F466544

General Info

Members Datasets Scaffolds Average Seq Length
586 315 1172 133

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10202435|Ga0111539_102024351
Length 146
Sequence MRHRHGLRKLNRTSSHRLAMLRNMTNSLLRHEIIQTTLPKAKELRRVAEPIITLGKAATLANRRLAFNRLRDRAMVVKLFDELGPRYAARNGGYLRILKAGFRKGDNAPMALVELLDRPDAEVGADSGSERRAARNREEPAEQVAG

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
101 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
102 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
183 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
189 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
190 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
198 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
201 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
202 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
219 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
220 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
221 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
236 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
283 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
286 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
298 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
301 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
302 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
303 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
304 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
305 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
306 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
307 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
308 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
309 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
310 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
311 2547132512 Azospira oryzae 6a3 Isolate Unclassified
312 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
313 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
314 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
315 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0.17
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.53
Nodule 0
Rhizoplane 1.37
Rhizosphere 88.23
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10202435 3300009094 Bacteria 2315
2 Ga0070658_10897771 3300005327 Bacteria 770
3 Ga0070676_10782145 3300005328 Bacteria 703
4 Ga0070683_100184513 3300005329 Bacteria 1980
5 Ga0070683_100766444 3300005329 Bacteria 924
6 Ga0070670_100041949 3300005331 Bacteria 3932
7 Ga0070670_100397325 3300005331 Bacteria 1217
8 Ga0070677_10318353 3300005333 Bacteria 796
9 Ga0068869_100000239 3300005334 Bacteria 28911
10 Ga0070666_10437128 3300005335 Bacteria 944
11 Ga0070680_100082662 3300005336 Bacteria 2651
12 Ga0070680_100702174 3300005336 Bacteria 870
13 Ga0070682_100048033 3300005337 Bacteria 2656
14 Ga0068868_100103199 3300005338 Bacteria 2309
15 Ga0068868_100197383 3300005338 Bacteria 1676
16 Ga0068868_101039356 3300005338 Bacteria 751
17 Ga0070689_100359815 3300005340 Bacteria 1222
18 Ga0070687_100123981 3300005343 Bacteria 1482
19 Ga0070687_100450898 3300005343 Bacteria 856
20 Ga0070661_100443759 3300005344 Bacteria 1032
21 Ga0070692_10230773 3300005345 Bacteria 1099
22 Ga0070692_10495726 3300005345 Bacteria 791
23 Ga0070692_11310040 3300005345 Bacteria 520
24 Ga0070668_100914534 3300005347 Bacteria 785
25 Ga0070669_100932473 3300005353 Bacteria 743
26 Ga0070675_100318733 3300005354 Bacteria 1373
27 Ga0070675_100517107 3300005354 Bacteria 1077
28 Ga0070671_100307220 3300005355 Bacteria 1351
29 Ga0070671_100482469 3300005355 Bacteria 1065
30 Ga0070674_100105296 3300005356 Bacteria 2062
31 Ga0070674_100261564 3300005356 Bacteria 1363
32 Ga0070673_100118890 3300005364 Bacteria 2201
33 Ga0070673_100719881 3300005364 Bacteria 917
34 Ga0070659_100111138 3300005366 Bacteria 2212
35 Ga0070659_100322280 3300005366 Bacteria 1292
36 Ga0070659_100961346 3300005366 Bacteria 748
37 Ga0070667_100241938 3300005367 Bacteria 1611
38 Ga0070709_11065518 3300005434 Bacteria 645
39 Ga0070714_100346772 3300005435 Bacteria 1394
40 Ga0070713_100670775 3300005436 Bacteria 988
41 Ga0070713_101843916 3300005436 Bacteria 587
42 Ga0070710_10387403 3300005437 Bacteria 934
43 Ga0070701_10482390 3300005438 Bacteria 801
44 Ga0070711_100376169 3300005439 Unclassified 1147
45 Ga0070705_100827879 3300005440 Bacteria 739
46 Ga0070705_100842409 3300005440 Bacteria 733
47 Ga0070705_101686929 3300005440 Bacteria 535
48 Ga0070700_100013966 3300005441 Bacteria 4526
49 Ga0070700_100579275 3300005441 Bacteria 876
50 Ga0070694_100431826 3300005444 Bacteria 1037
51 Ga0070708_100969366 3300005445 Bacteria 798
52 Ga0070678_100032926 3300005456 Bacteria 3593
53 Ga0070678_100217204 3300005456 Bacteria 1587
54 Ga0070681_10029739 3300005458 Bacteria 5484
55 Ga0070681_10120986 3300005458 Bacteria 2553
56 Ga0070681_11193925 3300005458 Bacteria 683
57 Ga0068867_100230339 3300005459 Bacteria 1497
58 Ga0068867_100328275 3300005459 Bacteria 1270
59 Ga0068867_100515036 3300005459 Bacteria 1031
60 Ga0068867_100521484 3300005459 Bacteria 1025
61 Ga0068867_100735731 3300005459 Bacteria 874
62 Ga0068867_101153455 3300005459 Bacteria 710
63 Ga0070707_101050549 3300005468 Bacteria 780
64 Ga0070698_100575864 3300005471 Bacteria 1066
65 Ga0070698_101204345 3300005471 Bacteria 707
66 Ga0070699_100954813 3300005518 Bacteria 786
67 Ga0070699_100998353 3300005518 Bacteria 767
68 Ga0070679_100078071 3300005530 Bacteria 3300
69 Ga0070679_100129529 3300005530 Bacteria 2505
70 Ga0070679_100151965 3300005530 Bacteria 2291
71 Ga0070679_101219524 3300005530 Bacteria 698
72 Ga0070684_100986388 3300005535 Bacteria 790
73 Ga0070697_100106944 3300005536 Bacteria 2328
74 Ga0068853_100131569 3300005539 Bacteria 2240
75 Ga0068853_100173648 3300005539 Bacteria 1951
76 Ga0068853_100461883 3300005539 Bacteria 1195
77 Ga0068853_100811059 3300005539 Bacteria 896
78 Ga0068853_101142045 3300005539 Bacteria 752
79 Ga0070686_101124061 3300005544 Bacteria 650
80 Ga0070696_100953509 3300005546 Bacteria 714
81 Ga0070696_102007097 3300005546 Bacteria 502
82 Ga0070693_100367732 3300005547 Bacteria 988
83 Ga0070693_100837410 3300005547 Bacteria 685
84 Ga0070665_100239175 3300005548 Bacteria 1816
85 Ga0070665_101484214 3300005548 Bacteria 687
86 Ga0070704_100117650 3300005549 Bacteria 2034
87 Ga0070704_100499751 3300005549 Bacteria 1055
88 Ga0068855_100008416 3300005563 Bacteria 12475
89 Ga0068855_100017369 3300005563 Bacteria 8657
90 Ga0068855_100019447 3300005563 Bacteria 8160
91 Ga0068855_101356818 3300005563 Bacteria 734
92 Ga0070664_100593092 3300005564 Bacteria 1027
93 Ga0070664_101289173 3300005564 Bacteria 690
94 Ga0070664_101469755 3300005564 Bacteria 645
95 Ga0068857_101517694 3300005577 Bacteria 653
96 Ga0068854_100562680 3300005578 Bacteria 969
97 Ga0068856_100033727 3300005614 Bacteria 5014
98 Ga0068856_100123081 3300005614 Bacteria 2596
99 Ga0068856_100434983 3300005614 Bacteria 1332
100 Ga0068856_101054662 3300005614 Bacteria 831
101 Ga0070702_100616451 3300005615 Bacteria 816
102 Ga0070702_100946193 3300005615 Bacteria 678
103 Ga0070702_101270173 3300005615 Bacteria 596
104 Ga0068852_100013995 3300005616 Bacteria 6155
105 Ga0068852_100057823 3300005616 Bacteria 3356
106 Ga0068859_100148571 3300005617 Bacteria 2419
107 Ga0068864_100054268 3300005618 Bacteria 3459
108 Ga0068866_10021978 3300005718 Bacteria 2946
109 Ga0068861_100156950 3300005719 Bacteria 1873
110 Ga0068861_100954198 3300005719 Bacteria 816
111 Ga0068861_102591816 3300005719 Bacteria 511
112 Ga0068851_10050452 3300005834 Bacteria 2112
113 Ga0068851_10120112 3300005834 Bacteria 1411
114 Ga0068870_10954823 3300005840 Bacteria 609
115 Ga0068863_100005897 3300005841 Bacteria 12009
116 Ga0068863_102167846 3300005841 Bacteria 566
117 Ga0068858_100009002 3300005842 Bacteria 9549
118 Ga0068858_100027257 3300005842 Bacteria 5309
119 Ga0068858_100083384 3300005842 Bacteria 2972
120 Ga0068858_100832406 3300005842 Bacteria 901
121 Ga0068858_101201272 3300005842 Bacteria 745
122 Ga0068858_101991896 3300005842 Bacteria 574
123 Ga0068858_102409410 3300005842 Bacteria 520
124 Ga0068862_100073979 3300005844 Bacteria 2945
125 Ga0068862_100268762 3300005844 Bacteria 1559
126 Ga0070717_11004923 3300006028 Bacteria 760
127 Ga0075365_10147554 3300006038 Bacteria 1635
128 Ga0075365_10678944 3300006038 Bacteria 728
129 Ga0075368_10002682 3300006042 Bacteria 5858
130 Ga0075363_100016443 3300006048 Bacteria 3654
131 Ga0075363_100150445 3300006048 Bacteria 1314
132 Ga0075364_10403081 3300006051 Bacteria 933
133 Ga0075364_10617633 3300006051 Bacteria 741
134 Ga0075364_11118474 3300006051 Bacteria 535
135 Ga0070715_10224445 3300006163 Bacteria 968
136 Ga0070712_100391971 3300006175 Unclassified 1145
137 Ga0070712_100468283 3300006175 Bacteria 1052
138 Ga0075362_10032262 3300006177 Bacteria 2272
139 Ga0075367_10068609 3300006178 Bacteria 2127
140 Ga0075367_10240455 3300006178 Bacteria 1135
141 Ga0075369_10058580 3300006186 Bacteria 1677
142 Ga0075366_10003900 3300006195 Bacteria 7953
143 Ga0075366_10048007 3300006195 Bacteria 2531
144 Ga0075366_10071039 3300006195 Bacteria 2074
145 Ga0075366_10331180 3300006195 Bacteria 933
146 Ga0097621_100347649 3300006237 Bacteria 1318
147 Ga0075370_10007567 3300006353 Bacteria 5537
148 Ga0068871_100003989 3300006358 Bacteria 10207
149 Ga0068871_100041716 3300006358 Bacteria 3681
150 Ga0068871_100992503 3300006358 Bacteria 782
151 Ga0075428_100051648 3300006844 Bacteria 4508
152 Ga0075428_100884281 3300006844 Bacteria 948
153 Ga0075433_11246386 3300006852 Bacteria 645
154 Ga0075434_100025576 3300006871 Bacteria 5776
155 Ga0075434_100124409 3300006871 Bacteria 2596
156 Ga0075434_100429316 3300006871 Bacteria 1342
157 Ga0075434_100855297 3300006871 Bacteria 925
158 Ga0068865_101025001 3300006881 Bacteria 724
159 Ga0075436_100000862 3300006914 Bacteria 20155
160 Ga0075436_100056376 3300006914 Bacteria 2714
161 Ga0075436_100073902 3300006914 Bacteria 2360
162 Ga0097620_100148573 3300006931 Bacteria 2419
163 Ga0075435_100172209 3300007076 Bacteria 1827
164 Ga0075435_101610583 3300007076 Bacteria 570
165 Ga0099794_10015066 3300007265 Bacteria 3404
166 Ga0099794_10025195 3300007265 Bacteria 2737
167 Ga0099794_10355689 3300007265 Bacteria 762
168 Ga0105251_10462060 3300009011 Bacteria 589
169 Ga0105240_10003296 3300009093 Bacteria 25239
170 Ga0105240_10070801 3300009093 Bacteria 4313
171 Ga0105240_11018909 3300009093 Bacteria 885
172 Ga0105240_11952901 3300009093 Bacteria 610
173 Ga0105240_12043598 3300009093 Bacteria 595
174 Ga0111539_10004777 3300009094 Bacteria 17692
175 Ga0111539_11074802 3300009094 Bacteria 935
176 Ga0105245_10044453 3300009098 Bacteria 3964
177 Ga0105245_10187258 3300009098 Bacteria 1981
178 Ga0105245_10578710 3300009098 Bacteria 1147
179 Ga0105245_11358064 3300009098 Bacteria 760
180 Ga0105247_10440622 3300009101 Bacteria 937
181 Ga0114129_10573939 3300009147 Bacteria 1464
182 Ga0105243_10050853 3300009148 Bacteria 3275
183 Ga0105243_10168466 3300009148 Bacteria 1895
184 Ga0105243_10535911 3300009148 Bacteria 1116
185 Ga0105241_10133559 3300009174 Bacteria 2012
186 Ga0105241_10286930 3300009174 Bacteria 1408
187 Ga0105241_11543553 3300009174 Bacteria 640
188 Ga0105241_12038162 3300009174 Bacteria 566
189 Ga0105242_10006123 3300009176 Bacteria 9271
190 Ga0105242_10081256 3300009176 Bacteria 2710
191 Ga0105242_10249820 3300009176 Bacteria 1598
192 Ga0105242_10941765 3300009176 Bacteria 867
193 Ga0105248_10062805 3300009177 Bacteria 4170
194 Ga0105248_10539955 3300009177 Bacteria 1315
195 Ga0105248_11835285 3300009177 Bacteria 688
196 Ga0105237_10033934 3300009545 Bacteria 5170
197 Ga0105237_10041822 3300009545 Bacteria 4621
198 Ga0105237_10600948 3300009545 Bacteria 1107
199 Ga0105237_11058780 3300009545 Bacteria 818
200 Ga0105237_11090614 3300009545 Bacteria 805
201 Ga0105238_10351942 3300009551 Bacteria 1462
202 Ga0105238_10492404 3300009551 Bacteria 1226
203 Ga0105238_10690610 3300009551 Bacteria 1032
204 Ga0105238_10786215 3300009551 Bacteria 967
205 Ga0105238_11050577 3300009551 Bacteria 836
206 Ga0105249_11801180 3300009553 Bacteria 685
207 Ga0105249_12109979 3300009553 Bacteria 636
208 Ga0105239_10016687 3300010375 Bacteria 8118
209 Ga0105239_10224013 3300010375 Bacteria 2109
210 Ga0105239_11159515 3300010375 Bacteria 890
211 Ga0105239_12319771 3300010375 Bacteria 625
212 Ga0157346_1012824 3300012480 Bacteria 639
213 Ga0157318_1013691 3300012482 Bacteria 643
214 Ga0157316_1064741 3300012510 Bacteria 538
215 Ga0157373_10014959 3300013100 Bacteria 5679
216 Ga0157373_10658576 3300013100 Bacteria 765
217 Ga0157371_10549174 3300013102 Bacteria 856
218 Ga0157371_10921248 3300013102 Bacteria 663
219 Ga0157370_10008784 3300013104 Bacteria 10854
220 Ga0157369_10290349 3300013105 Bacteria 1702
221 Ga0157369_10470448 3300013105 Bacteria 1301
222 Ga0157369_10473252 3300013105 Bacteria 1296
223 Ga0157374_10142688 3300013296 Bacteria 2325
224 Ga0157374_10144200 3300013296 Bacteria 2313
225 Ga0157374_11689795 3300013296 Bacteria 658
226 Ga0157378_10043202 3300013297 Bacteria 4002
227 Ga0157378_10715357 3300013297 Bacteria 1022
228 Ga0157378_11216466 3300013297 Bacteria 793
229 Ga0163162_10113966 3300013306 Bacteria 2802
230 Ga0163162_10621849 3300013306 Bacteria 1205
231 Ga0163162_10841329 3300013306 Bacteria 1033
232 Ga0163162_11162680 3300013306 Bacteria 875
233 Ga0157372_10006865 3300013307 Bacteria 12114
234 Ga0157372_11123795 3300013307 Bacteria 909
235 Ga0157375_10050523 3300013308 Bacteria 4079
236 Ga0163163_11579056 3300014325 Bacteria 717
237 Ga0157380_10619532 3300014326 Bacteria 1074
238 Ga0157380_10710913 3300014326 Bacteria 1011
239 Ga0157380_11705514 3300014326 Bacteria 688
240 Ga0182008_10018284 3300014497 Bacteria 3629
241 Ga0157377_10124346 3300014745 Bacteria 1567
242 Ga0157379_10068146 3300014968 Bacteria 3181
243 Ga0157379_10125264 3300014968 Bacteria 2312
244 Ga0157376_10051732 3300014969 Bacteria 3412
245 Ga0157376_10618976 3300014969 Bacteria 1080
246 Ga0157376_10763873 3300014969 Bacteria 977
247 Ga0163161_10628811 3300017792 Bacteria 888
248 Ga0163161_11512498 3300017792 Bacteria 589
249 Ga0206354_10063477 3300020081 Bacteria 642
250 Ga0213872_10021164 3300021361 Bacteria 2994
251 Ga0213876_10162750 3300021384 Bacteria 1187
252 Ga0207656_10001500 3300025321 Bacteria 7731
253 Ga0207642_10125207 3300025899 Bacteria 1332
254 Ga0207688_10061781 3300025901 Bacteria 2112
255 Ga0207680_10374569 3300025903 Bacteria 1003
256 Ga0207699_10850384 3300025906 Bacteria 672
257 Ga0207645_10693848 3300025907 Bacteria 692
258 Ga0207705_10260813 3300025909 Bacteria 1323
259 Ga0207705_10468452 3300025909 Bacteria 977
260 Ga0207705_10668060 3300025909 Bacteria 808
261 Ga0207654_10324969 3300025911 Bacteria 1053
262 Ga0207654_10562009 3300025911 Bacteria 811
263 Ga0207707_10049882 3300025912 Bacteria 3647
264 Ga0207707_10077125 3300025912 Bacteria 2908
265 Ga0207707_10806939 3300025912 Bacteria 781
266 Ga0207707_11171241 3300025912 Bacteria 623
267 Ga0207695_10009540 3300025913 Bacteria 12001
268 Ga0207695_10529200 3300025913 Bacteria 1060
269 Ga0207671_10017161 3300025914 Bacteria 5593
270 Ga0207671_10520013 3300025914 Bacteria 949
271 Ga0207671_11163078 3300025914 Bacteria 604
272 Ga0207693_10304221 3300025915 Bacteria 1249
273 Ga0207693_10519131 3300025915 Unclassified 929
274 Ga0207663_10056311 3300025916 Bacteria 2471
275 Ga0207663_10662030 3300025916 Unclassified 825
276 Ga0207660_10523218 3300025917 Bacteria 963
277 Ga0207660_11637753 3300025917 Bacteria 518
278 Ga0207662_10202198 3300025918 Bacteria 1286
279 Ga0207662_10320382 3300025918 Bacteria 1035
280 Ga0207649_10463214 3300025920 Bacteria 959
281 Ga0207652_10100647 3300025921 Bacteria 2552
282 Ga0207652_11096441 3300025921 Bacteria 696
283 Ga0207681_10575209 3300025923 Bacteria 929
284 Ga0207694_10015938 3300025924 Bacteria 5672
285 Ga0207694_10428260 3300025924 Bacteria 1103
286 Ga0207694_10438924 3300025924 Bacteria 1089
287 Ga0207694_11540167 3300025924 Bacteria 561
288 Ga0207650_10060557 3300025925 Bacteria 2825
289 Ga0207650_11378094 3300025925 Bacteria 600
290 Ga0207659_10243675 3300025926 Bacteria 1455
291 Ga0207687_10062240 3300025927 Bacteria 2638
292 Ga0207700_10107445 3300025928 Bacteria 2239
293 Ga0207700_11085143 3300025928 Bacteria 716
294 Ga0207664_10527148 3300025929 Bacteria 1059
295 Ga0207644_10274777 3300025931 Bacteria 1351
296 Ga0207644_10986571 3300025931 Bacteria 707
297 Ga0207690_10099810 3300025932 Bacteria 2070
298 Ga0207690_10238835 3300025932 Bacteria 1399
299 Ga0207706_11225902 3300025933 Bacteria 623
300 Ga0207686_10069757 3300025934 Bacteria 2256
301 Ga0207686_10113674 3300025934 Bacteria 1831
302 Ga0207686_10333869 3300025934 Bacteria 1136
303 Ga0207686_11057720 3300025934 Bacteria 660
304 Ga0207709_10451427 3300025935 Bacteria 994
305 Ga0207669_10050079 3300025937 Bacteria 2494
306 Ga0207669_11025655 3300025937 Bacteria 694
307 Ga0207704_10759876 3300025938 Bacteria 807
308 Ga0207704_11394964 3300025938 Bacteria 600
309 Ga0207665_10136638 3300025939 Bacteria 1745
310 Ga0207691_10083916 3300025940 Bacteria 2860
311 Ga0207691_10849583 3300025940 Bacteria 765
312 Ga0207711_10040325 3300025941 Bacteria 3972
313 Ga0207689_10000370 3300025942 Bacteria 42422
314 Ga0207689_10911461 3300025942 Bacteria 742
315 Ga0207661_10841865 3300025944 Bacteria 844
316 Ga0207679_10116237 3300025945 Bacteria 2121
317 Ga0207667_10011637 3300025949 Bacteria 10213
318 Ga0207667_10249444 3300025949 Bacteria 1816
319 Ga0207667_12083654 3300025949 Bacteria 526
320 Ga0207651_10015447 3300025960 Bacteria 4437
321 Ga0207712_10982713 3300025961 Bacteria 748
322 Ga0207640_10591020 3300025981 Bacteria 938
323 Ga0207640_10911403 3300025981 Bacteria 768
324 Ga0207658_10233208 3300025986 Bacteria 1555
325 Ga0207658_10513691 3300025986 Bacteria 1068
326 Ga0207677_10006249 3300026023 Bacteria 6514
327 Ga0207677_10207482 3300026023 Bacteria 1562
328 Ga0207677_10819256 3300026023 Bacteria 834
329 Ga0207703_10069578 3300026035 Bacteria 2903
330 Ga0207703_10489216 3300026035 Bacteria 1154
331 Ga0207703_11271200 3300026035 Bacteria 708
332 Ga0207639_10013232 3300026041 Bacteria 5768
333 Ga0207639_10172407 3300026041 Bacteria 1833
334 Ga0207639_10189767 3300026041 Bacteria 1754
335 Ga0207639_10582061 3300026041 Bacteria 1030
336 Ga0207678_10082772 3300026067 Bacteria 2746
337 Ga0207708_10033659 3300026075 Bacteria 3895
338 Ga0207708_10789366 3300026075 Bacteria 817
339 Ga0207702_10015403 3300026078 Bacteria 6336
340 Ga0207702_10272295 3300026078 Bacteria 1597
341 Ga0207702_10367696 3300026078 Bacteria 1380
342 Ga0207702_11052545 3300026078 Bacteria 807
343 Ga0207702_11589147 3300026078 Bacteria 647
344 Ga0207641_10190858 3300026088 Bacteria 1883
345 Ga0207641_11353290 3300026088 Bacteria 713
346 Ga0207641_11540651 3300026088 Bacteria 666
347 Ga0207648_10090358 3300026089 Bacteria 2676
348 Ga0207648_10283009 3300026089 Bacteria 1483
349 Ga0207648_10325469 3300026089 Bacteria 1382
350 Ga0207648_10870773 3300026089 Bacteria 840
351 Ga0207648_12178312 3300026089 Bacteria 515
352 Ga0207676_10176567 3300026095 Bacteria 1866
353 Ga0207674_10150649 3300026116 Bacteria 2283
354 Ga0207683_10038091 3300026121 Bacteria 4188
355 Ga0207683_10040680 3300026121 Bacteria 4057
356 Ga0207683_10111579 3300026121 Bacteria 2449
357 Ga0207683_10622949 3300026121 Bacteria 999
358 Ga0207698_10053328 3300026142 Bacteria 3104
359 Ga0207698_10478473 3300026142 Bacteria 1207
360 Ga0209969_1000383 3300027360 Bacteria 5901
361 Ga0210000_1016818 3300027462 Bacteria 1106
362 Ga0209999_1001158 3300027543 Bacteria 4500
363 Ga0209588_1009253 3300027671 Bacteria 2940
364 Ga0209588_1157021 3300027671 Bacteria 719
365 Ga0209588_1233763 3300027671 Bacteria 565
366 Ga0209971_1003675 3300027682 Bacteria 3636
367 Ga0209998_10032618 3300027717 Bacteria 1158
368 Ga0209813_10023151 3300027866 Bacteria 1764
369 Ga0209813_10084750 3300027866 Bacteria 1054
370 Ga0209974_10001043 3300027876 Bacteria 9809
371 Ga0207428_10007467 3300027907 Bacteria 9965
372 Ga0207428_10148918 3300027907 Bacteria 1782
373 Ga0207428_11305681 3300027907 Bacteria 503
374 Ga0268266_10118435 3300028379 Bacteria 2354
375 Ga0268266_10149487 3300028379 Bacteria 2104
376 Ga0268266_10199873 3300028379 Bacteria 1829
377 Ga0268265_10084722 3300028380 Bacteria 2513
378 Ga0268265_10233470 3300028380 Bacteria 1618
379 Ga0268264_10083813 3300028381 Bacteria 2731
380 Ga0307511_10000653 3300030521 Bacteria 37038
381 Ga0265332_10048865 3300031238 Bacteria 1819
382 Ga0265328_10000839 3300031239 Bacteria 14245
383 Ga0265328_10021475 3300031239 Bacteria 2463
384 Ga0265328_10114687 3300031239 Bacteria 1002
385 Ga0265328_10134913 3300031239 Bacteria 925
386 Ga0265331_10000050 3300031250 Bacteria 181286
387 Ga0265331_10003466 3300031250 Bacteria 10177
388 Ga0265327_10000109 3300031251 Bacteria 181275
389 Ga0265327_10000161 3300031251 Bacteria 144768
390 Ga0265327_10004575 3300031251 Bacteria 12181
391 Ga0265316_10238687 3300031344 Bacteria 1337
392 Ga0265316_10324601 3300031344 Bacteria 1118
393 Ga0307408_100293848 3300031548 Bacteria 1358
394 Ga0307406_10661368 3300031901 Bacteria 868
395 Ga0307409_101363461 3300031995 Bacteria 735
396 Ga0373958_0063341 3300034819 Bacteria 806
397 Ga0373928_0127448 3300035084 Bacteria 687
398 Ga0373932_0294181 3300035112 Bacteria 604
399 Ga0373939_0327205 3300035114 Bacteria 618
400 Ga0373953_0033407 3300035117 Bacteria 2012
401 Ga0373954_0093041 3300035118 Bacteria 1449
402 Ga0373956_0059357 3300035119 Bacteria 1730
403 Ga0373957_0022817 3300035120 Bacteria 2233
404 Ga0373957_0035427 3300035120 Bacteria 1854
405 Ga0373955_0025822 3300035172 Bacteria 3020
406 Ga0373955_0671310 3300035172 Bacteria 636
407 Ga0373942_0209632 3300035207 Bacteria 649
408 Ga0373962_0229417 3300035242 Bacteria 638
409 Ga0373935_0573763 3300035692 Bacteria 824
410 Ga0373935_1196402 3300035692 Bacteria 566
411 Ga0373927_0173010 3300035695 Bacteria 1416
412 Ga0373933_0013960 3300035724 Bacteria 4457
413 Ga0373933_0211461 3300035724 Bacteria 1243
414 Ga0373933_0880156 3300035724 Bacteria 590
415 Ga0373937_0019465 3300036401 Bacteria 6077
416 Ga0373937_0057553 3300036401 Bacteria 3572
417 Ga0373937_0059217 3300036401 Bacteria 3519
418 Ga0373937_0395335 3300036401 Bacteria 1311
419 Ga0373925_0585040 3300037068 Bacteria 919
420 Ga0395899_0171993 3300037312 Bacteria 1525
421 Ga0395900_0884280 3300037418 Bacteria 817
422 Ga0395905_0013092 3300037471 Bacteria 7964
423 Ga0400483_057151 3300039062 Bacteria 1965
424 Ga0400483_139236 3300039062 Bacteria 1444
425 Ga0400483_186650 3300039062 Bacteria 2969
426 Ga0436365_0854741 3300039437 Bacteria 685
427 Ga0436365_1601346 3300039437 Bacteria 2241
428 Ga0436361_0050017 3300039447 Bacteria 26618
429 Ga0439447_163493 3300041407 Bacteria 513
430 Ga0451789_1187517 3300041443 Bacteria 560
431 Ga0451839_0692740 3300041496 Bacteria 650
432 Ga0451853_0874889 3300041512 Bacteria 781
433 Ga0451577_1007827 3300042876 Bacteria 748
434 Ga0451577_1047828 3300042876 Bacteria 731
435 Ga0453683_0674112 3300044673 Bacteria 677
436 Ga0453684_0353189 3300044712 Bacteria 1657
437 Ga0453684_0846607 3300044712 Bacteria 983
438 Ga0451576_1049256 3300045051 Bacteria 854
439 Ga0495603_0562736 3300046455 Bacteria 653
440 Ga0495629_0319230 3300046459 Bacteria 1062
441 Ga0495608_0103787 3300046511 Bacteria 1831
442 Ga0495628_0006157 3300046516 Bacteria 10491
443 Ga0495630_0110176 3300046517 Bacteria 2085
444 Ga0495642_0434036 3300046528 Bacteria 580
445 Ga0495640_0418098 3300046533 Bacteria 821
446 Ga0495586_0043984 3300046535 Bacteria 2404
447 Ga0495598_0417969 3300046537 Bacteria 526
448 Ga0495621_0196828 3300046539 Bacteria 809
449 Ga0495621_0412732 3300046539 Bacteria 574
450 Ga0495645_0204491 3300046543 Bacteria 1337
451 Ga0495622_0268605 3300046557 Bacteria 748
452 Ga0495667_0023519 3300046559 Bacteria 4151
453 Ga0495656_0795823 3300046615 Bacteria 511
454 Ga0495668_0261270 3300046616 Bacteria 948
455 Ga0495657_0146887 3300046675 Bacteria 1466
456 Ga0495646_0340110 3300046680 Bacteria 788
457 Ga0495647_0516737 3300046681 Bacteria 557
458 Ga0495600_0073469 3300046809 Bacteria 2233
459 Ga0495604_0039043 3300047317 Bacteria 3732
460 Ga0495636_0103288 3300047318 Bacteria 1248
461 Ga0495680_0172127 3300047322 Bacteria 1567
462 Ga0495675_0365813 3300047444 Bacteria 846
463 Ga0495684_0133481 3300047471 Bacteria 1863
464 Ga0496102_0418388 3300048905 Bacteria 1259
465 Ga0496104_0035628 3300048907 Bacteria 4647
466 Ga0496104_0779031 3300048907 Bacteria 863
467 Ga0496104_1106928 3300048907 Bacteria 696
468 Ga0496110_0103024 3300048913 Bacteria 2560
469 Ga0496113_0862544 3300048916 Bacteria 717
470 Ga0496114_0756197 3300048917 Bacteria 849
471 Ga0501031_0011216 3300049568 Bacteria 5841
472 Ga0501032_0003598 3300049569 Bacteria 11803
473 Ga0501032_0012634 3300049569 Bacteria 6025
474 Ga0501033_0001817 3300049570 Bacteria 18639
475 Ga0501033_0004521 3300049570 Bacteria 11131
476 Ga0501033_0029294 3300049570 Bacteria 4137
477 Ga0501034_0003361 3300049571 Bacteria 18264
478 Ga0501034_0184133 3300049571 Bacteria 2052
479 Ga0501036_0002120 3300049572 Bacteria 15493
480 Ga0501036_0010828 3300049572 Bacteria 7534
481 Ga0501036_0159394 3300049572 Bacteria 1903
482 Ga0501037_0001263 3300049573 Bacteria 18639
483 Ga0501037_0169944 3300049573 Bacteria 1550
484 Ga0501037_0431822 3300049573 Bacteria 900
485 Ga0501038_0003243 3300049574 Bacteria 15162
486 Ga0501038_0004836 3300049574 Bacteria 12512
487 Ga0501038_0009205 3300049574 Bacteria 9059
488 Ga0501038_0027558 3300049574 Bacteria 5054
489 Ga0501038_0371341 3300049574 Bacteria 1111
490 Ga0501039_0021126 3300049575 Bacteria 4993
491 Ga0501039_0022190 3300049575 Bacteria 4873
492 Ga0501039_0382628 3300049575 Bacteria 1105
493 Ga0501039_0636386 3300049575 Bacteria 835
494 Ga0501042_0000031 3300049578 Bacteria 46017
495 Ga0501042_0628147 3300049578 Bacteria 781
496 Ga0501043_0000157 3300049579 Bacteria 62190
497 Ga0501043_0012057 3300049579 Bacteria 6758
498 Ga0501043_0012117 3300049579 Bacteria 6741
499 Ga0501046_0002577 3300049580 Bacteria 16965
500 Ga0501046_0078124 3300049580 Bacteria 2561
501 Ga0501046_0321700 3300049580 Bacteria 1127
502 Ga0501046_0575473 3300049580 Bacteria 801
503 Ga0501047_0002207 3300049581 Bacteria 18639
504 Ga0501047_0005455 3300049581 Bacteria 11968
505 Ga0501047_0262852 3300049581 Bacteria 1573
506 Ga0501048_0002716 3300049582 Bacteria 13496
507 Ga0501067_0163311 3300049583 Bacteria 1240
508 Ga0501068_0026149 3300049584 Bacteria 3437
509 Ga0501068_0193725 3300049584 Bacteria 1288
510 Ga0501068_0596027 3300049584 Bacteria 720
511 Ga0501069_0001064 3300049585 Bacteria 13167
512 Ga0501070_0001356 3300049586 Bacteria 21938
513 Ga0501070_1090978 3300049586 Bacteria 616
514 Ga0501073_0000321 3300049589 Bacteria 32033
515 Ga0501073_0172366 3300049589 Bacteria 1498
516 Ga0501074_0000097 3300049590 Bacteria 42311
517 Ga0501075_1048991 3300049591 Unclassified 619
518 Ga0501076_0318868 3300049592 Bacteria 1275
519 Ga0501079_0010889 3300049741 Bacteria 6926
520 Ga0501079_1135656 3300049741 Bacteria 616
521 Ga0501080_0004551 3300049742 Bacteria 12361
522 Ga0501080_0880816 3300049742 Bacteria 781
523 Ga0501035_0000671 3300049822 Bacteria 37548
524 Ga0501035_0022817 3300049822 Bacteria 5747
525 Ga0501035_0031902 3300049822 Bacteria 4797
526 Ga0501035_0157358 3300049822 Bacteria 1969
527 Ga0501035_0433143 3300049822 Bacteria 1090
528 Ga0501044_0000747 3300049823 Bacteria 39287
529 Ga0501044_0029513 3300049823 Bacteria 5782
530 Ga0501044_0164945 3300049823 Bacteria 2190
531 Ga0501044_0167932 3300049823 Bacteria 2167
532 Ga0501044_1384132 3300049823 Bacteria 569
533 Ga0501045_0963725 3300049824 Bacteria 626
534 Ga0501045_1402428 3300049824 Bacteria 507
535 nmdc:mga03683_309215_c1 3300050489 Bacteria 742
536 nmdc:mga03n38_323226_c1 3300050490 Bacteria 834
537 nmdc:mga00v17_24107_c1 3300050491 Bacteria 3525
538 nmdc:mga00v17_372343_c1 3300050491 Bacteria 929
539 nmdc:mga0yw44_424857_c1 3300050492 Bacteria 900
540 nmdc:mga0yw44_7154_c1 3300050492 Bacteria 5465
541 nmdc:mga0k408_122686_c1 3300050493 Bacteria 1540
542 nmdc:mga0k408_14579_c1 3300050493 Bacteria 4335
543 nmdc:mga0k408_24801_c1 3300050493 Bacteria 3393
544 nmdc:mga0k408_712_c1 3300050493 Bacteria 18213
545 nmdc:mga06z11_198107_c1 3300050494 Bacteria 1165
546 nmdc:mga06z11_32248_c1 3300050494 Bacteria 2554
547 nmdc:mga04h51_63514_c1 3300050495 Bacteria 1272
548 nmdc:mga07m45_21342_c1 3300050496 Bacteria 3525
549 nmdc:mga07m45_775818_c1 3300050496 Bacteria 550
550 nmdc:mga07m45_85577_c1 3300050496 Bacteria 1803
551 nmdc:mga05p37_460365_c1 3300050507 Bacteria 1470
552 nmdc:mga0qj67_365204_c1 3300050509 Bacteria 1166
553 nmdc:mga08y16_54336_c1 3300050511 Bacteria 4185
554 nmdc:mga08y16_65090_c1 3300050511 Bacteria 3805
555 nmdc:mga0n895_16127_c1 3300050512 Bacteria 6845
556 nmdc:mga0n895_477872_c1 3300050512 Bacteria 1257
557 nmdc:mga0n895_565922_c1 3300050512 Bacteria 1141
558 nmdc:mga0rr50_108788_c2 3300050513 Bacteria 1442
559 nmdc:mga0rr50_1490777_c1 3300050513 Bacteria 572
560 nmdc:mga08x19_46810_c1 3300050514 Bacteria 2767
561 nmdc:mga08x19_63870_c1 3300050514 Bacteria 2389
562 nmdc:mga08x19_8733_c1 3300050514 Bacteria 6043
563 nmdc:mga0a205_11320_c1 3300050515 Bacteria 8211
564 nmdc:mga0sz30_320539_c1 3300050516 Bacteria 692
565 nmdc:mga0sz30_389495_c1 3300050516 Bacteria 624
566 nmdc:mga0sz30_53980_c2 3300050516 Bacteria 1358
567 Ga0495601_0013569 3300053077 Bacteria 4900
568 Ga0495619_0507115 3300053085 Bacteria 829
569 Ga0500646_0000869 3300053090 Bacteria 8331
570 Ga0500583_0002645 3300053092 Bacteria 5434
571 Ga0500583_0329071 3300053092 Bacteria 743
572 Ga0500651_0262029 3300053093 Bacteria 1002
573 Ga0500651_0515900 3300053093 Bacteria 657
574 Ga0500641_0022818 3300053096 Bacteria 2401
575 Ga0500562_175927 3300053108 Bacteria 581
576 Ga0500594_0039541 3300053118 Bacteria 1283
577 Ga0500642_0181849 3300053130 Bacteria 983
578 Ga0500655_018398 3300053133 Bacteria 1297
579 Ga0500604_0000727 3300053151 Bacteria 9013
580 Ga0500645_154259 3300053730 Bacteria 631
581 2547375495 2547132103 Bacteria 5115736
582 2548846611 2547132512 Bacteria 3416496
583 2843691347 2843690924 Bacteria 5169057
584 2846034396 2846033681 Bacteria 4377894
585 2998344559 2998344455 Bacteria 4222996
586 639788552 639633007 Bacteria 4376040
587 Ga0111539_10202435
588 Ga0070658_10897771
589 Ga0070676_10782145
590 Ga0070683_100184513
591 Ga0070683_100766444
592 Ga0070670_100041949
593 Ga0070670_100397325
594 Ga0070677_10318353
595 Ga0068869_100000239
596 Ga0070666_10437128
597 Ga0070680_100082662
598 Ga0070680_100702174
599 Ga0070682_100048033
600 Ga0068868_100103199
601 Ga0068868_100197383
602 Ga0068868_101039356
603 Ga0070689_100359815
604 Ga0070687_100123981
605 Ga0070687_100450898
606 Ga0070661_100443759
607 Ga0070692_10230773
608 Ga0070692_10495726
609 Ga0070692_11310040
610 Ga0070668_100914534
611 Ga0070669_100932473
612 Ga0070675_100318733
613 Ga0070675_100517107
614 Ga0070671_100307220
615 Ga0070671_100482469
616 Ga0070674_100105296
617 Ga0070674_100261564
618 Ga0070673_100118890
619 Ga0070673_100719881
620 Ga0070659_100111138
621 Ga0070659_100322280
622 Ga0070659_100961346
623 Ga0070667_100241938
624 Ga0070709_11065518
625 Ga0070714_100346772
626 Ga0070713_100670775
627 Ga0070713_101843916
628 Ga0070710_10387403
629 Ga0070701_10482390
630 Ga0070711_100376169
631 Ga0070705_100827879
632 Ga0070705_100842409
633 Ga0070705_101686929
634 Ga0070700_100013966
635 Ga0070700_100579275
636 Ga0070694_100431826
637 Ga0070708_100969366
638 Ga0070678_100032926
639 Ga0070678_100217204
640 Ga0070681_10029739
641 Ga0070681_10120986
642 Ga0070681_11193925
643 Ga0068867_100230339
644 Ga0068867_100328275
645 Ga0068867_100515036
646 Ga0068867_100521484
647 Ga0068867_100735731
648 Ga0068867_101153455
649 Ga0070707_101050549
650 Ga0070698_100575864
651 Ga0070698_101204345
652 Ga0070699_100954813
653 Ga0070699_100998353
654 Ga0070679_100078071
655 Ga0070679_100129529
656 Ga0070679_100151965
657 Ga0070679_101219524
658 Ga0070684_100986388
659 Ga0070697_100106944
660 Ga0068853_100131569
661 Ga0068853_100173648
662 Ga0068853_100461883
663 Ga0068853_100811059
664 Ga0068853_101142045
665 Ga0070686_101124061
666 Ga0070696_100953509
667 Ga0070696_102007097
668 Ga0070693_100367732
669 Ga0070693_100837410
670 Ga0070665_100239175
671 Ga0070665_101484214
672 Ga0070704_100117650
673 Ga0070704_100499751
674 Ga0068855_100008416
675 Ga0068855_100017369
676 Ga0068855_100019447
677 Ga0068855_101356818
678 Ga0070664_100593092
679 Ga0070664_101289173
680 Ga0070664_101469755
681 Ga0068857_101517694
682 Ga0068854_100562680
683 Ga0068856_100033727
684 Ga0068856_100123081
685 Ga0068856_100434983
686 Ga0068856_101054662
687 Ga0070702_100616451
688 Ga0070702_100946193
689 Ga0070702_101270173
690 Ga0068852_100013995
691 Ga0068852_100057823
692 Ga0068859_100148571
693 Ga0068864_100054268
694 Ga0068866_10021978
695 Ga0068861_100156950
696 Ga0068861_100954198
697 Ga0068861_102591816
698 Ga0068851_10050452
699 Ga0068851_10120112
700 Ga0068870_10954823
701 Ga0068863_100005897
702 Ga0068863_102167846
703 Ga0068858_100009002
704 Ga0068858_100027257
705 Ga0068858_100083384
706 Ga0068858_100832406
707 Ga0068858_101201272
708 Ga0068858_101991896
709 Ga0068858_102409410
710 Ga0068862_100073979
711 Ga0068862_100268762
712 Ga0070717_11004923
713 Ga0075365_10147554
714 Ga0075365_10678944
715 Ga0075368_10002682
716 Ga0075363_100016443
717 Ga0075363_100150445
718 Ga0075364_10403081
719 Ga0075364_10617633
720 Ga0075364_11118474
721 Ga0070715_10224445
722 Ga0070712_100391971
723 Ga0070712_100468283
724 Ga0075362_10032262
725 Ga0075367_10068609
726 Ga0075367_10240455
727 Ga0075369_10058580
728 Ga0075366_10003900
729 Ga0075366_10048007
730 Ga0075366_10071039
731 Ga0075366_10331180
732 Ga0097621_100347649
733 Ga0075370_10007567
734 Ga0068871_100003989
735 Ga0068871_100041716
736 Ga0068871_100992503
737 Ga0075428_100051648
738 Ga0075428_100884281
739 Ga0075433_11246386
740 Ga0075434_100025576
741 Ga0075434_100124409
742 Ga0075434_100429316
743 Ga0075434_100855297
744 Ga0068865_101025001
745 Ga0075436_100000862
746 Ga0075436_100056376
747 Ga0075436_100073902
748 Ga0097620_100148573
749 Ga0075435_100172209
750 Ga0075435_101610583
751 Ga0099794_10015066
752 Ga0099794_10025195
753 Ga0099794_10355689
754 Ga0105251_10462060
755 Ga0105240_10003296
756 Ga0105240_10070801
757 Ga0105240_11018909
758 Ga0105240_11952901
759 Ga0105240_12043598
760 Ga0111539_10004777
761 Ga0111539_11074802
762 Ga0105245_10044453
763 Ga0105245_10187258
764 Ga0105245_10578710
765 Ga0105245_11358064
766 Ga0105247_10440622
767 Ga0114129_10573939
768 Ga0105243_10050853
769 Ga0105243_10168466
770 Ga0105243_10535911
771 Ga0105241_10133559
772 Ga0105241_10286930
773 Ga0105241_11543553
774 Ga0105241_12038162
775 Ga0105242_10006123
776 Ga0105242_10081256
777 Ga0105242_10249820
778 Ga0105242_10941765
779 Ga0105248_10062805
780 Ga0105248_10539955
781 Ga0105248_11835285
782 Ga0105237_10033934
783 Ga0105237_10041822
784 Ga0105237_10600948
785 Ga0105237_11058780
786 Ga0105237_11090614
787 Ga0105238_10351942
788 Ga0105238_10492404
789 Ga0105238_10690610
790 Ga0105238_10786215
791 Ga0105238_11050577
792 Ga0105249_11801180
793 Ga0105249_12109979
794 Ga0105239_10016687
795 Ga0105239_10224013
796 Ga0105239_11159515
797 Ga0105239_12319771
798 Ga0157346_1012824
799 Ga0157318_1013691
800 Ga0157316_1064741
801 Ga0157373_10014959
802 Ga0157373_10658576
803 Ga0157371_10549174
804 Ga0157371_10921248
805 Ga0157370_10008784
806 Ga0157369_10290349
807 Ga0157369_10470448
808 Ga0157369_10473252
809 Ga0157374_10142688
810 Ga0157374_10144200
811 Ga0157374_11689795
812 Ga0157378_10043202
813 Ga0157378_10715357
814 Ga0157378_11216466
815 Ga0163162_10113966
816 Ga0163162_10621849
817 Ga0163162_10841329
818 Ga0163162_11162680
819 Ga0157372_10006865
820 Ga0157372_11123795
821 Ga0157375_10050523
822 Ga0163163_11579056
823 Ga0157380_10619532
824 Ga0157380_10710913
825 Ga0157380_11705514
826 Ga0182008_10018284
827 Ga0157377_10124346
828 Ga0157379_10068146
829 Ga0157379_10125264
830 Ga0157376_10051732
831 Ga0157376_10618976
832 Ga0157376_10763873
833 Ga0163161_10628811
834 Ga0163161_11512498
835 Ga0206354_10063477
836 Ga0213872_10021164
837 Ga0213876_10162750
838 Ga0207656_10001500
839 Ga0207642_10125207
840 Ga0207688_10061781
841 Ga0207680_10374569
842 Ga0207699_10850384
843 Ga0207645_10693848
844 Ga0207705_10260813
845 Ga0207705_10468452
846 Ga0207705_10668060
847 Ga0207654_10324969
848 Ga0207654_10562009
849 Ga0207707_10049882
850 Ga0207707_10077125
851 Ga0207707_10806939
852 Ga0207707_11171241
853 Ga0207695_10009540
854 Ga0207695_10529200
855 Ga0207671_10017161
856 Ga0207671_10520013
857 Ga0207671_11163078
858 Ga0207693_10304221
859 Ga0207693_10519131
860 Ga0207663_10056311
861 Ga0207663_10662030
862 Ga0207660_10523218
863 Ga0207660_11637753
864 Ga0207662_10202198
865 Ga0207662_10320382
866 Ga0207649_10463214
867 Ga0207652_10100647
868 Ga0207652_11096441
869 Ga0207681_10575209
870 Ga0207694_10015938
871 Ga0207694_10428260
872 Ga0207694_10438924
873 Ga0207694_11540167
874 Ga0207650_10060557
875 Ga0207650_11378094
876 Ga0207659_10243675
877 Ga0207687_10062240
878 Ga0207700_10107445
879 Ga0207700_11085143
880 Ga0207664_10527148
881 Ga0207644_10274777
882 Ga0207644_10986571
883 Ga0207690_10099810
884 Ga0207690_10238835
885 Ga0207706_11225902
886 Ga0207686_10069757
887 Ga0207686_10113674
888 Ga0207686_10333869
889 Ga0207686_11057720
890 Ga0207709_10451427
891 Ga0207669_10050079
892 Ga0207669_11025655
893 Ga0207704_10759876
894 Ga0207704_11394964
895 Ga0207665_10136638
896 Ga0207691_10083916
897 Ga0207691_10849583
898 Ga0207711_10040325
899 Ga0207689_10000370
900 Ga0207689_10911461
901 Ga0207661_10841865
902 Ga0207679_10116237
903 Ga0207667_10011637
904 Ga0207667_10249444
905 Ga0207667_12083654
906 Ga0207651_10015447
907 Ga0207712_10982713
908 Ga0207640_10591020
909 Ga0207640_10911403
910 Ga0207658_10233208
911 Ga0207658_10513691
912 Ga0207677_10006249
913 Ga0207677_10207482
914 Ga0207677_10819256
915 Ga0207703_10069578
916 Ga0207703_10489216
917 Ga0207703_11271200
918 Ga0207639_10013232
919 Ga0207639_10172407
920 Ga0207639_10189767
921 Ga0207639_10582061
922 Ga0207678_10082772
923 Ga0207708_10033659
924 Ga0207708_10789366
925 Ga0207702_10015403
926 Ga0207702_10272295
927 Ga0207702_10367696
928 Ga0207702_11052545
929 Ga0207702_11589147
930 Ga0207641_10190858
931 Ga0207641_11353290
932 Ga0207641_11540651
933 Ga0207648_10090358
934 Ga0207648_10283009
935 Ga0207648_10325469
936 Ga0207648_10870773
937 Ga0207648_12178312
938 Ga0207676_10176567
939 Ga0207674_10150649
940 Ga0207683_10038091
941 Ga0207683_10040680
942 Ga0207683_10111579
943 Ga0207683_10622949
944 Ga0207698_10053328
945 Ga0207698_10478473
946 Ga0209969_1000383
947 Ga0210000_1016818
948 Ga0209999_1001158
949 Ga0209588_1009253
950 Ga0209588_1157021
951 Ga0209588_1233763
952 Ga0209971_1003675
953 Ga0209998_10032618
954 Ga0209813_10023151
955 Ga0209813_10084750
956 Ga0209974_10001043
957 Ga0207428_10007467
958 Ga0207428_10148918
959 Ga0207428_11305681
960 Ga0268266_10118435
961 Ga0268266_10149487
962 Ga0268266_10199873
963 Ga0268265_10084722
964 Ga0268265_10233470
965 Ga0268264_10083813
966 Ga0307511_10000653
967 Ga0265332_10048865
968 Ga0265328_10000839
969 Ga0265328_10021475
970 Ga0265328_10114687
971 Ga0265328_10134913
972 Ga0265331_10000050
973 Ga0265331_10003466
974 Ga0265327_10000109
975 Ga0265327_10000161
976 Ga0265327_10004575
977 Ga0265316_10238687
978 Ga0265316_10324601
979 Ga0307408_100293848
980 Ga0307406_10661368
981 Ga0307409_101363461
982 Ga0373958_0063341
983 Ga0373928_0127448
984 Ga0373932_0294181
985 Ga0373939_0327205
986 Ga0373953_0033407
987 Ga0373954_0093041
988 Ga0373956_0059357
989 Ga0373957_0022817
990 Ga0373957_0035427
991 Ga0373955_0025822
992 Ga0373955_0671310
993 Ga0373942_0209632
994 Ga0373962_0229417
995 Ga0373935_0573763
996 Ga0373935_1196402
997 Ga0373927_0173010
998 Ga0373933_0013960
999 Ga0373933_0211461
1000 Ga0373933_0880156
1001 Ga0373937_0019465
1002 Ga0373937_0057553
1003 Ga0373937_0059217
1004 Ga0373937_0395335
1005 Ga0373925_0585040
1006 Ga0395899_0171993
1007 Ga0395900_0884280
1008 Ga0395905_0013092
1009 Ga0400483_057151
1010 Ga0400483_139236
1011 Ga0400483_186650
1012 Ga0436365_0854741
1013 Ga0436365_1601346
1014 Ga0436361_0050017
1015 Ga0439447_163493
1016 Ga0451789_1187517
1017 Ga0451839_0692740
1018 Ga0451853_0874889
1019 Ga0451577_1007827
1020 Ga0451577_1047828
1021 Ga0453683_0674112
1022 Ga0453684_0353189
1023 Ga0453684_0846607
1024 Ga0451576_1049256
1025 Ga0495603_0562736
1026 Ga0495629_0319230
1027 Ga0495608_0103787
1028 Ga0495628_0006157
1029 Ga0495630_0110176
1030 Ga0495642_0434036
1031 Ga0495640_0418098
1032 Ga0495586_0043984
1033 Ga0495598_0417969
1034 Ga0495621_0196828
1035 Ga0495621_0412732
1036 Ga0495645_0204491
1037 Ga0495622_0268605
1038 Ga0495667_0023519
1039 Ga0495656_0795823
1040 Ga0495668_0261270
1041 Ga0495657_0146887
1042 Ga0495646_0340110
1043 Ga0495647_0516737
1044 Ga0495600_0073469
1045 Ga0495604_0039043
1046 Ga0495636_0103288
1047 Ga0495680_0172127
1048 Ga0495675_0365813
1049 Ga0495684_0133481
1050 Ga0496102_0418388
1051 Ga0496104_0035628
1052 Ga0496104_0779031
1053 Ga0496104_1106928
1054 Ga0496110_0103024
1055 Ga0496113_0862544
1056 Ga0496114_0756197
1057 Ga0501031_0011216
1058 Ga0501032_0003598
1059 Ga0501032_0012634
1060 Ga0501033_0001817
1061 Ga0501033_0004521
1062 Ga0501033_0029294
1063 Ga0501034_0003361
1064 Ga0501034_0184133
1065 Ga0501036_0002120
1066 Ga0501036_0010828
1067 Ga0501036_0159394
1068 Ga0501037_0001263
1069 Ga0501037_0169944
1070 Ga0501037_0431822
1071 Ga0501038_0003243
1072 Ga0501038_0004836
1073 Ga0501038_0009205
1074 Ga0501038_0027558
1075 Ga0501038_0371341
1076 Ga0501039_0021126
1077 Ga0501039_0022190
1078 Ga0501039_0382628
1079 Ga0501039_0636386
1080 Ga0501042_0000031
1081 Ga0501042_0628147
1082 Ga0501043_0000157
1083 Ga0501043_0012057
1084 Ga0501043_0012117
1085 Ga0501046_0002577
1086 Ga0501046_0078124
1087 Ga0501046_0321700
1088 Ga0501046_0575473
1089 Ga0501047_0002207
1090 Ga0501047_0005455
1091 Ga0501047_0262852
1092 Ga0501048_0002716
1093 Ga0501067_0163311
1094 Ga0501068_0026149
1095 Ga0501068_0193725
1096 Ga0501068_0596027
1097 Ga0501069_0001064
1098 Ga0501070_0001356
1099 Ga0501070_1090978
1100 Ga0501073_0000321
1101 Ga0501073_0172366
1102 Ga0501074_0000097
1103 Ga0501075_1048991
1104 Ga0501076_0318868
1105 Ga0501079_0010889
1106 Ga0501079_1135656
1107 Ga0501080_0004551
1108 Ga0501080_0880816
1109 Ga0501035_0000671
1110 Ga0501035_0022817
1111 Ga0501035_0031902
1112 Ga0501035_0157358
1113 Ga0501035_0433143
1114 Ga0501044_0000747
1115 Ga0501044_0029513
1116 Ga0501044_0164945
1117 Ga0501044_0167932
1118 Ga0501044_1384132
1119 Ga0501045_0963725
1120 Ga0501045_1402428
1121 nmdc:mga03683_309215_c1
1122 nmdc:mga03n38_323226_c1
1123 nmdc:mga00v17_24107_c1
1124 nmdc:mga00v17_372343_c1
1125 nmdc:mga0yw44_424857_c1
1126 nmdc:mga0yw44_7154_c1
1127 nmdc:mga0k408_122686_c1
1128 nmdc:mga0k408_14579_c1
1129 nmdc:mga0k408_24801_c1
1130 nmdc:mga0k408_712_c1
1131 nmdc:mga06z11_198107_c1
1132 nmdc:mga06z11_32248_c1
1133 nmdc:mga04h51_63514_c1
1134 nmdc:mga07m45_21342_c1
1135 nmdc:mga07m45_775818_c1
1136 nmdc:mga07m45_85577_c1
1137 nmdc:mga05p37_460365_c1
1138 nmdc:mga0qj67_365204_c1
1139 nmdc:mga08y16_54336_c1
1140 nmdc:mga08y16_65090_c1
1141 nmdc:mga0n895_16127_c1
1142 nmdc:mga0n895_477872_c1
1143 nmdc:mga0n895_565922_c1
1144 nmdc:mga0rr50_108788_c2
1145 nmdc:mga0rr50_1490777_c1
1146 nmdc:mga08x19_46810_c1
1147 nmdc:mga08x19_63870_c1
1148 nmdc:mga08x19_8733_c1
1149 nmdc:mga0a205_11320_c1
1150 nmdc:mga0sz30_320539_c1
1151 nmdc:mga0sz30_389495_c1
1152 nmdc:mga0sz30_53980_c2
1153 Ga0495601_0013569
1154 Ga0495619_0507115
1155 Ga0500646_0000869
1156 Ga0500583_0002645
1157 Ga0500583_0329071
1158 Ga0500651_0262029
1159 Ga0500651_0515900
1160 Ga0500641_0022818
1161 Ga0500562_175927
1162 Ga0500594_0039541
1163 Ga0500642_0181849
1164 Ga0500655_018398
1165 Ga0500604_0000727
1166 Ga0500645_154259
1167 2547375495
1168 2548846611
1169 2843691347
1170 2846034396
1171 2998344559
1172 639788552

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01196

Ribosomal_L17

Ribosomal protein L17

20

116

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sfr-assembly1.cif.gz_N unmethylated mtb ribosome 50s with seq-9 0.973 14 116
5xym-assembly1.cif.gz_N large subunit of mycobacterium smegmatis 0.9681 13 116
4v4p-assembly1.cif.gz_A0 crystal structure of 70s ribosome with thrs operator and trnas. 0.9502 14 117
4v4p-assembly1.cif.gz_A0 crystal structure of 70s ribosome with thrs operator and trnas. 0.933 14 117
8cvm-assembly1.cif.gz_m cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9319 10 116
ID Description Score Start End Superfamily
1vt2N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9679 14 115 3.90.1030.10
5v7qN00 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9637 13 116 3.90.1030.10
1vs8N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9623 14 115 3.90.1030.10
1vt2N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9498 14 115 3.90.1030.10
1vs8N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9443 14 115 3.90.1030.10
ID Description Score Start End GO Terms
AF-A0A3A4VDG7-F1-model_v4 50S ribosomal protein L17 0.9828 22 116 GO:0003735
GO:0006412
GO:0022625
AF-A0A1F9ENG3-F1-model_v4 50S ribosomal protein L17 0.9828 20 114 GO:0003735
GO:0006412
GO:0022625
AF-A0A2E2TK58-F1-model_v4 50S ribosomal protein L17 0.9823 23 118 GO:0003735
GO:0006412
GO:0022625
AF-A0A5Q4FRT6-F1-model_v4 Large ribosomal subunit protein bL17 0.9806 14 116 GO:0003735
GO:0006412
GO:0022625
AF-A0A6J5Z5J0-F1-model_v4 Unannotated protein 0.98 14 116 GO:0003735
GO:0006412
GO:0022625

Map