 Ga0207709_101422602 304
438 3300025936 Ga0207670_10109945 Ga0207670_101099452 304
439 3300025937 Ga0207669_10155549 Ga0207669_101555493 304
440 3300025938 Ga0207704_10000166 Ga0207704_1000016623 304
441 3300025938 Ga0207704_10028245 Ga0207704_100282452 304
442 3300025940 Ga0207691_10016296 Ga0207691_100162965 304
443 3300025940 Ga0207691_10097893 Ga0207691_100978931 304
444 3300025940 Ga0207691_10316187 Ga0207691_103161871 304
445 3300025941 Ga0207711_10014573 Ga0207711_100145733 304
446 3300025941 Ga0207711_10038891 Ga0207711_100388915 304
447 3300025941 Ga0207711_10067741 Ga0207711_100677414 304
448 3300025942 Ga0207689_10000272 Ga0207689_1000027223 304
449 3300025942 Ga0207689_10000937 Ga0207689_1000093710 304
450 3300025942 Ga0207689_10001248 Ga0207689_1000124819 304
451 3300025944 Ga0207661_10029460 Ga0207661_100294603 304
452 3300025944 Ga0207661_10211006 Ga0207661_102110061 304
453 3300025945 Ga0207679_10015894 Ga0207679_100158943 304
454 3300025945 Ga0207679_10104017 Ga0207679_101040172 304
455 3300025945 Ga0207679_10185065 Ga0207679_101850651 304
456 3300025949 Ga0207667_10113456 Ga0207667_101134562 304
457 3300025949 Ga0207667_10563682 Ga0207667_105636821 304
458 3300025960 Ga0207651_10037473 Ga0207651_100374733 304
459 3300025972 Ga0207668_10133598 Ga0207668_101335982 304
460 3300025981 Ga0207640_10006595 Ga0207640_100065953 304
461 3300025981 Ga0207640_10021609 Ga0207640_100216092 304
462 3300025986 Ga0207658_10006686 Ga0207658_100066867 304
463 3300025986 Ga0207658_10091873 Ga0207658_100918732 304
464 3300026023 Ga0207677_10033837 Ga0207677_100338373 304
465 3300026023 Ga0207677_10314858 Ga0207677_103148581 304
466 3300026035 Ga0207703_10000375 Ga0207703_1000037529 304
467 3300026035 Ga0207703_10015188 Ga0207703_100151883 304
468 3300026035 Ga0207703_10019666 Ga0207703_100196662 304
469 3300026035 Ga0207703_10070368 Ga0207703_100703682 304
470 3300026041 Ga0207639_10091865 Ga0207639_100918651 304
471 3300026041 Ga0207639_10252212 Ga0207639_102522122 304
472 3300026067 Ga0207678_10000711 Ga0207678_1000071125 304
473 3300026067 Ga0207678_10003317 Ga0207678_100033175 304
474 3300026067 Ga0207678_10009807 Ga0207678_100098072 304
475 3300026067 Ga0207678_10317485 Ga0207678_103174851 304
476 3300026075 Ga0207708_10000134 Ga0207708_1000013422 304
477 3300026075 Ga0207708_10000749 Ga0207708_100007493 304
478 3300026078 Ga0207702_10010113 Ga0207702_100101136 304
479 3300026078 Ga0207702_10089243 Ga0207702_100892432 304
480 3300026088 Ga0207641_10019018 Ga0207641_100190187 304
481 3300026088 Ga0207641_10510520 Ga0207641_105105201 304
482 3300026089 Ga0207648_10000433 Ga0207648_1000043324 304
483 3300026089 Ga0207648_10002680 Ga0207648_1000268016 304
484 3300026095 Ga0207676_10010703 Ga0207676_100107032 304
485 3300026095 Ga0207676_10051785 Ga0207676_100517854 304
486 3300026095 Ga0207676_10062591 Ga0207676_100625912 304
487 3300026095 Ga0207676_10517730 Ga0207676_105177302 304
488 3300026116 Ga0207674_10026211 Ga0207674_100262112 304
489 3300026116 Ga0207674_10328098 Ga0207674_103280982 304
490 3300026118 Ga0207675_100000490 Ga0207675_10000049017 304
491 3300026118 Ga0207675_100002302 Ga0207675_1000023027 304
492 3300026118 Ga0207675_100026407 Ga0207675_1000264075 304
493 3300026121 Ga0207683_10005797 Ga0207683_100057976 304
494 3300026121 Ga0207683_10012464 Ga0207683_100124646 304
495 3300026121 Ga0207683_10166311 Ga0207683_101663112 304
496 3300026142 Ga0207698_10002753 Ga0207698_100027535 304
497 3300026142 Ga0207698_10247142 Ga0207698_102471421 304
498 3300027111 Ga0209281_1000002 Ga0209281_1000002792 304
499 3300027665 Ga0209983_1018933 Ga0209983_10189332 304
500 3300028379 Ga0268266_10164311 Ga0268266_101643113 304
501 3300028379 Ga0268266_10429243 Ga0268266_104292431 304
502 3300028380 Ga0268265_10010067 Ga0268265_100100673 304
503 3300028380 Ga0268265_10135597 Ga0268265_101355972 304
504 3300028381 Ga0268264_10004638 Ga0268264_100046388 304
505 3300028794 Ga0307515_10027638 Ga0307515_100276387 304
506 3300031507 Ga0307509_10062175 Ga0307509_100621753 304
507 3300031548 Ga0307408_100004119 Ga0307408_1000041195 304
508 3300031649 Ga0307514_10000355 Ga0307514_1000035577 304
509 3300031691 Ga0316579_10001716 Ga0316579_100017162 304
510 3300031728 Ga0316578_10014936 Ga0316578_100149361 304
511 3300031730 Ga0307516_10171053 Ga0307516_101710531 304
512 3300031901 Ga0307406_10003644 Ga0307406_100036444 304
513 3300031911 Ga0307412_10172533 Ga0307412_101725332 304
514 3300032002 Ga0307416_100326714 Ga0307416_1003267142 304
515 3300035170 Ga0373943_0130977 Ga0373943_0130977_240_1160 304
516 3300035691 Ga0373931_0000882 Ga0373931_0000882_8602_9522 304
517 3300035691 Ga0373931_0056926 Ga0373931_0056926_555_1475 304
518 3300035695 Ga0373927_0119654 Ga0373927_0119654_646_1563 304
519 3300036401 Ga0373937_0186202 Ga0373937_0186202_758_1678 304
520 3300036647 Ga0316582_0011481 Ga0316582_0011481_1330_2250 304
521 3300037068 Ga0373925_0073937 Ga0373925_0073937_474_1391 304
522 3300037068 Ga0373925_0157574 Ga0373925_0157574_591_1511 304
523 3300037471 Ga0395905_0001659 Ga0395905_0001659_15935_16852 304
524 3300037471 Ga0395905_0053160 Ga0395905_0053160_1805_2728 304
525 3300039447 Ga0436361_0021397 Ga0436361_0021397_39063_39980 304
526 3300039447 Ga0436361_0163583 Ga0436361_0163583_30820_31734 304
527 3300039447 Ga0436361_0694318 Ga0436361_0694318_10264_11190 304
528 3300042435 Ga0439434_0053546 Ga0439434_0053546_271_1197 304
529 3300042531 Ga0450918_000419 Ga0450918_000419_2316_3236 304
530 3300042532 Ga0450893_0009516 Ga0450893_0009516_330_1256 304
531 3300042876 Ga0451577_0003355 Ga0451577_0003355_15406_16368 304
532 3300042876 Ga0451577_0011238 Ga0451577_0011238_7378_8298 304
533 3300044712 Ga0453684_0098650 Ga0453684_0098650_1222_2139 304
534 3300046454 Ga0495592_0000307 Ga0495592_0000307_30761_31681 304
535 3300046457 Ga0495590_0001456 Ga0495590_0001456_342_1259 304
536 3300046542 Ga0495597_0000054 Ga0495597_0000054_70949_71866 304
537 3300046558 Ga0495633_0001764 Ga0495633_0001764_220_1137 304
538 3300046681 Ga0495647_0048038 Ga0495647_0048038_350_1267 304
539 3300048903 Ga0496100_0119952 Ga0496100_0119952_279_1199 304
540 3300048904 Ga0496101_0035120 Ga0496101_0035120_2523_3443 304
541 3300048904 Ga0496101_0138814 Ga0496101_0138814_867_1787 304
542 3300048905 Ga0496102_0012909 Ga0496102_0012909_203_1123 304
543 3300048905 Ga0496102_0352231 Ga0496102_0352231_329_1249 304
544 3300048907 Ga0496104_0077458 Ga0496104_0077458_1946_2866 304
545 3300048907 Ga0496104_0362256 Ga0496104_0362256_394_1314 304
546 3300048908 Ga0496105_0031152 Ga0496105_0031152_2633_3550 304
547 3300048908 Ga0496105_0220206 Ga0496105_0220206_595_1515 304
548 3300048909 Ga0496106_0023412 Ga0496106_0023412_2076_2996 304
549 3300048909 Ga0496106_0063643 Ga0496106_0063643_1607_2527 304
550 3300048910 Ga0496107_0073536 Ga0496107_0073536_1537_2457 304
551 3300048910 Ga0496107_0241731 Ga0496107_0241731_352_1272 304
552 3300048911 Ga0496108_0096804 Ga0496108_0096804_595_1515 304
553 3300048912 Ga0496109_0027726 Ga0496109_0027726_2308_3228 304
554 3300048912 Ga0496109_0084402 Ga0496109_0084402_437_1357 304
555 3300048913 Ga0496110_0058616 Ga0496110_0058616_1780_2700 304
556 3300048913 Ga0496110_0110927 Ga0496110_0110927_58_978 304
557 3300048914 Ga0496111_0111703 Ga0496111_0111703_754_1674 304
558 3300048915 Ga0496112_0110815 Ga0496112_0110815_1274_2194 304
559 3300048915 Ga0496112_0394269 Ga0496112_0394269_119_1036 304
560 3300048917 Ga0496114_0035179 Ga0496114_0035179_2644_3564 304
561 3300048917 Ga0496114_0172549 Ga0496114_0172549_353_1270 304
562 3300048917 Ga0496114_0466587 Ga0496114_0466587_149_1069 304
563 3300048918 Ga0496115_0038526 Ga0496115_0038526_1833_2753 304
564 3300049515 Ga0501292_006324 Ga0501292_006324_351_1271 304
565 3300049571 Ga0501034_0306624 Ga0501034_0306624_133_1050 304
566 3300049579 Ga0501043_0000012 Ga0501043_0000012_89050_89970 304
567 3300049580 Ga0501046_0000030 Ga0501046_0000030_89022_89942 304
568 3300049581 Ga0501047_0000049 Ga0501047_0000049_63719_64639 304
569 3300049582 Ga0501048_0000082 Ga0501048_0000082_40381_41301 304
570 3300049658 Ga0501211_001400 Ga0501211_001400_1552_2466 304
571 3300049744 Ga0501083_0010638 Ga0501083_0010638_2724_3644 304
572 3300049764 Ga0501267_000300 Ga0501267_000300_934_1848 304
573 3300049823 Ga0501044_0180647 Ga0501044_0180647_912_1832 304
574 3300049824 Ga0501045_0003743 Ga0501045_0003743_6530_7450 304
575 3300050493 nmdc:mga0k408_158154_c1 nmdc:mga0k408_158154_c1_25_945 304
576 3300050508 nmdc:mga09592_1124_c1 nmdc:mga09592_1124_c1_18888_19808 304
577 3300050509 nmdc:mga0qj67_290918_c1 nmdc:mga0qj67_290918_c1_164_1084 304
578 3300059421 Ga0590071_028275 Ga0590071_028275_187_1113 304
579 3300059424 Ga0590075_006183 Ga0590075_006183_617_1543 304
580 2162886007 SwRhRL2b_contig_1290167 SwRhRL2b_0183.00003660 305
581 3300005289 Ga0065704_10004249 Ga0065704_100042497 305
582 3300005548 Ga0070665_100061618 Ga0070665_1000616182 305
583 3300048924 Ga0496121_0001278 Ga0496121_0001278_31884_32801 305
584 3300048927 Ga0496124_0074561 Ga0496124_0074561_508_1425 305
585 3300048928 Ga0496125_0107227 Ga0496125_0107227_121_1038 305
586 3300048929 Ga0496126_0029704 Ga0496126_0029704_2270_3187 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

6

290

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3x43-assembly2.cif.gz_H crystal structure of o-ureido-l-serine synthase 0.9587 1 298
3x44-assembly1.cif.gz_A crystal structure of o-ureido-l-serine-bound k43a mutant of o-ureido-l-serine synthase 0.957 1 299
1o58-assembly1.cif.gz_D crystal structure of o-acetylserine sulfhydrylase (tm0665) from thermotoga maritima at 1.80 a resolution 0.9564 6 299
3fca-assembly1.cif.gz_A genetic incorporation of a metal-ion chelating amino acid into proteins as biophysical probe 0.9542 5 299
1o58-assembly1.cif.gz_B crystal structure of o-acetylserine sulfhydrylase (tm0665) from thermotoga maritima at 1.80 a resolution 0.9525 6 299
ID Description Score Start End Superfamily
af_Q2G0V4_40_140_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9667 43 143 3.40.50.1100
5b1iC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9605 42 139 3.40.50.1100
af_K7L749_14_232_2.10.25.10 Mainly Beta;Ribbon;Laminin;Laminin 0.958 10 233 2.10.25.10
3dkiB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9547 42 151 3.40.50.1100
1j6nA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9532 156 299 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A7Y4J7I4-F1-model_v4 deleted 0.9897 41 183
AF-A0A257NPR7-F1-model_v4 Cysteine synthase (EC 2.5.1.47) 0.9834 1 305 GO:0004124
GO:0006535
AF-A0A3M6QIX4-F1-model_v4 Cysteine synthase (EC 2.5.1.47) 0.9822 1 305 GO:0004124
GO:0006535
AF-A0A7Y0NM23-F1-model_v4 deleted 0.9819 1 303
AF-A0A259KJR6-F1-model_v4 Cysteine synthase (EC 2.5.1.47) 0.9818 1 305 GO:0004124
GO:0006535

Feature Viewer

pLDDT pTM Quality
90.15 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map