F466536

General Info

Members Datasets Scaffolds Average Seq Length
586 242 585 223

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100018651|Ga0068860_1000186511
Length 242
Sequence MPMNFSKAYRHYSKLLYTLILILFISNKSFAQIDPPTARTDTIAPIPPLSERAKKWGPNDTIIVSAIWYQNELLPYKEMEMAWVSNMPPDKLAKWVEEWTRLRNAVYVTYPYARIAGITINDINGHMNGMSKKQRKAYIKTREKELKKQFADPLSNLSVYQGKILMKLINRQTGNNCYEIVKEYRGGVTARLYQTVAFFFGSNMKQDWDLKEKTDREIENIVKEIDGSWYNNPYRPGIAPSR

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
157 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
158 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
159 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
164 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
165 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
212 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
213 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
214 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
215 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
222 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
232 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
233 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
234 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
235 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
236 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
239 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.17
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.73
Nodule 0
Rhizoplane 1.37
Rhizosphere 94.2
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1008240 3300001904 Bacteria 1734
2 JGI25154J39366_1009323 3300002738 Bacteria 1214
3 Ga0065712_10010653 3300005290 Bacteria 2753
4 Ga0065712_10068728 3300005290 Bacteria 9217
5 Ga0065712_10131631 3300005290 Bacteria 1538
6 Ga0065715_10309646 3300005293 Bacteria 977
7 Ga0070658_10000438 3300005327 Bacteria 36124
8 Ga0070676_10025781 3300005328 Bacteria 3325
9 Ga0070683_100004631 3300005329 Bacteria 11359
10 Ga0070683_100011439 3300005329 Bacteria 7671
11 Ga0070683_100113430 3300005329 Bacteria 2558
12 Ga0070690_100180278 3300005330 Bacteria 1459
13 Ga0070690_100321880 3300005330 Bacteria 1114
14 Ga0070670_100048717 3300005331 Unclassified 3646
15 Ga0070677_10092274 3300005333 Unclassified 1319
16 Ga0068869_100004499 3300005334 Bacteria 8672
17 Ga0068869_100008279 3300005334 Bacteria 6699
18 Ga0068869_100018905 3300005334 Bacteria 4697
19 Ga0068869_100049089 3300005334 Unclassified 3054
20 Ga0068869_100078482 3300005334 Bacteria 2459
21 Ga0068869_100081079 3300005334 Bacteria 2422
22 Ga0068869_100098516 3300005334 Bacteria 2208
23 Ga0068869_100548557 3300005334 Bacteria 971
24 Ga0070666_10000405 3300005335 Bacteria 27033
25 Ga0070666_10006706 3300005335 Bacteria 7087
26 Ga0070666_10023370 3300005335 Bacteria 4024
27 Ga0070666_10050150 3300005335 Bacteria 2807
28 Ga0070666_10246892 3300005335 Bacteria 1263
29 Ga0070682_100494482 3300005337 Bacteria 946
30 Ga0068868_100013667 3300005338 Bacteria 5962
31 Ga0068868_100052068 3300005338 Bacteria 3223
32 Ga0068868_100563140 3300005338 Bacteria 1006
33 Ga0068868_100624971 3300005338 Bacteria 956
34 Ga0070660_100463592 3300005339 Bacteria 1052
35 Ga0070689_100020116 3300005340 Unclassified 4949
36 Ga0070689_100055284 3300005340 Unclassified 3075
37 Ga0070689_100083918 3300005340 Bacteria 2503
38 Ga0070689_100118384 3300005340 Unclassified 2113
39 Ga0070661_100003972 3300005344 Bacteria 10173
40 Ga0070661_100024577 3300005344 Bacteria 4321
41 Ga0070661_100036304 3300005344 Unclassified 3582
42 Ga0070668_100022068 3300005347 Unclassified 4812
43 Ga0070668_100049495 3300005347 Bacteria 3233
44 Ga0070668_100344044 3300005347 Bacteria 1261
45 Ga0070668_100413650 3300005347 Bacteria 1153
46 Ga0070669_100008945 3300005353 Bacteria 7146
47 Ga0070669_100125776 3300005353 Bacteria 1961
48 Ga0070669_100194920 3300005353 Unclassified 1591
49 Ga0070669_100210210 3300005353 Bacteria 1534
50 Ga0070675_100001853 3300005354 Bacteria 15590
51 Ga0070671_100094064 3300005355 Bacteria 2511
52 Ga0070671_100279417 3300005355 Bacteria 1420
53 Ga0070671_100900465 3300005355 Bacteria 773
54 Ga0070673_100014003 3300005364 Bacteria 5570
55 Ga0070673_100023170 3300005364 Unclassified 4533
56 Ga0070673_100119283 3300005364 Bacteria 2198
57 Ga0070673_100287186 3300005364 Bacteria 1445
58 Ga0070688_100000797 3300005365 Bacteria 15547
59 Ga0070688_100011740 3300005365 Bacteria 4882
60 Ga0070688_100037727 3300005365 Bacteria 2946
61 Ga0070659_100002732 3300005366 Bacteria 12552
62 Ga0070659_100212993 3300005366 Bacteria 1593
63 Ga0070667_100026170 3300005367 Bacteria 4852
64 Ga0070667_100087580 3300005367 Bacteria 2673
65 Ga0070667_100090221 3300005367 Bacteria 2634
66 Ga0070667_100349767 3300005367 Bacteria 1338
67 Ga0070667_100427227 3300005367 Bacteria 1208
68 Ga0070667_101015566 3300005367 Bacteria 774
69 Ga0070701_10016422 3300005438 Bacteria 3442
70 Ga0070694_100211633 3300005444 Bacteria 1450
71 Ga0070708_100323811 3300005445 Bacteria 1452
72 Ga0070678_100082275 3300005456 Bacteria 2444
73 Ga0070678_100115240 3300005456 Bacteria 2109
74 Ga0070678_100487912 3300005456 Bacteria 1085
75 Ga0070662_100005152 3300005457 Bacteria 8336
76 Ga0070662_100069184 3300005457 Unclassified 2597
77 Ga0070662_100086663 3300005457 Bacteria 2343
78 Ga0070662_100179319 3300005457 Bacteria 1669
79 Ga0070662_100445415 3300005457 Bacteria 1074
80 Ga0068867_100026189 3300005459 Bacteria 4186
81 Ga0068867_100029278 3300005459 Bacteria 3967
82 Ga0068867_100121730 3300005459 Unclassified 2017
83 Ga0068867_100134048 3300005459 Bacteria 1928
84 Ga0068867_100689375 3300005459 Bacteria 900
85 Ga0070685_10021915 3300005466 Bacteria 3476
86 Ga0070685_10037819 3300005466 Bacteria 2735
87 Ga0070685_10051544 3300005466 Bacteria 2379
88 Ga0070685_10282834 3300005466 Bacteria 1111
89 Ga0070707_100121011 3300005468 Bacteria 2542
90 Ga0070698_100001497 3300005471 Bacteria 25950
91 Ga0070698_100005363 3300005471 Bacteria 14025
92 Ga0070698_100010867 3300005471 Bacteria 9686
93 Ga0070699_100160848 3300005518 Bacteria 1987
94 Ga0070684_100002706 3300005535 Bacteria 13093
95 Ga0070684_100062723 3300005535 Unclassified 3256
96 Ga0068853_100002920 3300005539 Bacteria 12997
97 Ga0068853_100015298 3300005539 Bacteria 6306
98 Ga0068853_100131206 3300005539 Bacteria 2243
99 Ga0068853_100205366 3300005539 Bacteria 1794
100 Ga0068853_100397513 3300005539 Bacteria 1289
101 Ga0070672_100061466 3300005543 Bacteria 2961
102 Ga0070672_100098607 3300005543 Bacteria 2367
103 Ga0070672_100317045 3300005543 Bacteria 1325
104 Ga0070686_100116920 3300005544 Bacteria 1825
105 Ga0070686_100283841 3300005544 Bacteria 1222
106 Ga0070693_100478272 3300005547 Unclassified 879
107 Ga0070665_100029139 3300005548 Bacteria 5556
108 Ga0070665_100130723 3300005548 Bacteria 2513
109 Ga0070665_100346961 3300005548 Bacteria 1489
110 Ga0070665_100525738 3300005548 Bacteria 1195
111 Ga0068855_100011667 3300005563 Bacteria 10620
112 Ga0070664_100004774 3300005564 Bacteria 10857
113 Ga0070664_100034556 3300005564 Bacteria 4241
114 Ga0070664_100057696 3300005564 Bacteria 3300
115 Ga0070664_100060571 3300005564 Unclassified 3223
116 Ga0070664_100137723 3300005564 Bacteria 2148
117 Ga0070664_100281294 3300005564 Bacteria 1500
118 Ga0068857_100015228 3300005577 Bacteria 6711
119 Ga0068857_100018587 3300005577 Bacteria 6098
120 Ga0068857_100049312 3300005577 Bacteria 3735
121 Ga0068857_100089884 3300005577 Bacteria 2748
122 Ga0068857_100170871 3300005577 Bacteria 1976
123 Ga0068854_100013566 3300005578 Bacteria 5353
124 Ga0068854_100086750 3300005578 Bacteria 2321
125 Ga0068854_100633876 3300005578 Bacteria 916
126 Ga0068856_100620687 3300005614 Bacteria 1102
127 Ga0068852_100014252 3300005616 Bacteria 6111
128 Ga0068852_100154668 3300005616 Bacteria 2135
129 Ga0068852_100473775 3300005616 Unclassified 1243
130 Ga0068852_100787356 3300005616 Bacteria 965
131 Ga0068852_100790562 3300005616 Bacteria 963
132 Ga0068859_100000066 3300005617 Bacteria 100640
133 Ga0068859_100020688 3300005617 Bacteria 6603
134 Ga0068859_100064949 3300005617 Unclassified 3683
135 Ga0068859_100065804 3300005617 Bacteria 3658
136 Ga0068859_100069771 3300005617 Unclassified 3550
137 Ga0068859_100164619 3300005617 Bacteria 2297
138 Ga0068859_100225170 3300005617 Bacteria 1963
139 Ga0068859_100392642 3300005617 Bacteria 1483
140 Ga0068859_100599222 3300005617 Unclassified 1195
141 Ga0068859_101224369 3300005617 Bacteria 827
142 Ga0068864_100053379 3300005618 Bacteria 3486
143 Ga0068864_100120854 3300005618 Bacteria 2342
144 Ga0068864_100234932 3300005618 Bacteria 1697
145 Ga0068864_100345393 3300005618 Bacteria 1403
146 Ga0068866_10036116 3300005718 Bacteria 2419
147 Ga0068866_10042763 3300005718 Unclassified 2257
148 Ga0068861_100010078 3300005719 Bacteria 6553
149 Ga0068861_100105363 3300005719 Bacteria 2251
150 Ga0068861_100369180 3300005719 Bacteria 1264
151 Ga0068870_10009000 3300005840 Bacteria 4518
152 Ga0068870_10093881 3300005840 Bacteria 1683
153 Ga0068870_10179378 3300005840 Bacteria 1270
154 Ga0068863_100002306 3300005841 Bacteria 18971
155 Ga0068863_100034806 3300005841 Bacteria 4797
156 Ga0068863_100134435 3300005841 Bacteria 2362
157 Ga0068863_100462614 3300005841 Bacteria 1246
158 Ga0068858_100097299 3300005842 Bacteria 2744
159 Ga0068858_100276628 3300005842 Bacteria 1598
160 Ga0068858_101027672 3300005842 Bacteria 808
161 Ga0068858_101086112 3300005842 Bacteria 785
162 Ga0068860_100013138 3300005843 Bacteria 8126
163 Ga0068860_100018651 3300005843 Bacteria 6747
164 Ga0068860_100111999 3300005843 Bacteria 2609
165 Ga0068860_100552535 3300005843 Bacteria 1154
166 Ga0068862_100070113 3300005844 Unclassified 3026
167 Ga0068862_100226233 3300005844 Bacteria 1695
168 Ga0068862_100236250 3300005844 Bacteria 1660
169 Ga0068862_100484274 3300005844 Unclassified 1171
170 Ga0068862_100523223 3300005844 Bacteria 1129
171 Ga0068862_100706493 3300005844 Bacteria 977
172 Ga0068862_101071352 3300005844 Unclassified 800
173 Ga0070715_10005844 3300006163 Bacteria 4141
174 Ga0075366_10011952 3300006195 Bacteria 4916
175 Ga0075366_10056906 3300006195 Bacteria 2323
176 Ga0097621_100006713 3300006237 Bacteria 8179
177 Ga0097621_100007600 3300006237 Bacteria 7766
178 Ga0097621_100276679 3300006237 Bacteria 1477
179 Ga0068871_100007069 3300006358 Bacteria 8001
180 Ga0068871_100023301 3300006358 Bacteria 4786
181 Ga0068871_100120331 3300006358 Bacteria 2217
182 Ga0068871_100202679 3300006358 Bacteria 1713
183 Ga0068871_100519739 3300006358 Bacteria 1075
184 Ga0075428_100025952 3300006844 Bacteria 6488
185 Ga0075428_100049741 3300006844 Bacteria 4599
186 Ga0075428_100179564 3300006844 Bacteria 2292
187 Ga0075430_100018064 3300006846 Bacteria 6003
188 Ga0075431_100032821 3300006847 Bacteria 5350
189 Ga0075429_100002013 3300006880 Bacteria 16893
190 Ga0075429_100053015 3300006880 Bacteria 3529
191 Ga0068865_100308216 3300006881 Bacteria 1269
192 Ga0068865_100357419 3300006881 Bacteria 1185
193 Ga0097620_100000066 3300006931 Bacteria 100640
194 Ga0097620_100020689 3300006931 Bacteria 6603
195 Ga0097620_100064950 3300006931 Unclassified 3683
196 Ga0097620_100065800 3300006931 Bacteria 3658
197 Ga0097620_100069772 3300006931 Unclassified 3550
198 Ga0097620_100164625 3300006931 Bacteria 2297
199 Ga0097620_100225172 3300006931 Bacteria 1963
200 Ga0097620_100392655 3300006931 Bacteria 1483
201 Ga0097620_100599096 3300006931 Unclassified 1195
202 Ga0097620_101224145 3300006931 Bacteria 827
203 Ga0105240_10774088 3300009093 Bacteria 1041
204 Ga0111539_10001795 3300009094 Bacteria 28548
205 Ga0111539_10046172 3300009094 Bacteria 5212
206 Ga0111539_10473606 3300009094 Unclassified 1458
207 Ga0111539_10679533 3300009094 Bacteria 1199
208 Ga0105245_10366128 3300009098 Bacteria 1432
209 Ga0105247_10004365 3300009101 Bacteria 9034
210 Ga0105247_10156132 3300009101 Bacteria 1507
211 Ga0105247_10475348 3300009101 Bacteria 906
212 Ga0114129_10012913 3300009147 Bacteria 11885
213 Ga0114129_10082280 3300009147 Bacteria 4474
214 Ga0114129_10154899 3300009147 Unclassified 3134
215 Ga0105243_10111456 3300009148 Bacteria 2290
216 Ga0105243_11157221 3300009148 Bacteria 785
217 Ga0105241_10048477 3300009174 Bacteria 3233
218 Ga0105241_10475917 3300009174 Unclassified 1109
219 Ga0105242_10012895 3300009176 Bacteria 6442
220 Ga0105242_10036375 3300009176 Bacteria 3950
221 Ga0105242_10110461 3300009176 Unclassified 2342
222 Ga0105242_10115683 3300009176 Bacteria 2293
223 Ga0105242_10201097 3300009176 Unclassified 1770
224 Ga0105242_10220448 3300009176 Bacteria 1695
225 Ga0105242_10668963 3300009176 Bacteria 1012
226 Ga0105248_10501116 3300009177 Bacteria 1369
227 Ga0105248_10670491 3300009177 Bacteria 1170
228 Ga0105237_10003163 3300009545 Bacteria 19782
229 Ga0105237_10073316 3300009545 Bacteria 3416
230 Ga0105237_10390294 3300009545 Bacteria 1397
231 Ga0105249_10003050 3300009553 Bacteria 14455
232 Ga0105249_10020018 3300009553 Bacteria 5975
233 Ga0105249_10053584 3300009553 Bacteria 3687
234 Ga0105249_10078787 3300009553 Bacteria 3058
235 Ga0105249_10083226 3300009553 Unclassified 2978
236 Ga0105249_10238904 3300009553 Bacteria 1795
237 Ga0105249_10826046 3300009553 Unclassified 991
238 Ga0105246_10031640 3300011119 Bacteria 3502
239 Ga0105246_10163694 3300011119 Bacteria 1697
240 Ga0105246_10191272 3300011119 Bacteria 1584
241 Ga0105246_10640410 3300011119 Bacteria 924
242 Ga0157373_10025136 3300013100 Unclassified 4311
243 Ga0157371_10113005 3300013102 Bacteria 1928
244 Ga0157371_10158876 3300013102 Bacteria 1614
245 Ga0157371_10200512 3300013102 Bacteria 1430
246 Ga0157369_10595359 3300013105 Bacteria 1141
247 Ga0157374_10000607 3300013296 Bacteria 31733
248 Ga0157374_10052899 3300013296 Bacteria 3784
249 Ga0157378_10059214 3300013297 Bacteria 3417
250 Ga0157378_10073652 3300013297 Unclassified 3071
251 Ga0163162_10001227 3300013306 Bacteria 23959
252 Ga0163162_10019698 3300013306 Bacteria 6623
253 Ga0163162_10031957 3300013306 Bacteria 5225
254 Ga0163162_10054154 3300013306 Bacteria 4035
255 Ga0163162_10055510 3300013306 Bacteria 3988
256 Ga0163162_10059113 3300013306 Unclassified 3865
257 Ga0163162_10209333 3300013306 Bacteria 2080
258 Ga0157372_10046610 3300013307 Bacteria 4812
259 Ga0157372_10189734 3300013307 Bacteria 2380
260 Ga0157372_10263616 3300013307 Bacteria 2001
261 Ga0157372_10565903 3300013307 Bacteria 1325
262 Ga0157375_10043460 3300013308 Bacteria 4359
263 Ga0157375_10077744 3300013308 Bacteria 3349
264 Ga0157375_10121536 3300013308 Bacteria 2721
265 Ga0157375_10124965 3300013308 Unclassified 2686
266 Ga0157375_10625963 3300013308 Bacteria 1234
267 Ga0157375_10656302 3300013308 Bacteria 1205
268 Ga0157375_10688956 3300013308 Bacteria 1176
269 Ga0163163_10000078 3300014325 Bacteria 107017
270 Ga0163163_10039910 3300014325 Bacteria 4583
271 Ga0163163_10182792 3300014325 Bacteria 2144
272 Ga0163163_10213378 3300014325 Bacteria 1979
273 Ga0163163_10537561 3300014325 Bacteria 1231
274 Ga0157380_10008693 3300014326 Bacteria 7259
275 Ga0157380_10055217 3300014326 Unclassified 3153
276 Ga0157380_10250400 3300014326 Bacteria 1603
277 Ga0157377_10000903 3300014745 Bacteria 12391
278 Ga0157377_10030207 3300014745 Bacteria 2933
279 Ga0157377_10098499 3300014745 Bacteria 1738
280 Ga0157379_10188270 3300014968 Bacteria 1865
281 Ga0157379_10335440 3300014968 Bacteria 1382
282 Ga0157379_10640932 3300014968 Bacteria 994
283 Ga0157376_10022328 3300014969 Bacteria 4931
284 Ga0157376_10043460 3300014969 Bacteria 3688
285 Ga0157376_10062805 3300014969 Bacteria 3127
286 Ga0157376_10119413 3300014969 Bacteria 2334
287 Ga0157376_10218499 3300014969 Bacteria 1764
288 Ga0157376_10256203 3300014969 Bacteria 1637
289 Ga0157376_10274540 3300014969 Unclassified 1585
290 Ga0157376_10296059 3300014969 Bacteria 1530
291 Ga0157376_10303419 3300014969 Bacteria 1512
292 Ga0157376_11103054 3300014969 Bacteria 819
293 Ga0163161_10003903 3300017792 Bacteria 10455
294 Ga0163161_10127277 3300017792 Bacteria 1919
295 Ga0209646_1002144 3300025246 Bacteria 4583
296 Ga0207697_10173301 3300025315 Bacteria 944
297 Ga0207642_10064423 3300025899 Bacteria 1718
298 Ga0207688_10009233 3300025901 Bacteria 5373
299 Ga0207688_10218177 3300025901 Bacteria 1148
300 Ga0207680_10000143 3300025903 Bacteria 34125
301 Ga0207680_10005367 3300025903 Bacteria 6119
302 Ga0207680_10250428 3300025903 Bacteria 1223
303 Ga0207680_10510644 3300025903 Unclassified 856
304 Ga0207647_10011499 3300025904 Bacteria 6205
305 Ga0207647_10072657 3300025904 Bacteria 2074
306 Ga0207685_10089374 3300025905 Bacteria 1293
307 Ga0207645_10002535 3300025907 Bacteria 14293
308 Ga0207645_10011599 3300025907 Bacteria 6010
309 Ga0207645_10042618 3300025907 Unclassified 2904
310 Ga0207643_10008176 3300025908 Bacteria 5615
311 Ga0207643_10021539 3300025908 Bacteria 3542
312 Ga0207643_10042481 3300025908 Bacteria 2564
313 Ga0207654_10012016 3300025911 Bacteria 4428
314 Ga0207654_10081792 3300025911 Bacteria 1946
315 Ga0207671_10001491 3300025914 Bacteria 27003
316 Ga0207671_10041039 3300025914 Bacteria 3424
317 Ga0207671_10433329 3300025914 Bacteria 1046
318 Ga0207657_10421182 3300025919 Bacteria 1049
319 Ga0207649_10052049 3300025920 Bacteria 2539
320 Ga0207649_10054025 3300025920 Bacteria 2498
321 Ga0207649_10172393 3300025920 Bacteria 1508
322 Ga0207681_10024153 3300025923 Unclassified 3898
323 Ga0207681_10075182 3300025923 Unclassified 2369
324 Ga0207681_10121929 3300025923 Bacteria 1913
325 Ga0207681_10286346 3300025923 Bacteria 1299
326 Ga0207650_10027536 3300025925 Bacteria 4070
327 Ga0207659_10037945 3300025926 Unclassified 3348
328 Ga0207659_10083185 3300025926 Bacteria 2372
329 Ga0207659_10301466 3300025926 Bacteria 1316
330 Ga0207644_10548739 3300025931 Bacteria 956
331 Ga0207644_10693266 3300025931 Bacteria 849
332 Ga0207690_10057952 3300025932 Bacteria 2618
333 Ga0207690_10098514 3300025932 Bacteria 2082
334 Ga0207706_10004992 3300025933 Bacteria 12392
335 Ga0207706_10020423 3300025933 Bacteria 5955
336 Ga0207706_10194688 3300025933 Bacteria 1778
337 Ga0207686_10006728 3300025934 Bacteria 6193
338 Ga0207686_10075107 3300025934 Bacteria 2187
339 Ga0207670_10011453 3300025936 Bacteria 5151
340 Ga0207670_10012045 3300025936 Bacteria 5042
341 Ga0207670_10124309 3300025936 Bacteria 1880
342 Ga0207670_10131657 3300025936 Bacteria 1833
343 Ga0207670_10150459 3300025936 Bacteria 1726
344 Ga0207704_10054986 3300025938 Bacteria 2430
345 Ga0207704_10520746 3300025938 Bacteria 962
346 Ga0207704_10646711 3300025938 Unclassified 870
347 Ga0207691_10035080 3300025940 Bacteria 4660
348 Ga0207691_10038775 3300025940 Bacteria 4409
349 Ga0207691_10079706 3300025940 Bacteria 2947
350 Ga0207691_10153081 3300025940 Bacteria 2027
351 Ga0207691_10406403 3300025940 Unclassified 1161
352 Ga0207689_10002539 3300025942 Bacteria 16945
353 Ga0207689_10008970 3300025942 Bacteria 8665
354 Ga0207689_10025673 3300025942 Bacteria 4936
355 Ga0207689_10028313 3300025942 Bacteria 4687
356 Ga0207689_10029184 3300025942 Bacteria 4609
357 Ga0207689_10087767 3300025942 Bacteria 2555
358 Ga0207689_10161349 3300025942 Bacteria 1847
359 Ga0207689_10212142 3300025942 Unclassified 1600
360 Ga0207689_10234677 3300025942 Bacteria 1516
361 Ga0207661_10011446 3300025944 Bacteria 6429
362 Ga0207661_10048223 3300025944 Unclassified 3383
363 Ga0207661_10091625 3300025944 Bacteria 2533
364 Ga0207661_10837248 3300025944 Bacteria 847
365 Ga0207679_10010266 3300025945 Bacteria 6025
366 Ga0207679_10045764 3300025945 Bacteria 3167
367 Ga0207679_10150261 3300025945 Bacteria 1895
368 Ga0207679_10214221 3300025945 Bacteria 1617
369 Ga0207667_10014746 3300025949 Bacteria 8894
370 Ga0207667_10340325 3300025949 Bacteria 1531
371 Ga0207651_10009245 3300025960 Bacteria 5381
372 Ga0207651_10084605 3300025960 Bacteria 2298
373 Ga0207651_10189260 3300025960 Bacteria 1640
374 Ga0207712_10014692 3300025961 Bacteria 5042
375 Ga0207712_10016748 3300025961 Unclassified 4752
376 Ga0207712_10047041 3300025961 Bacteria 2993
377 Ga0207712_10163320 3300025961 Bacteria 1733
378 Ga0207712_10555364 3300025961 Bacteria 988
379 Ga0207668_10204799 3300025972 Unclassified 1574
380 Ga0207668_10355276 3300025972 Unclassified 1226
381 Ga0207668_10482449 3300025972 Bacteria 1063
382 Ga0207668_10771577 3300025972 Bacteria 849
383 Ga0207640_10077923 3300025981 Bacteria 2254
384 Ga0207640_10343119 3300025981 Bacteria 1197
385 Ga0207658_10029958 3300025986 Bacteria 3849
386 Ga0207658_10172822 3300025986 Bacteria 1782
387 Ga0207658_10183780 3300025986 Bacteria 1732
388 Ga0207677_10013387 3300026023 Unclassified 4752
389 Ga0207677_10041530 3300026023 Bacteria 3042
390 Ga0207677_10112629 3300026023 Bacteria 2029
391 Ga0207677_10140129 3300026023 Bacteria 1850
392 Ga0207703_10002420 3300026035 Bacteria 16204
393 Ga0207703_10042065 3300026035 Bacteria 3663
394 Ga0207639_10002438 3300026041 Bacteria 12502
395 Ga0207639_10010753 3300026041 Bacteria 6341
396 Ga0207639_10084906 3300026041 Bacteria 2516
397 Ga0207639_10193447 3300026041 Bacteria 1739
398 Ga0207639_10194944 3300026041 Bacteria 1733
399 Ga0207639_10692832 3300026041 Bacteria 945
400 Ga0207708_10120644 3300026075 Bacteria 2042
401 Ga0207702_10527278 3300026078 Bacteria 1153
402 Ga0207641_10000828 3300026088 Bacteria 32919
403 Ga0207641_10006622 3300026088 Bacteria 9727
404 Ga0207641_10145732 3300026088 Unclassified 2141
405 Ga0207641_10232526 3300026088 Unclassified 1714
406 Ga0207648_10009063 3300026089 Bacteria 9571
407 Ga0207648_10035476 3300026089 Bacteria 4393
408 Ga0207648_10066258 3300026089 Unclassified 3149
409 Ga0207648_10067108 3300026089 Bacteria 3128
410 Ga0207648_10081523 3300026089 Bacteria 2822
411 Ga0207648_10498494 3300026089 Bacteria 1114
412 Ga0207676_10045231 3300026095 Bacteria 3400
413 Ga0207676_10607274 3300026095 Bacteria 1051
414 Ga0207676_10953914 3300026095 Bacteria 843
415 Ga0207676_11109078 3300026095 Bacteria 782
416 Ga0207674_10005175 3300026116 Bacteria 15536
417 Ga0207674_10035928 3300026116 Bacteria 5168
418 Ga0207674_10061318 3300026116 Bacteria 3800
419 Ga0207674_10069369 3300026116 Unclassified 3545
420 Ga0207674_10194117 3300026116 Bacteria 1980
421 Ga0207674_10606198 3300026116 Bacteria 1058
422 Ga0207675_100000938 3300026118 Bacteria 29125
423 Ga0207675_100020934 3300026118 Bacteria 6098
424 Ga0207675_100104638 3300026118 Bacteria 2668
425 Ga0207675_100268025 3300026118 Bacteria 1657
426 Ga0207675_100385764 3300026118 Bacteria 1378
427 Ga0207675_100428838 3300026118 Bacteria 1307
428 Ga0207675_100660302 3300026118 Bacteria 1052
429 Ga0207675_101587986 3300026118 Bacteria 675
430 Ga0207683_10002317 3300026121 Bacteria 16706
431 Ga0207683_10019840 3300026121 Bacteria 5743
432 Ga0207698_10124448 3300026142 Bacteria 2190
433 Ga0207428_10262044 3300027907 Bacteria 1287
434 Ga0268266_10175687 3300028379 Bacteria 1947
435 Ga0268266_10262734 3300028379 Bacteria 1600
436 Ga0268265_10003979 3300028380 Bacteria 10413
437 Ga0268265_10129002 3300028380 Unclassified 2098
438 Ga0268265_10264362 3300028380 Unclassified 1531
439 Ga0268265_10538302 3300028380 Bacteria 1107
440 Ga0268265_10702393 3300028380 Bacteria 977
441 Ga0268264_10001339 3300028381 Bacteria 23170
442 Ga0268264_10007090 3300028381 Bacteria 9391
443 Ga0268264_10116991 3300028381 Bacteria 2344
444 Ga0268264_10736739 3300028381 Bacteria 981
445 Ga0307515_10000251 3300028794 Bacteria 132970
446 Ga0307513_10195550 3300031456 Bacteria 1869
447 Ga0307513_10270483 3300031456 Bacteria 1483
448 Ga0307513_10596675 3300031456 Bacteria 814
449 Ga0307410_10072079 3300031852 Bacteria 2398
450 Ga0307412_10426653 3300031911 Bacteria 1086
451 Ga0373934_0005320 3300035086 Bacteria 4764
452 Ga0373923_0097502 3300035111 Bacteria 1293
453 Ga0373943_0109664 3300035170 Bacteria 1454
454 Ga0373955_0306434 3300035172 Bacteria 958
455 Ga0373935_0255813 3300035692 Bacteria 1227
456 Ga0373927_0158820 3300035695 Bacteria 1481
457 Ga0373933_0052234 3300035724 Bacteria 2445
458 Ga0373947_0131804 3300035725 Bacteria 1596
459 Ga0373937_0117552 3300036401 Bacteria 2476
460 Ga0373937_0669893 3300036401 Bacteria 983
461 Ga0373937_1438825 3300036401 Bacteria 637
462 Ga0395905_0066510 3300037471 Unclassified 3375
463 Ga0395905_0184063 3300037471 Unclassified 1961
464 Ga0439439_0027353 3300041406 Bacteria 1441
465 Ga0439439_0051011 3300041406 Bacteria 1085
466 Ga0451798_0868747 3300041458 Unclassified 936
467 Ga0451800_1008588 3300041459 Unclassified 760
468 Ga0451804_1073348 3300041463 Bacteria 1206
469 Ga0451807_2002172 3300041486 Bacteria 1199
470 Ga0451855_0626846 3300041511 Bacteria 756
471 Ga0451853_0329485 3300041512 Bacteria 765
472 Ga0451853_0615961 3300041512 Bacteria 2283
473 Ga0439449_0063473 3300042007 Bacteria 1363
474 Ga0439457_004296 3300042014 Bacteria 3743
475 Ga0439457_008964 3300042014 Bacteria 2342
476 Ga0439457_027840 3300042014 Bacteria 1252
477 Ga0439457_048622 3300042014 Bacteria 950
478 Ga0439462_0002133 3300042015 Bacteria 4544
479 Ga0439434_0002629 3300042435 Bacteria 5233
480 Ga0466972_0000083 3300044658 Bacteria 87204
481 Ga0466972_0006324 3300044658 Bacteria 5950
482 Ga0466966_0000161 3300044684 Bacteria 43671
483 Ga0466968_0077704 3300044735 Bacteria 1454
484 Ga0466957_0035607 3300044842 Bacteria 2987
485 Ga0466957_0257070 3300044842 Bacteria 1163
486 Ga0466959_0000005 3300045049 Bacteria 213958
487 Ga0495592_0099941 3300046454 Bacteria 2068
488 Ga0495629_0121359 3300046459 Bacteria 1821
489 Ga0495638_0058728 3300046460 Bacteria 2383
490 Ga0495653_0275161 3300046463 Bacteria 1107
491 Ga0495580_0055645 3300046472 Bacteria 2787
492 Ga0495628_0047817 3300046516 Bacteria 3392
493 Ga0495630_0006101 3300046517 Bacteria 8544
494 Ga0495643_0020469 3300046522 Bacteria 3813
495 Ga0495665_0180709 3300046531 Bacteria 1096
496 Ga0495587_0025834 3300046536 Bacteria 3586
497 Ga0495645_0087872 3300046543 Bacteria 2224
498 Ga0495633_0077047 3300046558 Bacteria 1553
499 Ga0495667_0081174 3300046559 Bacteria 2108
500 Ga0495635_0066843 3300046663 Bacteria 2466
501 Ga0495657_0170543 3300046675 Bacteria 1340
502 Ga0495657_0352319 3300046675 Bacteria 871
503 Ga0495670_0026829 3300046691 Bacteria 2852
504 Ga0495600_0409257 3300046809 Unclassified 843
505 Ga0495674_0102592 3300047319 Bacteria 2433
506 Ga0495674_0309942 3300047319 Bacteria 1288
507 Ga0495684_0072743 3300047471 Bacteria 2612
508 Ga0495684_0156710 3300047471 Bacteria 1701
509 Ga0496106_0193478 3300048909 Bacteria 1618
510 Ga0496111_0191893 3300048914 Bacteria 1519
511 Ga0496112_0698533 3300048915 Bacteria 942
512 Ga0496114_0329534 3300048917 Bacteria 1350
513 Ga0501031_0045864 3300049568 Bacteria 2852
514 Ga0501032_0002810 3300049569 Bacteria 13533
515 Ga0501034_0026330 3300049571 Bacteria 5924
516 Ga0501034_0239319 3300049571 Bacteria 1761
517 Ga0501036_0006337 3300049572 Bacteria 9602
518 Ga0501036_0112058 3300049572 Bacteria 2305
519 Ga0501038_0010161 3300049574 Bacteria 8616
520 Ga0501038_0010781 3300049574 Bacteria 8354
521 Ga0501039_0072696 3300049575 Bacteria 2672
522 Ga0501042_0390573 3300049578 Bacteria 1008
523 Ga0501043_0002617 3300049579 Bacteria 15178
524 Ga0501043_0033385 3300049579 Bacteria 4049
525 Ga0501046_0025486 3300049580 Bacteria 4839
526 Ga0501046_0279012 3300049580 Bacteria 1224
527 Ga0501046_0681076 3300049580 Bacteria 725
528 Ga0501047_0016280 3300049581 Bacteria 7092
529 Ga0501047_0062311 3300049581 Bacteria 3597
530 Ga0501047_0363728 3300049581 Bacteria 1282
531 Ga0501047_0714140 3300049581 Bacteria 819
532 Ga0501048_0163503 3300049582 Bacteria 1575
533 Ga0501067_0014205 3300049583 Bacteria 4411
534 Ga0501068_0080365 3300049584 Bacteria 2000
535 Ga0501070_0113996 3300049586 Bacteria 2233
536 Ga0501073_0085818 3300049589 Bacteria 2189
537 Ga0501073_0138910 3300049589 Bacteria 1683
538 Ga0501074_0015164 3300049590 Bacteria 5604
539 Ga0501198_048122 3300049649 Unclassified 754
540 Ga0501242_000510 3300049674 Bacteria 3442
541 Ga0501250_000773 3300049680 Bacteria 2351
542 Ga0501257_010370 3300049686 Bacteria 2114
543 Ga0501257_016290 3300049686 Bacteria 1724
544 Ga0501257_043449 3300049686 Bacteria 1107
545 Ga0501259_009993 3300049688 Bacteria 1546
546 Ga0501225_0002103 3300049705 Bacteria 6186
547 Ga0501245_002369 3300049708 Bacteria 2515
548 Ga0501079_0155880 3300049741 Bacteria 1780
549 Ga0501080_0259243 3300049742 Bacteria 1584
550 Ga0501083_0019383 3300049744 Bacteria 4739
551 Ga0501083_0350453 3300049744 Bacteria 960
552 Ga0501266_001991 3300049763 Bacteria 2573
553 Ga0501268_004350 3300049765 Bacteria 1990
554 Ga0501035_0010571 3300049822 Bacteria 8551
555 Ga0501035_0096075 3300049822 Bacteria 2604
556 Ga0501044_0008438 3300049823 Bacteria 11298
557 Ga0501044_0039615 3300049823 Bacteria 4915
558 Ga0501044_0076559 3300049823 Bacteria 3395
559 nmdc:mga0k408_330845_c1 3300050493 Bacteria 909
560 nmdc:mga0k408_9565_c1 3300050493 Bacteria 5229
561 nmdc:mga05p37_45515_c1 3300050507 Bacteria 5396
562 nmdc:mga05p37_68874_c1 3300050507 Bacteria 4351
563 nmdc:mga09592_6092_c1 3300050508 Bacteria 9824
564 nmdc:mga0qj67_17832_c1 3300050509 Bacteria 5401
565 nmdc:mga0qj67_77797_c1 3300050509 Bacteria 2654
566 nmdc:mga06r32_62932_c1 3300050510 Unclassified 3575
567 nmdc:mga08y16_547000_c1 3300050511 Bacteria 1172
568 nmdc:mga08y16_87186_c1 3300050511 Bacteria 3252
569 nmdc:mga08y16_9862_c1 3300050511 Bacteria 10028
570 Ga0500578_0000066 3300053086 Bacteria 116854
571 Ga0500578_0008597 3300053086 Bacteria 6673
572 Ga0500583_0000002 3300053092 Bacteria 232826
573 Ga0500651_0124048 3300053093 Bacteria 1566
574 Ga0500556_0060626 3300053104 Bacteria 1393
575 Ga0500642_0036417 3300053130 Bacteria 2097
576 Ga0500642_0068038 3300053130 Bacteria 1615
577 Ga0500589_005704 3300053147 Bacteria 4887
578 Ga0500622_0022887 3300053156 Bacteria 3309
579 Ga0500637_0141101 3300053178 Bacteria 1395
580 Ga0500611_000075 3300053727 Bacteria 39695
581 Ga0500611_031704 3300053727 Bacteria 1100
582 Ga0501084_0201326 3300054114 Bacteria 1680
583 Ga0501084_0805082 3300054114 Bacteria 791
584 Ga0587076_016462 3300059645 Bacteria 1168
585 Ga0501082_0473963 3300060353 Unclassified 1094

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100020934 Ga0207675_1000209347 182
2 3300036401 Ga0373937_1438825 Ga0373937_1438825_42_614 186
3 3300006358 Ga0068871_100007069 Ga0068871_1000070693 190
4 3300013306 Ga0163162_10055510 Ga0163162_100555103 190
5 3300014969 Ga0157376_10256203 Ga0157376_102562033 190
6 3300014969 Ga0157376_10274540 Ga0157376_102745401 190
7 3300014969 Ga0157376_10296059 Ga0157376_102960593 190
8 3300005456 Ga0070678_100487912 Ga0070678_1004879121 191
9 3300049581 Ga0501047_0714140 Ga0501047_0714140_201_785 191
10 3300044842 Ga0466957_0035607 Ga0466957_0035607_1974_2618 192
11 3300005328 Ga0070676_10025781 Ga0070676_100257813 194
12 3300005334 Ga0068869_100008279 Ga0068869_1000082796 194
13 3300005338 Ga0068868_100013667 Ga0068868_1000136672 194
14 3300005364 Ga0070673_100119283 Ga0070673_1001192832 194
15 3300005367 Ga0070667_101015566 Ga0070667_1010155661 194
16 3300005457 Ga0070662_100005152 Ga0070662_1000051524 194
17 3300005564 Ga0070664_100137723 Ga0070664_1001377232 194
18 3300013306 Ga0163162_10019698 Ga0163162_100196985 194
19 3300025901 Ga0207688_10218177 Ga0207688_102181772 194
20 3300025933 Ga0207706_10020423 Ga0207706_100204235 194
21 3300025942 Ga0207689_10234677 Ga0207689_102346772 194
22 3300025945 Ga0207679_10214221 Ga0207679_102142212 194
23 3300025981 Ga0207640_10343119 Ga0207640_103431192 194
24 3300026023 Ga0207677_10140129 Ga0207677_101401292 194
25 3300026118 Ga0207675_101587986 Ga0207675_1015879861 194
26 3300031456 Ga0307513_10270483 Ga0307513_102704832 194
27 3300046459 Ga0495629_0121359 Ga0495629_0121359_363_998 194
28 3300047471 Ga0495684_0156710 Ga0495684_0156710_1043_1678 194
29 3300053086 Ga0500578_0000066 Ga0500578_0000066_23445_24086 194
30 3300036401 Ga0373937_0669893 Ga0373937_0669893_85_723 195
31 3300046558 Ga0495633_0077047 Ga0495633_0077047_776_1414 195
32 3300046675 Ga0495657_0170543 Ga0495657_0170543_50_688 195
33 3300046691 Ga0495670_0026829 Ga0495670_0026829_1105_1743 195
34 3300013296 Ga0157374_10052899 Ga0157374_100528993 196
35 3300035172 Ga0373955_0306434 Ga0373955_0306434_40_675 196
36 3300046472 Ga0495580_0055645 Ga0495580_0055645_244_879 196
37 3300046531 Ga0495665_0180709 Ga0495665_0180709_34_669 196
38 3300046663 Ga0495635_0066843 Ga0495635_0066843_59_694 196
39 3300046809 Ga0495600_0409257 Ga0495600_0409257_95_730 196
40 3300047319 Ga0495674_0102592 Ga0495674_0102592_309_944 196
41 3300046543 Ga0495645_0087872 Ga0495645_0087872_393_1031 197
42 3300046675 Ga0495657_0352319 Ga0495657_0352319_66_758 198
43 3300053092 Ga0500583_0000002 Ga0500583_0000002_61716_62324 199
44 3300005347 Ga0070668_100049495 Ga0070668_1000494951 200
45 3300005459 Ga0068867_100029278 Ga0068867_1000292783 200
46 3300005617 Ga0068859_100599222 Ga0068859_1005992222 200
47 3300005718 Ga0068866_10042763 Ga0068866_100427631 200
48 3300005844 Ga0068862_101071352 Ga0068862_1010713521 200
49 3300006237 Ga0097621_100006713 Ga0097621_1000067134 200
50 3300006881 Ga0068865_100357419 Ga0068865_1003574192 200
51 3300006931 Ga0097620_100599096 Ga0097620_1005990962 200
52 3300009098 Ga0105245_10366128 Ga0105245_103661282 200
53 3300014969 Ga0157376_10022328 Ga0157376_100223283 200
54 3300025907 Ga0207645_10042618 Ga0207645_100426182 200
55 3300025923 Ga0207681_10075182 Ga0207681_100751822 200
56 3300025938 Ga0207704_10646711 Ga0207704_106467111 200
57 3300026089 Ga0207648_10067108 Ga0207648_100671082 200
58 3300028380 Ga0268265_10129002 Ga0268265_101290021 200
59 3300005334 Ga0068869_100004499 Ga0068869_1000044994 201
60 3300005335 Ga0070666_10000405 Ga0070666_100004054 201
61 3300005347 Ga0070668_100344044 Ga0070668_1003440442 201
62 3300005355 Ga0070671_100279417 Ga0070671_1002794172 201
63 3300005719 Ga0068861_100369180 Ga0068861_1003691802 201
64 3300005841 Ga0068863_100002306 Ga0068863_1000023066 201
65 3300005843 Ga0068860_100013138 Ga0068860_1000131388 201
66 3300005844 Ga0068862_100236250 Ga0068862_1002362502 201
67 3300009148 Ga0105243_10111456 Ga0105243_101114562 201
68 3300009176 Ga0105242_10220448 Ga0105242_102204482 201
69 3300009553 Ga0105249_10003050 Ga0105249_1000305010 201
70 3300011119 Ga0105246_10191272 Ga0105246_101912722 201
71 3300013102 Ga0157371_10200512 Ga0157371_102005123 201
72 3300013306 Ga0163162_10001227 Ga0163162_1000122724 201
73 3300014325 Ga0163163_10039910 Ga0163163_100399103 201
74 3300014968 Ga0157379_10640932 Ga0157379_106409322 201
75 3300025903 Ga0207680_10000143 Ga0207680_1000014318 201
76 3300025931 Ga0207644_10693266 Ga0207644_106932661 201
77 3300025942 Ga0207689_10008970 Ga0207689_100089706 201
78 3300025961 Ga0207712_10014692 Ga0207712_100146923 201
79 3300025986 Ga0207658_10029958 Ga0207658_100299583 201
80 3300026041 Ga0207639_10692832 Ga0207639_106928321 201
81 3300026088 Ga0207641_10000828 Ga0207641_1000082811 201
82 3300026118 Ga0207675_100428838 Ga0207675_1004288382 201
83 3300028381 Ga0268264_10001339 Ga0268264_100013397 201
84 3300049569 Ga0501032_0002810 Ga0501032_0002810_8637_9335 202
85 3300049571 Ga0501034_0026330 Ga0501034_0026330_1282_1980 202
86 3300049572 Ga0501036_0006337 Ga0501036_0006337_1323_2021 202
87 3300049574 Ga0501038_0010161 Ga0501038_0010161_6120_6818 202
88 3300049575 Ga0501039_0072696 Ga0501039_0072696_1844_2542 202
89 3300049578 Ga0501042_0390573 Ga0501042_0390573_116_814 202
90 3300049579 Ga0501043_0002617 Ga0501043_0002617_6019_6717 202
91 3300049580 Ga0501046_0025486 Ga0501046_0025486_651_1349 202
92 3300049581 Ga0501047_0062311 Ga0501047_0062311_2218_2916 202
93 3300049582 Ga0501048_0163503 Ga0501048_0163503_38_736 202
94 3300049583 Ga0501067_0014205 Ga0501067_0014205_332_1030 202
95 3300049584 Ga0501068_0080365 Ga0501068_0080365_226_924 202
96 3300049586 Ga0501070_0113996 Ga0501070_0113996_1374_2072 202
97 3300049589 Ga0501073_0085818 Ga0501073_0085818_810_1508 202
98 3300049590 Ga0501074_0015164 Ga0501074_0015164_2909_3607 202
99 3300049741 Ga0501079_0155880 Ga0501079_0155880_67_765 202
100 3300049742 Ga0501080_0259243 Ga0501080_0259243_481_1179 202
101 3300049744 Ga0501083_0019383 Ga0501083_0019383_3213_3911 202
102 3300049822 Ga0501035_0010571 Ga0501035_0010571_7056_7754 202
103 3300049823 Ga0501044_0039615 Ga0501044_0039615_766_1464 202
104 3300054114 Ga0501084_0201326 Ga0501084_0201326_619_1317 202
105 3300060353 Ga0501082_0473963 Ga0501082_0473963_355_1053 202
106 3300005340 Ga0070689_100118384 Ga0070689_1001183843 203
107 3300005367 Ga0070667_100427227 Ga0070667_1004272271 203
108 3300009101 Ga0105247_10475348 Ga0105247_104753481 203
109 3300009176 Ga0105242_10115683 Ga0105242_101156832 203
110 3300009177 Ga0105248_10501116 Ga0105248_105011162 203
111 3300009553 Ga0105249_10238904 Ga0105249_102389042 203
112 3300013306 Ga0163162_10209333 Ga0163162_102093332 203
113 3300013307 Ga0157372_10565903 Ga0157372_105659032 203
114 3300014325 Ga0163163_10182792 Ga0163163_101827921 203
115 3300014968 Ga0157379_10335440 Ga0157379_103354402 203
116 3300014969 Ga0157376_10119413 Ga0157376_101194132 203
117 3300026088 Ga0207641_10006622 Ga0207641_100066222 203
118 3300041459 Ga0451800_1008588 Ga0451800_1008588_85_738 203
119 3300041486 Ga0451807_2002172 Ga0451807_2002172_154_807 203
120 3300044735 Ga0466968_0077704 Ga0466968_0077704_668_1306 203
121 3300046522 Ga0495643_0020469 Ga0495643_0020469_1898_2545 203
122 3300002738 JGI25154J39366_1009323 JGI25154J39366_10093232 204
123 3300005563 Ga0068855_100011667 Ga0068855_1000116676 204
124 3300005577 Ga0068857_100089884 Ga0068857_1000898844 204
125 3300005578 Ga0068854_100633876 Ga0068854_1006338762 204
126 3300005614 Ga0068856_100620687 Ga0068856_1006206872 204
127 3300005616 Ga0068852_100473775 Ga0068852_1004737752 204
128 3300005842 Ga0068858_101086112 Ga0068858_1010861121 204
129 3300006195 Ga0075366_10056906 Ga0075366_100569063 204
130 3300009093 Ga0105240_10774088 Ga0105240_107740881 204
131 3300009147 Ga0114129_10012913 Ga0114129_100129133 204
132 3300009174 Ga0105241_10048477 Ga0105241_100484773 204
133 3300009545 Ga0105237_10073316 Ga0105237_100733161 204
134 3300025246 Ga0209646_1002144 Ga0209646_10021445 204
135 3300025911 Ga0207654_10081792 Ga0207654_100817922 204
136 3300025914 Ga0207671_10041039 Ga0207671_100410395 204
137 3300025949 Ga0207667_10014746 Ga0207667_100147466 204
138 3300026078 Ga0207702_10527278 Ga0207702_105272781 204
139 3300031456 Ga0307513_10195550 Ga0307513_101955502 204
140 3300035695 Ga0373927_0158820 Ga0373927_0158820_692_1333 204
141 3300041406 Ga0439439_0027353 Ga0439439_0027353_430_1071 204
142 3300041406 Ga0439439_0051011 Ga0439439_0051011_29_670 204
143 3300041458 Ga0451798_0868747 Ga0451798_0868747_82_723 204
144 3300041463 Ga0451804_1073348 Ga0451804_1073348_166_807 204
145 3300041511 Ga0451855_0626846 Ga0451855_0626846_10_651 204
146 3300041512 Ga0451853_0615961 Ga0451853_0615961_1449_2090 204
147 3300042014 Ga0439457_004296 Ga0439457_004296_662_1303 204
148 3300042014 Ga0439457_048622 Ga0439457_048622_250_891 204
149 3300042015 Ga0439462_0002133 Ga0439462_0002133_264_905 204
150 3300044658 Ga0466972_0000083 Ga0466972_0000083_30612_31253 204
151 3300044658 Ga0466972_0006324 Ga0466972_0006324_4163_4804 204
152 3300044684 Ga0466966_0000161 Ga0466966_0000161_41815_42456 204
153 3300044842 Ga0466957_0257070 Ga0466957_0257070_185_826 204
154 3300045049 Ga0466959_0000005 Ga0466959_0000005_64263_64904 204
155 3300049580 Ga0501046_0681076 Ga0501046_0681076_59_700 204
156 3300049581 Ga0501047_0016280 Ga0501047_0016280_303_944 204
157 3300049686 Ga0501257_016290 Ga0501257_016290_171_812 204
158 3300049705 Ga0501225_0002103 Ga0501225_0002103_2321_2962 204
159 3300049744 Ga0501083_0350453 Ga0501083_0350453_131_775 204
160 3300049823 Ga0501044_0008438 Ga0501044_0008438_10469_11110 204
161 3300050493 nmdc:mga0k408_330845_c1 nmdc:mga0k408_330845_c1_138_779 204
162 3300050507 nmdc:mga05p37_45515_c1 nmdc:mga05p37_45515_c1_1589_2230 204
163 3300053086 Ga0500578_0008597 Ga0500578_0008597_3278_3919 204
164 3300053093 Ga0500651_0124048 Ga0500651_0124048_181_822 204
165 3300053104 Ga0500556_0060626 Ga0500556_0060626_159_800 204
166 3300053130 Ga0500642_0036417 Ga0500642_0036417_969_1610 204
167 3300053130 Ga0500642_0068038 Ga0500642_0068038_754_1395 204
168 3300053147 Ga0500589_005704 Ga0500589_005704_3694_4335 204
169 3300053156 Ga0500622_0022887 Ga0500622_0022887_747_1388 204
170 3300053178 Ga0500637_0141101 Ga0500637_0141101_663_1304 204
171 3300053727 Ga0500611_031704 Ga0500611_031704_400_1041 204
172 3300054114 Ga0501084_0805082 Ga0501084_0805082_47_688 204
173 3300059645 Ga0587076_016462 Ga0587076_016462_335_976 204
174 iso_pu_bacteria 2738541278 2738728216 204
175 3300005539 Ga0068853_100397513 Ga0068853_1003975132 205
176 3300005338 Ga0068868_100624971 Ga0068868_1006249711 206
177 3300005616 Ga0068852_100014252 Ga0068852_1000142525 206
178 3300005617 Ga0068859_100000066 Ga0068859_10000006649 206
179 3300006358 Ga0068871_100120331 Ga0068871_1001203313 206
180 3300006931 Ga0097620_100000066 Ga0097620_10000006649 206
181 3300009094 Ga0111539_10046172 Ga0111539_100461724 206
182 3300009148 Ga0105243_11157221 Ga0105243_111572211 206
183 3300009176 Ga0105242_10110461 Ga0105242_101104611 206
184 3300009176 Ga0105242_10201097 Ga0105242_102010972 206
185 3300009545 Ga0105237_10003163 Ga0105237_1000316310 206
186 3300011119 Ga0105246_10163694 Ga0105246_101636942 206
187 3300013308 Ga0157375_10625963 Ga0157375_106259632 206
188 3300013308 Ga0157375_10688956 Ga0157375_106889562 206
189 3300014969 Ga0157376_10043460 Ga0157376_100434605 206
190 3300025904 Ga0207647_10072657 Ga0207647_100726572 206
191 3300025911 Ga0207654_10012016 Ga0207654_100120166 206
192 3300025914 Ga0207671_10001491 Ga0207671_1000149110 206
193 3300025972 Ga0207668_10771577 Ga0207668_107715771 206
194 3300026035 Ga0207703_10002420 Ga0207703_1000242011 206
195 3300042435 Ga0439434_0002629 Ga0439434_0002629_3325_3981 206
196 3300050511 nmdc:mga08y16_87186_c1 nmdc:mga08y16_87186_c1_499_1161 206
197 3300005290 Ga0065712_10010653 Ga0065712_100106532 207
198 3300005290 Ga0065712_10131631 Ga0065712_101316311 207
199 3300005293 Ga0065715_10309646 Ga0065715_103096462 207
200 3300005327 Ga0070658_10000438 Ga0070658_1000043823 207
201 3300005329 Ga0070683_100004631 Ga0070683_1000046319 207
202 3300005329 Ga0070683_100011439 Ga0070683_1000114392 207
203 3300005329 Ga0070683_100113430 Ga0070683_1001134301 207
204 3300005330 Ga0070690_100180278 Ga0070690_1001802782 207
205 3300005330 Ga0070690_100321880 Ga0070690_1003218802 207
206 3300005331 Ga0070670_100048717 Ga0070670_1000487172 207
207 3300005334 Ga0068869_100078482 Ga0068869_1000784824 207
208 3300005334 Ga0068869_100081079 Ga0068869_1000810791 207
209 3300005334 Ga0068869_100548557 Ga0068869_1005485572 207
210 3300005335 Ga0070666_10006706 Ga0070666_100067064 207
211 3300005335 Ga0070666_10050150 Ga0070666_100501502 207
212 3300005335 Ga0070666_10246892 Ga0070666_102468922 207
213 3300005338 Ga0068868_100052068 Ga0068868_1000520684 207
214 3300005339 Ga0070660_100463592 Ga0070660_1004635922 207
215 3300005340 Ga0070689_100055284 Ga0070689_1000552844 207
216 3300005340 Ga0070689_100083918 Ga0070689_1000839182 207
217 3300005344 Ga0070661_100003972 Ga0070661_1000039724 207
218 3300005344 Ga0070661_100024577 Ga0070661_1000245771 207
219 3300005344 Ga0070661_100036304 Ga0070661_1000363045 207
220 3300005353 Ga0070669_100210210 Ga0070669_1002102102 207
221 3300005355 Ga0070671_100094064 Ga0070671_1000940644 207
222 3300005355 Ga0070671_100900465 Ga0070671_1009004651 207
223 3300005364 Ga0070673_100287186 Ga0070673_1002871862 207
224 3300005365 Ga0070688_100011740 Ga0070688_1000117406 207
225 3300005365 Ga0070688_100037727 Ga0070688_1000377273 207
226 3300005366 Ga0070659_100002732 Ga0070659_1000027324 207
227 3300005366 Ga0070659_100212993 Ga0070659_1002129932 207
228 3300005367 Ga0070667_100087580 Ga0070667_1000875802 207
229 3300005367 Ga0070667_100349767 Ga0070667_1003497671 207
230 3300005456 Ga0070678_100115240 Ga0070678_1001152402 207
231 3300005457 Ga0070662_100069184 Ga0070662_1000691842 207
232 3300005457 Ga0070662_100179319 Ga0070662_1001793192 207
233 3300005457 Ga0070662_100445415 Ga0070662_1004454152 207
234 3300005459 Ga0068867_100026189 Ga0068867_1000261894 207
235 3300005466 Ga0070685_10021915 Ga0070685_100219152 207
236 3300005466 Ga0070685_10037819 Ga0070685_100378194 207
237 3300005466 Ga0070685_10282834 Ga0070685_102828341 207
238 3300005471 Ga0070698_100001497 Ga0070698_10000149725 207
239 3300005471 Ga0070698_100010867 Ga0070698_1000108676 207
240 3300005535 Ga0070684_100002706 Ga0070684_10000270611 207
241 3300005535 Ga0070684_100062723 Ga0070684_1000627234 207
242 3300005539 Ga0068853_100002920 Ga0068853_1000029207 207
243 3300005539 Ga0068853_100205366 Ga0068853_1002053662 207
244 3300005543 Ga0070672_100317045 Ga0070672_1003170452 207
245 3300005544 Ga0070686_100283841 Ga0070686_1002838411 207
246 3300005548 Ga0070665_100130723 Ga0070665_1001307232 207
247 3300005548 Ga0070665_100346961 Ga0070665_1003469612 207
248 3300005548 Ga0070665_100525738 Ga0070665_1005257381 207
249 3300005564 Ga0070664_100004774 Ga0070664_1000047741 207
250 3300005564 Ga0070664_100034556 Ga0070664_1000345564 207
251 3300005564 Ga0070664_100057696 Ga0070664_1000576962 207
252 3300005564 Ga0070664_100060571 Ga0070664_1000605714 207
253 3300005577 Ga0068857_100015228 Ga0068857_1000152283 207
254 3300005577 Ga0068857_100049312 Ga0068857_1000493124 207
255 3300005578 Ga0068854_100013566 Ga0068854_1000135662 207
256 3300005578 Ga0068854_100086750 Ga0068854_1000867502 207
257 3300005616 Ga0068852_100154668 Ga0068852_1001546682 207
258 3300005616 Ga0068852_100787356 Ga0068852_1007873562 207
259 3300005616 Ga0068852_100790562 Ga0068852_1007905622 207
260 3300005617 Ga0068859_100064949 Ga0068859_1000649493 207
261 3300005617 Ga0068859_100225170 Ga0068859_1002251702 207
262 3300005617 Ga0068859_101224369 Ga0068859_1012243691 207
263 3300005618 Ga0068864_100053379 Ga0068864_1000533792 207
264 3300005618 Ga0068864_100234932 Ga0068864_1002349322 207
265 3300005618 Ga0068864_100345393 Ga0068864_1003453932 207
266 3300005718 Ga0068866_10036116 Ga0068866_100361162 207
267 3300005840 Ga0068870_10093881 Ga0068870_100938812 207
268 3300005841 Ga0068863_100134435 Ga0068863_1001344352 207
269 3300005841 Ga0068863_100462614 Ga0068863_1004626142 207
270 3300005842 Ga0068858_100097299 Ga0068858_1000972992 207
271 3300005842 Ga0068858_100276628 Ga0068858_1002766283 207
272 3300005843 Ga0068860_100552535 Ga0068860_1005525351 207
273 3300005844 Ga0068862_100484274 Ga0068862_1004842742 207
274 3300005844 Ga0068862_100523223 Ga0068862_1005232231 207
275 3300005844 Ga0068862_100706493 Ga0068862_1007064931 207
276 3300006163 Ga0070715_10005844 Ga0070715_100058441 207
277 3300006237 Ga0097621_100007600 Ga0097621_1000076006 207
278 3300006358 Ga0068871_100202679 Ga0068871_1002026792 207
279 3300006931 Ga0097620_100064950 Ga0097620_1000649503 207
280 3300006931 Ga0097620_100225172 Ga0097620_1002251723 207
281 3300006931 Ga0097620_101224145 Ga0097620_1012241451 207
282 3300009094 Ga0111539_10473606 Ga0111539_104736062 207
283 3300009101 Ga0105247_10156132 Ga0105247_101561322 207
284 3300009176 Ga0105242_10036375 Ga0105242_100363753 207
285 3300009177 Ga0105248_10670491 Ga0105248_106704911 207
286 3300009545 Ga0105237_10390294 Ga0105237_103902942 207
287 3300009553 Ga0105249_10083226 Ga0105249_100832262 207
288 3300011119 Ga0105246_10640410 Ga0105246_106404102 207
289 3300013100 Ga0157373_10025136 Ga0157373_100251364 207
290 3300013102 Ga0157371_10158876 Ga0157371_101588762 207
291 3300013296 Ga0157374_10000607 Ga0157374_100006075 207
292 3300013297 Ga0157378_10073652 Ga0157378_100736524 207
293 3300013306 Ga0163162_10031957 Ga0163162_100319573 207
294 3300013306 Ga0163162_10054154 Ga0163162_100541543 207
295 3300013307 Ga0157372_10046610 Ga0157372_100466103 207
296 3300013307 Ga0157372_10263616 Ga0157372_102636162 207
297 3300013308 Ga0157375_10077744 Ga0157375_100777444 207
298 3300013308 Ga0157375_10121536 Ga0157375_101215362 207
299 3300013308 Ga0157375_10124965 Ga0157375_101249652 207
300 3300014325 Ga0163163_10000078 Ga0163163_1000007816 207
301 3300014326 Ga0157380_10055217 Ga0157380_100552173 207
302 3300014326 Ga0157380_10250400 Ga0157380_102504002 207
303 3300014745 Ga0157377_10030207 Ga0157377_100302071 207
304 3300014745 Ga0157377_10098499 Ga0157377_100984991 207
305 3300014968 Ga0157379_10188270 Ga0157379_101882702 207
306 3300014969 Ga0157376_10062805 Ga0157376_100628052 207
307 3300014969 Ga0157376_10218499 Ga0157376_102184992 207
308 3300014969 Ga0157376_10303419 Ga0157376_103034191 207
309 3300014969 Ga0157376_11103054 Ga0157376_111030541 207
310 3300017792 Ga0163161_10003903 Ga0163161_100039038 207
311 3300017792 Ga0163161_10127277 Ga0163161_101272772 207
312 3300025315 Ga0207697_10173301 Ga0207697_101733012 207
313 3300025899 Ga0207642_10064423 Ga0207642_100644232 207
314 3300025903 Ga0207680_10005367 Ga0207680_100053674 207
315 3300025903 Ga0207680_10250428 Ga0207680_102504282 207
316 3300025903 Ga0207680_10510644 Ga0207680_105106441 207
317 3300025904 Ga0207647_10011499 Ga0207647_100114995 207
318 3300025905 Ga0207685_10089374 Ga0207685_100893742 207
319 3300025907 Ga0207645_10002535 Ga0207645_100025352 207
320 3300025908 Ga0207643_10008176 Ga0207643_100081765 207
321 3300025914 Ga0207671_10433329 Ga0207671_104333291 207
322 3300025919 Ga0207657_10421182 Ga0207657_104211821 207
323 3300025920 Ga0207649_10052049 Ga0207649_100520494 207
324 3300025920 Ga0207649_10054025 Ga0207649_100540254 207
325 3300025920 Ga0207649_10172393 Ga0207649_101723932 207
326 3300025923 Ga0207681_10286346 Ga0207681_102863462 207
327 3300025925 Ga0207650_10027536 Ga0207650_100275363 207
328 3300025926 Ga0207659_10083185 Ga0207659_100831851 207
329 3300025926 Ga0207659_10301466 Ga0207659_103014662 207
330 3300025931 Ga0207644_10548739 Ga0207644_105487392 207
331 3300025932 Ga0207690_10057952 Ga0207690_100579523 207
332 3300025932 Ga0207690_10098514 Ga0207690_100985142 207
333 3300025933 Ga0207706_10004992 Ga0207706_100049922 207
334 3300025933 Ga0207706_10194688 Ga0207706_101946882 207
335 3300025934 Ga0207686_10006728 Ga0207686_100067283 207
336 3300025936 Ga0207670_10011453 Ga0207670_100114533 207
337 3300025936 Ga0207670_10012045 Ga0207670_100120453 207
338 3300025936 Ga0207670_10124309 Ga0207670_101243092 207
339 3300025936 Ga0207670_10150459 Ga0207670_101504591 207
340 3300025938 Ga0207704_10054986 Ga0207704_100549862 207
341 3300025938 Ga0207704_10520746 Ga0207704_105207461 207
342 3300025940 Ga0207691_10035080 Ga0207691_100350802 207
343 3300025940 Ga0207691_10153081 Ga0207691_101530812 207
344 3300025942 Ga0207689_10025673 Ga0207689_100256734 207
345 3300025942 Ga0207689_10028313 Ga0207689_100283134 207
346 3300025942 Ga0207689_10087767 Ga0207689_100877672 207
347 3300025944 Ga0207661_10011446 Ga0207661_100114464 207
348 3300025944 Ga0207661_10048223 Ga0207661_100482231 207
349 3300025944 Ga0207661_10091625 Ga0207661_100916252 207
350 3300025944 Ga0207661_10837248 Ga0207661_108372481 207
351 3300025945 Ga0207679_10010266 Ga0207679_100102665 207
352 3300025945 Ga0207679_10045764 Ga0207679_100457642 207
353 3300025945 Ga0207679_10150261 Ga0207679_101502612 207
354 3300025960 Ga0207651_10189260 Ga0207651_101892601 207
355 3300025981 Ga0207640_10077923 Ga0207640_100779233 207
356 3300025986 Ga0207658_10172822 Ga0207658_101728222 207
357 3300025986 Ga0207658_10183780 Ga0207658_101837802 207
358 3300026023 Ga0207677_10041530 Ga0207677_100415302 207
359 3300026023 Ga0207677_10112629 Ga0207677_101126292 207
360 3300026035 Ga0207703_10042065 Ga0207703_100420654 207
361 3300026041 Ga0207639_10002438 Ga0207639_100024386 207
362 3300026041 Ga0207639_10194944 Ga0207639_101949442 207
363 3300026075 Ga0207708_10120644 Ga0207708_101206442 207
364 3300026088 Ga0207641_10232526 Ga0207641_102325262 207
365 3300026089 Ga0207648_10081523 Ga0207648_100815233 207
366 3300026089 Ga0207648_10498494 Ga0207648_104984941 207
367 3300026095 Ga0207676_10045231 Ga0207676_100452312 207
368 3300026095 Ga0207676_10607274 Ga0207676_106072741 207
369 3300026095 Ga0207676_10953914 Ga0207676_109539141 207
370 3300026095 Ga0207676_11109078 Ga0207676_111090781 207
371 3300026116 Ga0207674_10005175 Ga0207674_1000517511 207
372 3300026116 Ga0207674_10061318 Ga0207674_100613184 207
373 3300026118 Ga0207675_100268025 Ga0207675_1002680252 207
374 3300026118 Ga0207675_100385764 Ga0207675_1003857642 207
375 3300026121 Ga0207683_10019840 Ga0207683_100198403 207
376 3300026142 Ga0207698_10124448 Ga0207698_101244482 207
377 3300027907 Ga0207428_10262044 Ga0207428_102620441 207
378 3300028379 Ga0268266_10175687 Ga0268266_101756872 207
379 3300028380 Ga0268265_10264362 Ga0268265_102643622 207
380 3300028380 Ga0268265_10702393 Ga0268265_107023931 207
381 3300028381 Ga0268264_10116991 Ga0268264_101169912 207
382 3300028794 Ga0307515_10000251 Ga0307515_1000025187 207
383 3300031456 Ga0307513_10596675 Ga0307513_105966751 207
384 3300035086 Ga0373934_0005320 Ga0373934_0005320_573_1244 207
385 3300035111 Ga0373923_0097502 Ga0373923_0097502_270_941 207
386 3300035170 Ga0373943_0109664 Ga0373943_0109664_363_1034 207
387 3300035692 Ga0373935_0255813 Ga0373935_0255813_541_1212 207
388 3300035724 Ga0373933_0052234 Ga0373933_0052234_1053_1724 207
389 3300035725 Ga0373947_0131804 Ga0373947_0131804_64_735 207
390 3300036401 Ga0373937_0117552 Ga0373937_0117552_1265_1936 207
391 3300041512 Ga0451853_0329485 Ga0451853_0329485_43_711 207
392 3300046454 Ga0495592_0099941 Ga0495592_0099941_134_805 207
393 3300046463 Ga0495653_0275161 Ga0495653_0275161_270_941 207
394 3300046516 Ga0495628_0047817 Ga0495628_0047817_1166_1837 207
395 3300046517 Ga0495630_0006101 Ga0495630_0006101_3633_4304 207
396 3300046536 Ga0495587_0025834 Ga0495587_0025834_301_972 207
397 3300046559 Ga0495667_0081174 Ga0495667_0081174_105_776 207
398 3300047319 Ga0495674_0309942 Ga0495674_0309942_348_1019 207
399 3300047471 Ga0495684_0072743 Ga0495684_0072743_781_1452 207
400 3300048909 Ga0496106_0193478 Ga0496106_0193478_347_1015 207
401 3300048914 Ga0496111_0191893 Ga0496111_0191893_86_754 207
402 3300048915 Ga0496112_0698533 Ga0496112_0698533_201_869 207
403 3300048917 Ga0496114_0329534 Ga0496114_0329534_287_955 207
404 3300049568 Ga0501031_0045864 Ga0501031_0045864_841_1509 207
405 3300049574 Ga0501038_0010781 Ga0501038_0010781_5675_6343 207
406 3300049579 Ga0501043_0033385 Ga0501043_0033385_2099_2767 207
407 3300049580 Ga0501046_0279012 Ga0501046_0279012_116_784 207
408 3300049589 Ga0501073_0138910 Ga0501073_0138910_892_1560 207
409 3300049822 Ga0501035_0096075 Ga0501035_0096075_1008_1676 207
410 3300049823 Ga0501044_0076559 Ga0501044_0076559_1703_2371 207
411 3300005459 Ga0068867_100121730 Ga0068867_1001217301 208
412 3300005543 Ga0070672_100098607 Ga0070672_1000986073 208
413 3300005617 Ga0068859_100069771 Ga0068859_1000697712 208
414 3300006358 Ga0068871_100519739 Ga0068871_1005197392 208
415 3300006844 Ga0075428_100049741 Ga0075428_1000497412 208
416 3300006880 Ga0075429_100002013 Ga0075429_1000020139 208
417 3300006931 Ga0097620_100069772 Ga0097620_1000697723 208
418 3300009174 Ga0105241_10475917 Ga0105241_104759172 208
419 3300009176 Ga0105242_10012895 Ga0105242_100128955 208
420 3300011119 Ga0105246_10031640 Ga0105246_100316404 208
421 3300013297 Ga0157378_10059214 Ga0157378_100592143 208
422 3300025934 Ga0207686_10075107 Ga0207686_100751073 208
423 3300025940 Ga0207691_10038775 Ga0207691_100387753 208
424 3300025940 Ga0207691_10406403 Ga0207691_104064032 208
425 3300025942 Ga0207689_10212142 Ga0207689_102121422 208
426 3300025961 Ga0207712_10555364 Ga0207712_105553642 208
427 3300025972 Ga0207668_10204799 Ga0207668_102047992 208
428 3300026089 Ga0207648_10066258 Ga0207648_100662582 208
429 3300049581 Ga0501047_0363728 Ga0501047_0363728_450_1085 208
430 3300049649 Ga0501198_048122 Ga0501198_048122_79_714 208
431 3300049680 Ga0501250_000773 Ga0501250_000773_1286_1921 208
432 3300049686 Ga0501257_010370 Ga0501257_010370_943_1578 208
433 3300049765 Ga0501268_004350 Ga0501268_004350_149_784 208
434 3300050508 nmdc:mga09592_6092_c1 nmdc:mga09592_6092_c1_4612_5301 208
435 3300050509 nmdc:mga0qj67_17832_c1 nmdc:mga0qj67_17832_c1_2104_2793 208
436 3300050509 nmdc:mga0qj67_77797_c1 nmdc:mga0qj67_77797_c1_1727_2416 208
437 3300050510 nmdc:mga06r32_62932_c1 nmdc:mga06r32_62932_c1_1037_1726 208
438 3300005334 Ga0068869_100018905 Ga0068869_1000189054 209
439 3300005334 Ga0068869_100098516 Ga0068869_1000985162 209
440 3300005335 Ga0070666_10023370 Ga0070666_100233703 209
441 3300005338 Ga0068868_100563140 Ga0068868_1005631401 209
442 3300005347 Ga0070668_100022068 Ga0070668_1000220682 209
443 3300005347 Ga0070668_100413650 Ga0070668_1004136502 209
444 3300005353 Ga0070669_100125776 Ga0070669_1001257761 209
445 3300005364 Ga0070673_100014003 Ga0070673_1000140032 209
446 3300005367 Ga0070667_100026170 Ga0070667_1000261702 209
447 3300005367 Ga0070667_100090221 Ga0070667_1000902212 209
448 3300005456 Ga0070678_100082275 Ga0070678_1000822752 209
449 3300005457 Ga0070662_100086663 Ga0070662_1000866632 209
450 3300005459 Ga0068867_100134048 Ga0068867_1001340482 209
451 3300005466 Ga0070685_10051544 Ga0070685_100515441 209
452 3300005548 Ga0070665_100029139 Ga0070665_1000291395 209
453 3300005577 Ga0068857_100170871 Ga0068857_1001708712 209
454 3300005617 Ga0068859_100020688 Ga0068859_1000206886 209
455 3300005719 Ga0068861_100105363 Ga0068861_1001053632 209
456 3300005840 Ga0068870_10179378 Ga0068870_101793782 209
457 3300005844 Ga0068862_100070113 Ga0068862_1000701132 209
458 3300006237 Ga0097621_100276679 Ga0097621_1002766792 209
459 3300006358 Ga0068871_100023301 Ga0068871_1000233014 209
460 3300006881 Ga0068865_100308216 Ga0068865_1003082162 209
461 3300006931 Ga0097620_100020689 Ga0097620_1000206892 209
462 3300009553 Ga0105249_10078787 Ga0105249_100787872 209
463 3300013105 Ga0157369_10595359 Ga0157369_105953592 209
464 3300013308 Ga0157375_10656302 Ga0157375_106563022 209
465 3300014325 Ga0163163_10537561 Ga0163163_105375612 209
466 3300025901 Ga0207688_10009233 Ga0207688_100092333 209
467 3300025907 Ga0207645_10011599 Ga0207645_100115993 209
468 3300025908 Ga0207643_10042481 Ga0207643_100424813 209
469 3300025923 Ga0207681_10121929 Ga0207681_101219292 209
470 3300025942 Ga0207689_10002539 Ga0207689_100025394 209
471 3300025942 Ga0207689_10029184 Ga0207689_100291844 209
472 3300025960 Ga0207651_10009245 Ga0207651_100092453 209
473 3300025961 Ga0207712_10047041 Ga0207712_100470412 209
474 3300025972 Ga0207668_10355276 Ga0207668_103552762 209
475 3300025972 Ga0207668_10482449 Ga0207668_104824491 209
476 3300026023 Ga0207677_10013387 Ga0207677_100133874 209
477 3300026041 Ga0207639_10084906 Ga0207639_100849062 209
478 3300026089 Ga0207648_10009063 Ga0207648_100090637 209
479 3300026116 Ga0207674_10194117 Ga0207674_101941172 209
480 3300026118 Ga0207675_100104638 Ga0207675_1001046383 209
481 3300026121 Ga0207683_10002317 Ga0207683_100023178 209
482 3300028379 Ga0268266_10262734 Ga0268266_102627342 209
483 3300028381 Ga0268264_10736739 Ga0268264_107367392 209
484 3300005468 Ga0070707_100121011 Ga0070707_1001210112 210
485 3300005518 Ga0070699_100160848 Ga0070699_1001608482 210
486 3300005543 Ga0070672_100061466 Ga0070672_1000614662 210
487 3300006844 Ga0075428_100025952 Ga0075428_1000259522 210
488 3300006846 Ga0075430_100018064 Ga0075430_1000180642 210
489 3300006847 Ga0075431_100032821 Ga0075431_1000328214 210
490 3300006880 Ga0075429_100053015 Ga0075429_1000530152 210
491 3300009094 Ga0111539_10679533 Ga0111539_106795331 210
492 3300009147 Ga0114129_10082280 Ga0114129_100822802 210
493 3300009147 Ga0114129_10154899 Ga0114129_101548992 210
494 3300025936 Ga0207670_10131657 Ga0207670_101316571 210
495 3300025940 Ga0207691_10079706 Ga0207691_100797062 210
496 3300049571 Ga0501034_0239319 Ga0501034_0239319_157_864 210
497 3300049572 Ga0501036_0112058 Ga0501036_0112058_1377_2084 210
498 3300050507 nmdc:mga05p37_68874_c1 nmdc:mga05p37_68874_c1_1857_2546 210
499 3300050511 nmdc:mga08y16_547000_c1 nmdc:mga08y16_547000_c1_445_1122 210
500 3300005471 Ga0070698_100005363 Ga0070698_10000536310 211
501 3300005547 Ga0070693_100478272 Ga0070693_1004782721 211
502 3300006844 Ga0075428_100179564 Ga0075428_1001795643 211
503 3300009553 Ga0105249_10826046 Ga0105249_108260462 211
504 3300014325 Ga0163163_10213378 Ga0163163_102133781 211
505 3300046460 Ga0495638_0058728 Ga0495638_0058728_81_782 211
506 3300053727 Ga0500611_000075 Ga0500611_000075_17871_18572 211
507 3300005337 Ga0070682_100494482 Ga0070682_1004944821 212
508 3300005459 Ga0068867_100689375 Ga0068867_1006893751 212
509 3300005539 Ga0068853_100015298 Ga0068853_1000152982 212
510 3300005617 Ga0068859_100392642 Ga0068859_1003926422 212
511 3300005841 Ga0068863_100034806 Ga0068863_1000348062 212
512 3300006931 Ga0097620_100392655 Ga0097620_1003926552 212
513 3300026041 Ga0207639_10010753 Ga0207639_100107535 212
514 3300026088 Ga0207641_10145732 Ga0207641_101457322 212
515 3300006195 Ga0075366_10011952 Ga0075366_100119525 213
516 3300028380 Ga0268265_10538302 Ga0268265_105383021 213
517 3300031852 Ga0307410_10072079 Ga0307410_100720791 213
518 3300031911 Ga0307412_10426653 Ga0307412_104266532 213
519 3300042007 Ga0439449_0063473 Ga0439449_0063473_440_1144 213
520 3300042014 Ga0439457_027840 Ga0439457_027840_327_1031 213
521 3300050493 nmdc:mga0k408_9565_c1 nmdc:mga0k408_9565_c1_1701_2405 213
522 3300005353 Ga0070669_100194920 Ga0070669_1001949202 214
523 3300042014 Ga0439457_008964 Ga0439457_008964_794_1465 214
524 3300049686 Ga0501257_043449 Ga0501257_043449_179_841 214
525 3300005445 Ga0070708_100323811 Ga0070708_1003238112 215
526 3300005617 Ga0068859_100065804 Ga0068859_1000658044 215
527 3300005618 Ga0068864_100120854 Ga0068864_1001208542 215
528 3300005842 Ga0068858_101027672 Ga0068858_1010276721 215
529 3300005843 Ga0068860_100018651 Ga0068860_1000186511 215
530 3300005843 Ga0068860_100111999 Ga0068860_1001119992 215
531 3300006931 Ga0097620_100065800 Ga0097620_1000658001 215
532 3300009101 Ga0105247_10004365 Ga0105247_100043653 215
533 3300009553 Ga0105249_10020018 Ga0105249_100200184 215
534 3300025949 Ga0207667_10340325 Ga0207667_103403251 215
535 3300025961 Ga0207712_10016748 Ga0207712_100167483 215
536 3300026116 Ga0207674_10069369 Ga0207674_100693692 215
537 3300026116 Ga0207674_10606198 Ga0207674_106061982 215
538 3300026118 Ga0207675_100660302 Ga0207675_1006603022 215
539 3300028381 Ga0268264_10007090 Ga0268264_100070902 215
540 3300005290 Ga0065712_10068728 Ga0065712_100687287 216
541 3300005333 Ga0070677_10092274 Ga0070677_100922741 216
542 3300005334 Ga0068869_100049089 Ga0068869_1000490892 216
543 3300005340 Ga0070689_100020116 Ga0070689_1000201163 216
544 3300005353 Ga0070669_100008945 Ga0070669_1000089452 216
545 3300005354 Ga0070675_100001853 Ga0070675_10000185316 216
546 3300005364 Ga0070673_100023170 Ga0070673_1000231704 216
547 3300005365 Ga0070688_100000797 Ga0070688_1000007977 216
548 3300005438 Ga0070701_10016422 Ga0070701_100164222 216
549 3300005444 Ga0070694_100211633 Ga0070694_1002116332 216
550 3300005544 Ga0070686_100116920 Ga0070686_1001169202 216
551 3300005564 Ga0070664_100281294 Ga0070664_1002812942 216
552 3300005577 Ga0068857_100018587 Ga0068857_1000185872 216
553 3300005617 Ga0068859_100164619 Ga0068859_1001646192 216
554 3300005719 Ga0068861_100010078 Ga0068861_1000100783 216
555 3300005840 Ga0068870_10009000 Ga0068870_100090002 216
556 3300005844 Ga0068862_100226233 Ga0068862_1002262332 216
557 3300006931 Ga0097620_100164625 Ga0097620_1001646252 216
558 3300009094 Ga0111539_10001795 Ga0111539_1000179524 216
559 3300009176 Ga0105242_10668963 Ga0105242_106689631 216
560 3300009553 Ga0105249_10053584 Ga0105249_100535842 216
561 3300013306 Ga0163162_10059113 Ga0163162_100591133 216
562 3300013308 Ga0157375_10043460 Ga0157375_100434602 216
563 3300014326 Ga0157380_10008693 Ga0157380_100086934 216
564 3300014745 Ga0157377_10000903 Ga0157377_1000090314 216
565 3300025908 Ga0207643_10021539 Ga0207643_100215393 216
566 3300025923 Ga0207681_10024153 Ga0207681_100241532 216
567 3300025926 Ga0207659_10037945 Ga0207659_100379452 216
568 3300025942 Ga0207689_10161349 Ga0207689_101613492 216
569 3300025960 Ga0207651_10084605 Ga0207651_100846052 216
570 3300025961 Ga0207712_10163320 Ga0207712_101633202 216
571 3300026089 Ga0207648_10035476 Ga0207648_100354762 216
572 3300026116 Ga0207674_10035928 Ga0207674_100359284 216
573 3300026118 Ga0207675_100000938 Ga0207675_10000093821 216
574 3300028380 Ga0268265_10003979 Ga0268265_100039796 216
575 3300050511 nmdc:mga08y16_9862_c1 nmdc:mga08y16_9862_c1_8130_8843 216
576 3300049674 Ga0501242_000510 Ga0501242_000510_1870_2535 218
577 3300049688 Ga0501259_009993 Ga0501259_009993_732_1397 218
578 3300049708 Ga0501245_002369 Ga0501245_002369_1473_2138 218
579 3300049763 Ga0501266_001991 Ga0501266_001991_1043_1708 218
580 3300013102 Ga0157371_10113005 Ga0157371_101130052 219
581 3300013307 Ga0157372_10189734 Ga0157372_101897342 219
582 3300037471 Ga0395905_0066510 Ga0395905_0066510_2074_2763 223
583 3300037471 Ga0395905_0184063 Ga0395905_0184063_1009_1698 223
584 3300001904 JGI24736J21556_1008240 JGI24736J21556_10082402 224
585 3300005539 Ga0068853_100131206 Ga0068853_1001312064 224
586 3300026041 Ga0207639_10193447 Ga0207639_101934472 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14127

DUF4294

Domain of unknown function (DUF4294)

72

224

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d9d-assembly1.cif.gz_A solution structure of the bag domain (275-350) of bag-family molecular chaperone regulator-5 0.4903 89 171
2d9d-assembly1.cif.gz_A solution structure of the bag domain (275-350) of bag-family molecular chaperone regulator-5 0.458 89 171
1nwm-assembly1.cif.gz_X gat domain of human gga1 0.4426 68 166
5wp3-assembly1.cif.gz_B crystal structure of eed in complex with eb22 0.4405 87 180
7dgy-assembly1.cif.gz_A de novo designed protein h4c2r 0.4345 91 207
ID Description Score Start End Superfamily
af_B2RUP2_751_827_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.6678 80 154 1.25.10.10
af_B2RUP2_751_827_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.6283 80 154 1.25.10.10
4evfA02 Mainly Alpha;Orthogonal Bundle;Annexin V; domain 1;Annexin 0.5378 113 180 1.10.220.10
4evfA02 Mainly Alpha;Orthogonal Bundle;Annexin V; domain 1;Annexin 0.5027 113 180 1.10.220.10
af_Q84SL6_255_359_1.20.58.1220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Exo84p, C-terminal helical domain 0.4943 85 180 1.20.58.1220
ID Description Score Start End GO Terms
AF-A0A257W5X7-F1-model_v4 DUF4294 domain-containing protein 0.9463 66 217
AF-A0A4Q5SVJ5-F1-model_v4 DUF4294 domain-containing protein 0.9058 42 223
AF-A0A257W5X7-F1-model_v4 DUF4294 domain-containing protein 0.8844 66 217
AF-A0A1M3G5J3-F1-model_v4 DUF4294 domain-containing protein 0.8614 35 218
AF-A0A4Q5SVJ5-F1-model_v4 DUF4294 domain-containing protein 0.8568 42 223

Feature Viewer

pLDDT pTM Quality
73.86 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map