F466545
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 586 | 256 | 1172 | 243 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10003569|Ga0114129_100035697 |
| Length | 277 |
| Sequence | MSAMEILFYALLFLVAFLYASVGHGGASGYLALMALFNIPVAVMKPTALVLNLFVSLTSFIQFYRGKHFKWKIFLPFALASIPLSFAGGLLSIDGMMYKKILGILLLIPVFRFFFFSKTDVTEFKKSNWALSLLIGGTIGFLSGLIGIGGGIILSPILLMLKWTDQKQTAAISALFIFVNSVAGLFGQLTKGIHFNADMYAYVAVAFTGGLAGAYFGALKFKQVILKNILATALLVASLKLIFTGEKPKLNNKAANPSTSLMIFPDKLDYPGTAPGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 70 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 71 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 102 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 156 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 158 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 159 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 160 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 161 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 162 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 164 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 172 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 175 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 176 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 179 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 180 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 181 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 182 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 183 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 185 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 186 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 187 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 188 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 189 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 190 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 191 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 218 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 219 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 220 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 221 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 222 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 223 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 224 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 225 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 227 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 228 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 229 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 230 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 237 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 238 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 239 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 240 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 241 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 242 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 243 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 244 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 245 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 246 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 247 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 248 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 249 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 250 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 251 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 252 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 253 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 254 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 255 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 256 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.27 |
| Metatranscriptomes | 0 |
| Isolates | 2.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.34 |
| Bulb | 0 |
| Endosphere | 1.88 |
| Nodule | 0.51 |
| Rhizoplane | 0.51 |
| Rhizosphere | 93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0114129_10003569 | 3300009147 | Bacteria | 21902 |
| 2 | SwRhRL2b_contig_916033 | 2162886007 | Bacteria | 1016 |
| 3 | rootH2_10295173 | 3300003320 | Bacteria | 1063 |
| 4 | rootL2_10134461 | 3300003322 | Bacteria | 1287 |
| 5 | rootL2_10248561 | 3300003322 | Unclassified | 1796 |
| 6 | Ga0055530_10002378 | 3300003791 | Bacteria | 12196 |
| 7 | Ga0065714_10073048 | 3300005288 | Bacteria | 3253 |
| 8 | Ga0065715_10043676 | 3300005293 | Unclassified | 1232 |
| 9 | Ga0065707_10197600 | 3300005295 | Bacteria | 1327 |
| 10 | Ga0070658_10070169 | 3300005327 | Unclassified | 2868 |
| 11 | Ga0070676_10006346 | 3300005328 | Bacteria | 6317 |
| 12 | Ga0070676_10057970 | 3300005328 | Bacteria | 2293 |
| 13 | Ga0070683_100204187 | 3300005329 | Unclassified | 1877 |
| 14 | Ga0070683_100361554 | 3300005329 | Bacteria | 1382 |
| 15 | Ga0070670_100185565 | 3300005331 | Bacteria | 1806 |
| 16 | Ga0070670_100189784 | 3300005331 | Bacteria | 1785 |
| 17 | Ga0070670_100279427 | 3300005331 | Unclassified | 1458 |
| 18 | Ga0070670_100506257 | 3300005331 | Unclassified | 1074 |
| 19 | Ga0070677_10045810 | 3300005333 | Bacteria | 1746 |
| 20 | Ga0068869_100019418 | 3300005334 | Bacteria | 4644 |
| 21 | Ga0068869_100020425 | 3300005334 | Bacteria | 4541 |
| 22 | Ga0068869_100045019 | 3300005334 | Bacteria | 3175 |
| 23 | Ga0068869_100405420 | 3300005334 | Unclassified | 1122 |
| 24 | Ga0070666_10000050 | 3300005335 | Bacteria | 100280 |
| 25 | Ga0070666_10154321 | 3300005335 | Unclassified | 1603 |
| 26 | Ga0070666_10234158 | 3300005335 | Bacteria | 1297 |
| 27 | Ga0070666_10536510 | 3300005335 | Unclassified | 850 |
| 28 | Ga0070680_100168666 | 3300005336 | Bacteria | 1841 |
| 29 | Ga0070682_100002796 | 3300005337 | Bacteria | 9669 |
| 30 | Ga0070682_100009802 | 3300005337 | Bacteria | 5423 |
| 31 | Ga0070682_100607494 | 3300005337 | Bacteria | 865 |
| 32 | Ga0068868_100003855 | 3300005338 | Bacteria | 10469 |
| 33 | Ga0068868_100759719 | 3300005338 | Bacteria | 872 |
| 34 | Ga0070689_100008890 | 3300005340 | Bacteria | 7101 |
| 35 | Ga0070689_100040492 | 3300005340 | Bacteria | 3573 |
| 36 | Ga0070689_100068440 | 3300005340 | Bacteria | 2769 |
| 37 | Ga0070689_100320133 | 3300005340 | Bacteria | 1295 |
| 38 | Ga0070689_100474039 | 3300005340 | Bacteria | 1068 |
| 39 | Ga0070691_10001334 | 3300005341 | Bacteria | 10499 |
| 40 | Ga0070661_100001199 | 3300005344 | Bacteria | 18295 |
| 41 | Ga0070661_100197800 | 3300005344 | Bacteria | 1535 |
| 42 | Ga0070668_100119220 | 3300005347 | Bacteria | 2107 |
| 43 | Ga0070668_100164516 | 3300005347 | Bacteria | 1802 |
| 44 | Ga0070668_100338896 | 3300005347 | Unclassified | 1270 |
| 45 | Ga0070668_100342551 | 3300005347 | Bacteria | 1263 |
| 46 | Ga0070668_100419645 | 3300005347 | Unclassified | 1145 |
| 47 | Ga0070669_100137279 | 3300005353 | Bacteria | 1882 |
| 48 | Ga0070669_100166432 | 3300005353 | Unclassified | 1716 |
| 49 | Ga0070675_100005613 | 3300005354 | Bacteria | 9606 |
| 50 | Ga0070675_100071662 | 3300005354 | Bacteria | 2875 |
| 51 | Ga0070675_100077798 | 3300005354 | Bacteria | 2762 |
| 52 | Ga0070675_100219146 | 3300005354 | Bacteria | 1657 |
| 53 | Ga0070671_100019435 | 3300005355 | Bacteria | 5528 |
| 54 | Ga0070674_100037295 | 3300005356 | Unclassified | 3269 |
| 55 | Ga0070674_100183238 | 3300005356 | Bacteria | 1605 |
| 56 | Ga0070673_100043512 | 3300005364 | Bacteria | 3471 |
| 57 | Ga0070673_100092033 | 3300005364 | Bacteria | 2480 |
| 58 | Ga0070673_100233601 | 3300005364 | Unclassified | 1596 |
| 59 | Ga0070673_100280769 | 3300005364 | Bacteria | 1461 |
| 60 | Ga0070673_100344835 | 3300005364 | Bacteria | 1321 |
| 61 | Ga0070688_100041523 | 3300005365 | Bacteria | 2824 |
| 62 | Ga0070688_100051239 | 3300005365 | Unclassified | 2575 |
| 63 | Ga0070688_100094014 | 3300005365 | Bacteria | 1965 |
| 64 | Ga0070688_100363963 | 3300005365 | Bacteria | 1062 |
| 65 | Ga0070659_100002681 | 3300005366 | Bacteria | 12650 |
| 66 | Ga0070667_100021876 | 3300005367 | Bacteria | 5307 |
| 67 | Ga0070667_100026929 | 3300005367 | Bacteria | 4783 |
| 68 | Ga0070667_100090788 | 3300005367 | Bacteria | 2626 |
| 69 | Ga0070667_100234997 | 3300005367 | Bacteria | 1635 |
| 70 | Ga0070667_100362186 | 3300005367 | Bacteria | 1314 |
| 71 | Ga0070701_10146605 | 3300005438 | Bacteria | 1355 |
| 72 | Ga0070701_10266789 | 3300005438 | Unclassified | 1040 |
| 73 | Ga0070700_100182923 | 3300005441 | Bacteria | 1460 |
| 74 | Ga0070663_100399469 | 3300005455 | Bacteria | 1123 |
| 75 | Ga0070663_100480737 | 3300005455 | Bacteria | 1028 |
| 76 | Ga0070662_100051494 | 3300005457 | Unclassified | 2974 |
| 77 | Ga0070662_100178219 | 3300005457 | Bacteria | 1674 |
| 78 | Ga0070662_100211480 | 3300005457 | Bacteria | 1543 |
| 79 | Ga0070662_100571026 | 3300005457 | Bacteria | 949 |
| 80 | Ga0068867_100015472 | 3300005459 | Bacteria | 5411 |
| 81 | Ga0068867_100031824 | 3300005459 | Bacteria | 3811 |
| 82 | Ga0068867_100200710 | 3300005459 | Unclassified | 1596 |
| 83 | Ga0070685_10011303 | 3300005466 | Bacteria | 4674 |
| 84 | Ga0070685_10053404 | 3300005466 | Bacteria | 2341 |
| 85 | Ga0070685_10324716 | 3300005466 | Bacteria | 1044 |
| 86 | Ga0070698_100000645 | 3300005471 | Bacteria | 37282 |
| 87 | Ga0070698_100008979 | 3300005471 | Bacteria | 10751 |
| 88 | Ga0070698_100353640 | 3300005471 | Bacteria | 1401 |
| 89 | Ga0070699_100144439 | 3300005518 | Bacteria | 2102 |
| 90 | Ga0070684_100000298 | 3300005535 | Bacteria | 34479 |
| 91 | Ga0070684_100000731 | 3300005535 | Bacteria | 22754 |
| 92 | Ga0070684_100044635 | 3300005535 | Unclassified | 3835 |
| 93 | Ga0070684_100730437 | 3300005535 | Bacteria | 924 |
| 94 | Ga0068853_100003450 | 3300005539 | Bacteria | 12095 |
| 95 | Ga0068853_100066002 | 3300005539 | Bacteria | 3142 |
| 96 | Ga0068853_100234714 | 3300005539 | Bacteria | 1679 |
| 97 | Ga0070672_100027429 | 3300005543 | Bacteria | 4247 |
| 98 | Ga0070672_100036884 | 3300005543 | Bacteria | 3728 |
| 99 | Ga0070672_100095973 | 3300005543 | Bacteria | 2398 |
| 100 | Ga0070672_100209441 | 3300005543 | Bacteria | 1632 |
| 101 | Ga0070672_100282035 | 3300005543 | Bacteria | 1405 |
| 102 | Ga0070672_100345308 | 3300005543 | Unclassified | 1268 |
| 103 | Ga0070665_100027335 | 3300005548 | Bacteria | 5747 |
| 104 | Ga0068855_100039717 | 3300005563 | Bacteria | 5586 |
| 105 | Ga0068855_100063789 | 3300005563 | Bacteria | 4298 |
| 106 | Ga0068855_100680900 | 3300005563 | Bacteria | 1102 |
| 107 | Ga0070664_100000884 | 3300005564 | Bacteria | 23265 |
| 108 | Ga0070664_100073067 | 3300005564 | Unclassified | 2942 |
| 109 | Ga0070664_100123294 | 3300005564 | Unclassified | 2271 |
| 110 | Ga0070664_100142133 | 3300005564 | Bacteria | 2114 |
| 111 | Ga0070664_100164630 | 3300005564 | Unclassified | 1964 |
| 112 | Ga0070664_100167746 | 3300005564 | Bacteria | 1946 |
| 113 | Ga0068857_100001112 | 3300005577 | Bacteria | 20920 |
| 114 | Ga0068857_100094094 | 3300005577 | Unclassified | 2683 |
| 115 | Ga0068854_100031547 | 3300005578 | Bacteria | 3684 |
| 116 | Ga0068854_100272172 | 3300005578 | Bacteria | 1360 |
| 117 | Ga0068856_100034845 | 3300005614 | Bacteria | 4932 |
| 118 | Ga0068856_100336621 | 3300005614 | Bacteria | 1527 |
| 119 | Ga0070702_100042270 | 3300005615 | Unclassified | 2561 |
| 120 | Ga0070702_100278061 | 3300005615 | Bacteria | 1148 |
| 121 | Ga0068852_100003986 | 3300005616 | Bacteria | 10377 |
| 122 | Ga0068852_100075752 | 3300005616 | Bacteria | 2969 |
| 123 | Ga0068852_100454203 | 3300005616 | Bacteria | 1269 |
| 124 | Ga0068859_100000025 | 3300005617 | Bacteria | 191679 |
| 125 | Ga0068859_100069053 | 3300005617 | Bacteria | 3568 |
| 126 | Ga0068859_100158238 | 3300005617 | Bacteria | 2344 |
| 127 | Ga0068859_100215497 | 3300005617 | Bacteria | 2007 |
| 128 | Ga0068859_100218717 | 3300005617 | Bacteria | 1992 |
| 129 | Ga0068859_100239690 | 3300005617 | Bacteria | 1902 |
| 130 | Ga0068859_100253063 | 3300005617 | Bacteria | 1852 |
| 131 | Ga0068859_100364756 | 3300005617 | Unclassified | 1540 |
| 132 | Ga0068864_100004501 | 3300005618 | Bacteria | 11462 |
| 133 | Ga0068864_100012580 | 3300005618 | Bacteria | 6996 |
| 134 | Ga0068864_100057609 | 3300005618 | Bacteria | 3357 |
| 135 | Ga0068864_100209380 | 3300005618 | Unclassified | 1795 |
| 136 | Ga0068864_100288187 | 3300005618 | Bacteria | 1534 |
| 137 | Ga0068866_10042188 | 3300005718 | Bacteria | 2269 |
| 138 | Ga0068861_100002289 | 3300005719 | Bacteria | 12425 |
| 139 | Ga0068861_100069150 | 3300005719 | Bacteria | 2731 |
| 140 | Ga0068861_100128679 | 3300005719 | Bacteria | 2052 |
| 141 | Ga0068861_100191358 | 3300005719 | Bacteria | 1710 |
| 142 | Ga0068861_100256154 | 3300005719 | Bacteria | 1496 |
| 143 | Ga0068870_10066422 | 3300005840 | Bacteria | 1953 |
| 144 | Ga0068870_10068942 | 3300005840 | Unclassified | 1923 |
| 145 | Ga0068870_10435865 | 3300005840 | Bacteria | 861 |
| 146 | Ga0068863_100004643 | 3300005841 | Bacteria | 13544 |
| 147 | Ga0068863_100055607 | 3300005841 | Bacteria | 3747 |
| 148 | Ga0068863_100083324 | 3300005841 | Bacteria | 3030 |
| 149 | Ga0068863_100524596 | 3300005841 | Bacteria | 1168 |
| 150 | Ga0068858_100018416 | 3300005842 | Bacteria | 6537 |
| 151 | Ga0068858_100035184 | 3300005842 | Bacteria | 4645 |
| 152 | Ga0068858_100351600 | 3300005842 | Bacteria | 1411 |
| 153 | Ga0068858_100709999 | 3300005842 | Bacteria | 979 |
| 154 | Ga0068860_100001253 | 3300005843 | Bacteria | 27686 |
| 155 | Ga0068860_100010864 | 3300005843 | Bacteria | 8978 |
| 156 | Ga0068860_100092893 | 3300005843 | Bacteria | 2875 |
| 157 | Ga0068860_100144518 | 3300005843 | Unclassified | 2288 |
| 158 | Ga0068860_100262803 | 3300005843 | Bacteria | 1683 |
| 159 | Ga0068860_100602638 | 3300005843 | Bacteria | 1104 |
| 160 | Ga0068860_100709218 | 3300005843 | Unclassified | 1016 |
| 161 | Ga0068862_100008657 | 3300005844 | Bacteria | 8417 |
| 162 | Ga0068862_100261570 | 3300005844 | Unclassified | 1580 |
| 163 | Ga0068862_100306878 | 3300005844 | Bacteria | 1462 |
| 164 | Ga0068862_100324415 | 3300005844 | Bacteria | 1422 |
| 165 | Ga0075366_10013347 | 3300006195 | Bacteria | 4675 |
| 166 | Ga0097621_100036651 | 3300006237 | Unclassified | 3924 |
| 167 | Ga0097621_100062189 | 3300006237 | Bacteria | 3065 |
| 168 | Ga0097621_100116118 | 3300006237 | Bacteria | 2266 |
| 169 | Ga0097621_100145632 | 3300006237 | Bacteria | 2028 |
| 170 | Ga0097621_100241271 | 3300006237 | Unclassified | 1580 |
| 171 | Ga0068871_100002075 | 3300006358 | Bacteria | 13555 |
| 172 | Ga0068871_100042894 | 3300006358 | Unclassified | 3634 |
| 173 | Ga0075428_100006620 | 3300006844 | Bacteria | 12891 |
| 174 | Ga0075428_100121289 | 3300006844 | Bacteria | 2847 |
| 175 | Ga0075430_100597680 | 3300006846 | Bacteria | 910 |
| 176 | Ga0075431_100000866 | 3300006847 | Bacteria | 26579 |
| 177 | Ga0075431_100226049 | 3300006847 | Bacteria | 1908 |
| 178 | Ga0075431_100407280 | 3300006847 | Bacteria | 1360 |
| 179 | Ga0075434_100122982 | 3300006871 | Unclassified | 2611 |
| 180 | Ga0075429_100006687 | 3300006880 | Bacteria | 9994 |
| 181 | Ga0075429_100009709 | 3300006880 | Bacteria | 8341 |
| 182 | Ga0068865_100004271 | 3300006881 | Bacteria | 8620 |
| 183 | Ga0068865_100173255 | 3300006881 | Bacteria | 1656 |
| 184 | Ga0068865_100317710 | 3300006881 | Bacteria | 1251 |
| 185 | Ga0097620_100000025 | 3300006931 | Bacteria | 191679 |
| 186 | Ga0097620_100069050 | 3300006931 | Bacteria | 3568 |
| 187 | Ga0097620_100158244 | 3300006931 | Bacteria | 2344 |
| 188 | Ga0097620_100215483 | 3300006931 | Bacteria | 2007 |
| 189 | Ga0097620_100218737 | 3300006931 | Bacteria | 1992 |
| 190 | Ga0097620_100239699 | 3300006931 | Bacteria | 1902 |
| 191 | Ga0097620_100253074 | 3300006931 | Bacteria | 1852 |
| 192 | Ga0097620_100301980 | 3300006931 | Bacteria | 1694 |
| 193 | Ga0097620_100364774 | 3300006931 | Unclassified | 1540 |
| 194 | Ga0099824_1006257 | 3300006942 | Bacteria | 16412 |
| 195 | Ga0099826_10030236 | 3300006948 | Bacteria | 3937 |
| 196 | Ga0105244_10147640 | 3300009036 | Bacteria | 1128 |
| 197 | Ga0105240_10364496 | 3300009093 | Unclassified | 1636 |
| 198 | Ga0111539_10095344 | 3300009094 | Bacteria | 3495 |
| 199 | Ga0111539_10124969 | 3300009094 | Bacteria | 3015 |
| 200 | Ga0111539_10177664 | 3300009094 | Bacteria | 2487 |
| 201 | Ga0111539_10246021 | 3300009094 | Bacteria | 2082 |
| 202 | Ga0111539_10536973 | 3300009094 | Bacteria | 1362 |
| 203 | Ga0105247_10005807 | 3300009101 | Bacteria | 7719 |
| 204 | Ga0105247_10186462 | 3300009101 | Unclassified | 1387 |
| 205 | Ga0114129_10001572 | 3300009147 | Bacteria | 31003 |
| 206 | Ga0114129_10093117 | 3300009147 | Bacteria | 4175 |
| 207 | Ga0114129_10527605 | 3300009147 | Bacteria | 1539 |
| 208 | Ga0105243_10000007 | 3300009148 | Bacteria | 445042 |
| 209 | Ga0105243_10685162 | 3300009148 | Bacteria | 997 |
| 210 | Ga0105241_10003958 | 3300009174 | Bacteria | 10954 |
| 211 | Ga0105241_10039119 | 3300009174 | Bacteria | 3577 |
| 212 | Ga0105241_10081764 | 3300009174 | Bacteria | 2531 |
| 213 | Ga0105242_10025664 | 3300009176 | Unclassified | 4665 |
| 214 | Ga0105242_10052608 | 3300009176 | Bacteria | 3323 |
| 215 | Ga0105242_10077674 | 3300009176 | Bacteria | 2770 |
| 216 | Ga0105242_10085056 | 3300009176 | Bacteria | 2652 |
| 217 | Ga0105248_10323054 | 3300009177 | Unclassified | 1738 |
| 218 | Ga0105237_10014702 | 3300009545 | Bacteria | 8172 |
| 219 | Ga0105237_10385929 | 3300009545 | Bacteria | 1405 |
| 220 | Ga0105249_10001240 | 3300009553 | Bacteria | 22411 |
| 221 | Ga0105249_10006762 | 3300009553 | Bacteria | 9991 |
| 222 | Ga0105249_10010036 | 3300009553 | Bacteria | 8310 |
| 223 | Ga0105249_10055960 | 3300009553 | Bacteria | 3611 |
| 224 | Ga0105249_10108254 | 3300009553 | Unclassified | 2624 |
| 225 | Ga0105246_10118181 | 3300011119 | Unclassified | 1960 |
| 226 | Ga0105246_10142077 | 3300011119 | Bacteria | 1806 |
| 227 | Ga0157373_10025044 | 3300013100 | Bacteria | 4320 |
| 228 | Ga0157371_10000119 | 3300013102 | Bacteria | 120350 |
| 229 | Ga0157371_10001988 | 3300013102 | Bacteria | 20241 |
| 230 | Ga0157371_10278929 | 3300013102 | Bacteria | 1207 |
| 231 | Ga0157370_10003284 | 3300013104 | Bacteria | 19066 |
| 232 | Ga0157370_10005524 | 3300013104 | Bacteria | 14173 |
| 233 | Ga0157370_10011855 | 3300013104 | Bacteria | 9092 |
| 234 | Ga0157370_10033654 | 3300013104 | Bacteria | 4996 |
| 235 | Ga0157370_10270778 | 3300013104 | Unclassified | 1569 |
| 236 | Ga0157369_10000015 | 3300013105 | Bacteria | 262917 |
| 237 | Ga0157369_10001151 | 3300013105 | Bacteria | 33014 |
| 238 | Ga0157369_10139551 | 3300013105 | Bacteria | 2565 |
| 239 | Ga0157374_10000955 | 3300013296 | Bacteria | 25080 |
| 240 | Ga0157374_10037758 | 3300013296 | Bacteria | 4436 |
| 241 | Ga0157374_10048274 | 3300013296 | Unclassified | 3950 |
| 242 | Ga0157374_10118437 | 3300013296 | Bacteria | 2554 |
| 243 | Ga0157374_10282089 | 3300013296 | Bacteria | 1640 |
| 244 | Ga0157374_10398571 | 3300013296 | Bacteria | 1373 |
| 245 | Ga0157378_10026297 | 3300013297 | Bacteria | 5130 |
| 246 | Ga0157378_10028270 | 3300013297 | Bacteria | 4945 |
| 247 | Ga0157378_10076764 | 3300013297 | Bacteria | 3011 |
| 248 | Ga0157378_10246342 | 3300013297 | Bacteria | 1709 |
| 249 | Ga0163162_10000344 | 3300013306 | Bacteria | 42218 |
| 250 | Ga0163162_10000520 | 3300013306 | Bacteria | 35697 |
| 251 | Ga0163162_10029655 | 3300013306 | Bacteria | 5416 |
| 252 | Ga0163162_10042164 | 3300013306 | Bacteria | 4566 |
| 253 | Ga0163162_10088421 | 3300013306 | Unclassified | 3177 |
| 254 | Ga0163162_10128685 | 3300013306 | Bacteria | 2640 |
| 255 | Ga0163162_10748766 | 3300013306 | Unclassified | 1096 |
| 256 | Ga0163162_10906655 | 3300013306 | Bacteria | 994 |
| 257 | Ga0157372_10053750 | 3300013307 | Bacteria | 4491 |
| 258 | Ga0157372_10206085 | 3300013307 | Bacteria | 2279 |
| 259 | Ga0157372_10396141 | 3300013307 | Bacteria | 1609 |
| 260 | Ga0157372_10450640 | 3300013307 | Bacteria | 1500 |
| 261 | Ga0157375_10002578 | 3300013308 | Bacteria | 15745 |
| 262 | Ga0157375_10059161 | 3300013308 | Bacteria | 3795 |
| 263 | Ga0157375_10154078 | 3300013308 | Bacteria | 2436 |
| 264 | Ga0157375_10283354 | 3300013308 | Bacteria | 1820 |
| 265 | Ga0157375_10349638 | 3300013308 | Bacteria | 1644 |
| 266 | Ga0157375_10666797 | 3300013308 | Bacteria | 1195 |
| 267 | Ga0157375_11190280 | 3300013308 | Unclassified | 894 |
| 268 | Ga0163163_10000075 | 3300014325 | Bacteria | 109545 |
| 269 | Ga0163163_10003651 | 3300014325 | Bacteria | 13084 |
| 270 | Ga0163163_10112665 | 3300014325 | Bacteria | 2750 |
| 271 | Ga0163163_10468591 | 3300014325 | Bacteria | 1320 |
| 272 | Ga0163163_10568365 | 3300014325 | Bacteria | 1197 |
| 273 | Ga0163163_10924716 | 3300014325 | Bacteria | 935 |
| 274 | Ga0157380_10003006 | 3300014326 | Bacteria | 11479 |
| 275 | Ga0157380_10024955 | 3300014326 | Bacteria | 4529 |
| 276 | Ga0157380_10109338 | 3300014326 | Unclassified | 2319 |
| 277 | Ga0157380_10365077 | 3300014326 | Bacteria | 1356 |
| 278 | Ga0157380_10812686 | 3300014326 | Bacteria | 953 |
| 279 | Ga0182008_10228894 | 3300014497 | Bacteria | 953 |
| 280 | Ga0182008_10238826 | 3300014497 | Bacteria | 934 |
| 281 | Ga0157377_10058698 | 3300014745 | Unclassified | 2191 |
| 282 | Ga0157377_10230051 | 3300014745 | Bacteria | 1191 |
| 283 | Ga0157377_10526978 | 3300014745 | Bacteria | 830 |
| 284 | Ga0157379_10040212 | 3300014968 | Bacteria | 4172 |
| 285 | Ga0157379_10119098 | 3300014968 | Bacteria | 2375 |
| 286 | Ga0157379_10197689 | 3300014968 | Bacteria | 1817 |
| 287 | Ga0157379_10337604 | 3300014968 | Bacteria | 1378 |
| 288 | Ga0157376_10018590 | 3300014969 | Bacteria | 5333 |
| 289 | Ga0157376_10127726 | 3300014969 | Bacteria | 2264 |
| 290 | Ga0157376_10262818 | 3300014969 | Bacteria | 1618 |
| 291 | Ga0157376_10394252 | 3300014969 | Bacteria | 1337 |
| 292 | Ga0157376_10451444 | 3300014969 | Bacteria | 1254 |
| 293 | Ga0182006_1000091 | 3300015261 | Bacteria | 109227 |
| 294 | Ga0182006_1000957 | 3300015261 | Bacteria | 19179 |
| 295 | Ga0182006_1009862 | 3300015261 | Bacteria | 4270 |
| 296 | Ga0182006_1020693 | 3300015261 | Unclassified | 2753 |
| 297 | Ga0182006_1027039 | 3300015261 | Bacteria | 2345 |
| 298 | Ga0182007_10000010 | 3300015262 | Bacteria | 286070 |
| 299 | Ga0182007_10079022 | 3300015262 | Bacteria | 1079 |
| 300 | Ga0183373_1003 | 3300015682 | Bacteria | 558813 |
| 301 | Ga0163161_10000046 | 3300017792 | Bacteria | 127211 |
| 302 | Ga0163161_10000524 | 3300017792 | Bacteria | 31293 |
| 303 | Ga0163161_10065492 | 3300017792 | Bacteria | 2652 |
| 304 | Ga0163161_10166360 | 3300017792 | Bacteria | 1684 |
| 305 | Ga0163161_10579718 | 3300017792 | Unclassified | 923 |
| 306 | Ga0213874_10067769 | 3300021377 | Bacteria | 1132 |
| 307 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 308 | Ga0209050_1000258 | 3300025298 | Bacteria | 113741 |
| 309 | Ga0207656_10008263 | 3300025321 | Bacteria | 3822 |
| 310 | Ga0207656_10139143 | 3300025321 | Bacteria | 1143 |
| 311 | Ga0207642_10160397 | 3300025899 | Bacteria | 1207 |
| 312 | Ga0207710_10000852 | 3300025900 | Bacteria | 16442 |
| 313 | Ga0207710_10011865 | 3300025900 | Bacteria | 3666 |
| 314 | Ga0207680_10000086 | 3300025903 | Bacteria | 42622 |
| 315 | Ga0207645_10003860 | 3300025907 | Bacteria | 11217 |
| 316 | Ga0207645_10005381 | 3300025907 | Bacteria | 9293 |
| 317 | Ga0207643_10004125 | 3300025908 | Bacteria | 7826 |
| 318 | Ga0207643_10013440 | 3300025908 | Bacteria | 4434 |
| 319 | Ga0207705_10060161 | 3300025909 | Unclassified | 2743 |
| 320 | Ga0207654_10004379 | 3300025911 | Bacteria | 7116 |
| 321 | Ga0207654_10325428 | 3300025911 | Bacteria | 1052 |
| 322 | Ga0207671_10014756 | 3300025914 | Bacteria | 6159 |
| 323 | Ga0207660_10003834 | 3300025917 | Bacteria | 9803 |
| 324 | Ga0207662_10119676 | 3300025918 | Unclassified | 1650 |
| 325 | Ga0207662_10340387 | 3300025918 | Unclassified | 1005 |
| 326 | Ga0207657_10039267 | 3300025919 | Bacteria | 4209 |
| 327 | Ga0207649_10005426 | 3300025920 | Bacteria | 6902 |
| 328 | Ga0207681_10050307 | 3300025923 | Unclassified | 2819 |
| 329 | Ga0207681_10051508 | 3300025923 | Bacteria | 2790 |
| 330 | Ga0207681_10235295 | 3300025923 | Bacteria | 1423 |
| 331 | Ga0207650_10022251 | 3300025925 | Unclassified | 4485 |
| 332 | Ga0207650_10095305 | 3300025925 | Bacteria | 2281 |
| 333 | Ga0207650_10245133 | 3300025925 | Bacteria | 1449 |
| 334 | Ga0207659_10014568 | 3300025926 | Bacteria | 5076 |
| 335 | Ga0207659_10170473 | 3300025926 | Unclassified | 1717 |
| 336 | Ga0207659_10231065 | 3300025926 | Bacteria | 1492 |
| 337 | Ga0207659_10248748 | 3300025926 | Bacteria | 1442 |
| 338 | Ga0207644_10129273 | 3300025931 | Bacteria | 1932 |
| 339 | Ga0207644_10284844 | 3300025931 | Bacteria | 1328 |
| 340 | Ga0207690_10088001 | 3300025932 | Bacteria | 2187 |
| 341 | Ga0207706_10027723 | 3300025933 | Bacteria | 5064 |
| 342 | Ga0207706_10055015 | 3300025933 | Bacteria | 3511 |
| 343 | Ga0207686_10063626 | 3300025934 | Bacteria | 2347 |
| 344 | Ga0207709_10000049 | 3300025935 | Bacteria | 237124 |
| 345 | Ga0207670_10018985 | 3300025936 | Bacteria | 4191 |
| 346 | Ga0207670_10062831 | 3300025936 | Bacteria | 2539 |
| 347 | Ga0207670_10154888 | 3300025936 | Bacteria | 1704 |
| 348 | Ga0207670_10232503 | 3300025936 | Bacteria | 1416 |
| 349 | Ga0207669_10029366 | 3300025937 | Bacteria | 3040 |
| 350 | Ga0207669_10192922 | 3300025937 | Unclassified | 1471 |
| 351 | Ga0207704_10140745 | 3300025938 | Bacteria | 1687 |
| 352 | Ga0207704_10339899 | 3300025938 | Bacteria | 1165 |
| 353 | Ga0207704_10673350 | 3300025938 | Unclassified | 854 |
| 354 | Ga0207691_10009095 | 3300025940 | Bacteria | 9534 |
| 355 | Ga0207691_10030538 | 3300025940 | Bacteria | 5035 |
| 356 | Ga0207691_10054732 | 3300025940 | Bacteria | 3639 |
| 357 | Ga0207691_10076270 | 3300025940 | Bacteria | 3021 |
| 358 | Ga0207691_10206809 | 3300025940 | Bacteria | 1706 |
| 359 | Ga0207711_10248045 | 3300025941 | Unclassified | 1634 |
| 360 | Ga0207711_10592806 | 3300025941 | Unclassified | 1034 |
| 361 | Ga0207689_10003687 | 3300025942 | Bacteria | 13959 |
| 362 | Ga0207689_10015930 | 3300025942 | Bacteria | 6365 |
| 363 | Ga0207689_10021969 | 3300025942 | Bacteria | 5365 |
| 364 | Ga0207689_10022578 | 3300025942 | Bacteria | 5288 |
| 365 | Ga0207689_10030997 | 3300025942 | Unclassified | 4455 |
| 366 | Ga0207689_10053617 | 3300025942 | Bacteria | 3322 |
| 367 | Ga0207689_10063806 | 3300025942 | Unclassified | 3031 |
| 368 | Ga0207689_10215348 | 3300025942 | Unclassified | 1587 |
| 369 | Ga0207661_10000738 | 3300025944 | Bacteria | 21229 |
| 370 | Ga0207661_10134380 | 3300025944 | Bacteria | 2123 |
| 371 | Ga0207661_10806490 | 3300025944 | Bacteria | 864 |
| 372 | Ga0207679_10000902 | 3300025945 | Bacteria | 18967 |
| 373 | Ga0207679_10118525 | 3300025945 | Unclassified | 2103 |
| 374 | Ga0207651_10031755 | 3300025960 | Bacteria | 3381 |
| 375 | Ga0207651_10046016 | 3300025960 | Unclassified | 2931 |
| 376 | Ga0207651_10085259 | 3300025960 | Bacteria | 2291 |
| 377 | Ga0207651_10140712 | 3300025960 | Bacteria | 1863 |
| 378 | Ga0207651_10240782 | 3300025960 | Bacteria | 1474 |
| 379 | Ga0207651_10242813 | 3300025960 | Bacteria | 1469 |
| 380 | Ga0207651_10402542 | 3300025960 | Bacteria | 1165 |
| 381 | Ga0207712_10003644 | 3300025961 | Bacteria | 9703 |
| 382 | Ga0207712_10004435 | 3300025961 | Bacteria | 8865 |
| 383 | Ga0207712_10026024 | 3300025961 | Bacteria | 3894 |
| 384 | Ga0207712_10092555 | 3300025961 | Bacteria | 2229 |
| 385 | Ga0207712_10212793 | 3300025961 | Bacteria | 1541 |
| 386 | Ga0207668_10025492 | 3300025972 | Unclassified | 3828 |
| 387 | Ga0207668_10244561 | 3300025972 | Bacteria | 1453 |
| 388 | Ga0207668_10599625 | 3300025972 | Unclassified | 959 |
| 389 | Ga0207658_10007791 | 3300025986 | Bacteria | 7294 |
| 390 | Ga0207658_10139245 | 3300025986 | Bacteria | 1961 |
| 391 | Ga0207658_10158804 | 3300025986 | Unclassified | 1851 |
| 392 | Ga0207658_10213616 | 3300025986 | Unclassified | 1618 |
| 393 | Ga0207658_10295179 | 3300025986 | Bacteria | 1394 |
| 394 | Ga0207658_10574199 | 3300025986 | Bacteria | 1011 |
| 395 | Ga0207677_10015160 | 3300026023 | Unclassified | 4524 |
| 396 | Ga0207677_10035761 | 3300026023 | Bacteria | 3229 |
| 397 | Ga0207677_10080673 | 3300026023 | Bacteria | 2332 |
| 398 | Ga0207677_10094807 | 3300026023 | Bacteria | 2179 |
| 399 | Ga0207677_10154854 | 3300026023 | Bacteria | 1773 |
| 400 | Ga0207677_10401044 | 3300026023 | Unclassified | 1163 |
| 401 | Ga0207677_10814595 | 3300026023 | Bacteria | 837 |
| 402 | Ga0207703_10010342 | 3300026035 | Bacteria | 7304 |
| 403 | Ga0207703_10190877 | 3300026035 | Bacteria | 1814 |
| 404 | Ga0207639_10021442 | 3300026041 | Bacteria | 4641 |
| 405 | Ga0207639_10096718 | 3300026041 | Bacteria | 2376 |
| 406 | Ga0207639_10224744 | 3300026041 | Bacteria | 1624 |
| 407 | Ga0207639_10273882 | 3300026041 | Bacteria | 1482 |
| 408 | Ga0207678_10200488 | 3300026067 | Bacteria | 1706 |
| 409 | Ga0207678_10548129 | 3300026067 | Bacteria | 1011 |
| 410 | Ga0207702_10176909 | 3300026078 | Bacteria | 1961 |
| 411 | Ga0207641_10000380 | 3300026088 | Bacteria | 52801 |
| 412 | Ga0207641_10000661 | 3300026088 | Bacteria | 37590 |
| 413 | Ga0207641_10025398 | 3300026088 | Bacteria | 4885 |
| 414 | Ga0207641_10030996 | 3300026088 | Bacteria | 4433 |
| 415 | Ga0207641_10048141 | 3300026088 | Bacteria | 3597 |
| 416 | Ga0207641_10098470 | 3300026088 | Bacteria | 2571 |
| 417 | Ga0207641_10509108 | 3300026088 | Bacteria | 1170 |
| 418 | Ga0207648_10003599 | 3300026089 | Bacteria | 16209 |
| 419 | Ga0207648_10012445 | 3300026089 | Bacteria | 7966 |
| 420 | Ga0207648_10015417 | 3300026089 | Bacteria | 7031 |
| 421 | Ga0207648_10106191 | 3300026089 | Bacteria | 2464 |
| 422 | Ga0207648_10110130 | 3300026089 | Unclassified | 2418 |
| 423 | Ga0207648_10505465 | 3300026089 | Bacteria | 1106 |
| 424 | Ga0207676_10009979 | 3300026095 | Bacteria | 6756 |
| 425 | Ga0207676_10033373 | 3300026095 | Bacteria | 3888 |
| 426 | Ga0207676_10133718 | 3300026095 | Unclassified | 2113 |
| 427 | Ga0207674_10003262 | 3300026116 | Bacteria | 19959 |
| 428 | Ga0207674_10050878 | 3300026116 | Unclassified | 4230 |
| 429 | Ga0207674_10233105 | 3300026116 | Bacteria | 1789 |
| 430 | Ga0207674_10233249 | 3300026116 | Unclassified | 1788 |
| 431 | Ga0207674_10542551 | 3300026116 | Unclassified | 1123 |
| 432 | Ga0207675_100002458 | 3300026118 | Bacteria | 18348 |
| 433 | Ga0207675_100018725 | 3300026118 | Bacteria | 6463 |
| 434 | Ga0207675_100041774 | 3300026118 | Unclassified | 4281 |
| 435 | Ga0207675_100262827 | 3300026118 | Bacteria | 1673 |
| 436 | Ga0207675_100429269 | 3300026118 | Bacteria | 1306 |
| 437 | Ga0207683_10003509 | 3300026121 | Bacteria | 13675 |
| 438 | Ga0207683_10049417 | 3300026121 | Bacteria | 3682 |
| 439 | Ga0207698_10002995 | 3300026142 | Bacteria | 10135 |
| 440 | Ga0207698_10046073 | 3300026142 | Bacteria | 3290 |
| 441 | Ga0207698_10210347 | 3300026142 | Unclassified | 1749 |
| 442 | Ga0209968_1011867 | 3300027526 | Bacteria | 1354 |
| 443 | Ga0209282_1023473 | 3300027666 | Bacteria | 3877 |
| 444 | Ga0268266_10064584 | 3300028379 | Unclassified | 3163 |
| 445 | Ga0268266_10160973 | 3300028379 | Bacteria | 2030 |
| 446 | Ga0268266_10323502 | 3300028379 | Bacteria | 1444 |
| 447 | Ga0268265_10005161 | 3300028380 | Bacteria | 8945 |
| 448 | Ga0268264_10002545 | 3300028381 | Bacteria | 15994 |
| 449 | Ga0268264_10080368 | 3300028381 | Bacteria | 2784 |
| 450 | Ga0268264_10122469 | 3300028381 | Unclassified | 2294 |
| 451 | Ga0268264_10349691 | 3300028381 | Bacteria | 1406 |
| 452 | Ga0265334_10003361 | 3300028573 | Bacteria | 7298 |
| 453 | Ga0307515_10009312 | 3300028794 | Bacteria | 19000 |
| 454 | Ga0265338_10015045 | 3300028800 | Bacteria | 8540 |
| 455 | Ga0265338_10378291 | 3300028800 | Bacteria | 1013 |
| 456 | Ga0316177_1113690 | 3300030731 | Bacteria | 4373 |
| 457 | Ga0316176_1047226 | 3300030732 | Bacteria | 14320 |
| 458 | Ga0316183_1086246 | 3300030742 | Bacteria | 40321 |
| 459 | Ga0316181_1058577 | 3300030744 | Bacteria | 14287 |
| 460 | Ga0316182_1223135 | 3300030745 | Bacteria | 1524 |
| 461 | Ga0265327_10000819 | 3300031251 | Bacteria | 46924 |
| 462 | Ga0265327_10006440 | 3300031251 | Bacteria | 9383 |
| 463 | Ga0307513_10134888 | 3300031456 | Bacteria | 2406 |
| 464 | Ga0316576_10300097 | 3300031727 | Bacteria | 1201 |
| 465 | Ga0307405_10000049 | 3300031731 | Bacteria | 66592 |
| 466 | Ga0307413_10002048 | 3300031824 | Bacteria | 8039 |
| 467 | Ga0307407_10000024 | 3300031903 | Bacteria | 113716 |
| 468 | Ga0307412_10182492 | 3300031911 | Bacteria | 1580 |
| 469 | Ga0307416_100000037 | 3300032002 | Bacteria | 137513 |
| 470 | Ga0307416_100006959 | 3300032002 | Bacteria | 7132 |
| 471 | Ga0307414_10001034 | 3300032004 | Bacteria | 14217 |
| 472 | Ga0307414_10004809 | 3300032004 | Bacteria | 7371 |
| 473 | Ga0307414_10006990 | 3300032004 | Bacteria | 6326 |
| 474 | Ga0307414_10014942 | 3300032004 | Bacteria | 4674 |
| 475 | Ga0307414_10034778 | 3300032004 | Bacteria | 3346 |
| 476 | Ga0307414_10068525 | 3300032004 | Bacteria | 2546 |
| 477 | Ga0307414_10091226 | 3300032004 | Unclassified | 2264 |
| 478 | Ga0307414_10189672 | 3300032004 | Bacteria | 1662 |
| 479 | Ga0307414_10212078 | 3300032004 | Bacteria | 1583 |
| 480 | Ga0307411_10000012 | 3300032005 | Bacteria | 161467 |
| 481 | Ga0373930_0011000 | 3300034816 | Bacteria | 1627 |
| 482 | Ga0373955_0156004 | 3300035172 | Unclassified | 1345 |
| 483 | Ga0373962_0106226 | 3300035242 | Unclassified | 881 |
| 484 | Ga0316574_0062061 | 3300035398 | Bacteria | 2348 |
| 485 | Ga0373937_0011902 | 3300036401 | Bacteria | 7636 |
| 486 | Ga0373937_0091931 | 3300036401 | Bacteria | 2812 |
| 487 | Ga0373937_0104510 | 3300036401 | Bacteria | 2631 |
| 488 | Ga0373937_0127322 | 3300036401 | Unclassified | 2377 |
| 489 | Ga0373925_0088452 | 3300037068 | Bacteria | 2366 |
| 490 | Ga0436363_0242255 | 3300039450 | Bacteria | 862 |
| 491 | Ga0439439_0089016 | 3300041406 | Unclassified | 841 |
| 492 | Ga0439447_000165 | 3300041407 | Bacteria | 22643 |
| 493 | Ga0439466_0002676 | 3300041411 | Bacteria | 6965 |
| 494 | Ga0439465_0008949 | 3300041413 | Bacteria | 3155 |
| 495 | Ga0451802_1277840 | 3300041460 | Bacteria | 881 |
| 496 | Ga0451843_0161377 | 3300041509 | Bacteria | 1001 |
| 497 | Ga0439449_0013962 | 3300042007 | Bacteria | 3021 |
| 498 | Ga0439449_0014815 | 3300042007 | Bacteria | 2930 |
| 499 | Ga0439457_000827 | 3300042014 | Bacteria | 9289 |
| 500 | Ga0439446_0038219 | 3300042156 | Bacteria | 1407 |
| 501 | Ga0451577_0003838 | 3300042876 | Bacteria | 16343 |
| 502 | Ga0453684_0000676 | 3300044712 | Bacteria | 122215 |
| 503 | Ga0453684_0183994 | 3300044712 | Unclassified | 2450 |
| 504 | Ga0451576_0000083 | 3300045051 | Bacteria | 236908 |
| 505 | Ga0451576_0252743 | 3300045051 | Unclassified | 1842 |
| 506 | Ga0451576_0434918 | 3300045051 | Bacteria | 1377 |
| 507 | Ga0451576_0672238 | 3300045051 | Unclassified | 1088 |
| 508 | Ga0495627_002629 | 3300046453 | Bacteria | 8446 |
| 509 | Ga0495629_0294425 | 3300046459 | Bacteria | 1112 |
| 510 | Ga0495638_0069041 | 3300046460 | Unclassified | 2166 |
| 511 | Ga0495664_0306898 | 3300046477 | Unclassified | 958 |
| 512 | Ga0495608_0390618 | 3300046511 | Bacteria | 852 |
| 513 | Ga0495610_0000045 | 3300046512 | Bacteria | 155304 |
| 514 | Ga0495610_0001236 | 3300046512 | Bacteria | 22946 |
| 515 | Ga0495618_0136374 | 3300046514 | Bacteria | 1570 |
| 516 | Ga0495630_0089950 | 3300046517 | Bacteria | 2319 |
| 517 | Ga0495587_0116277 | 3300046536 | Bacteria | 1534 |
| 518 | Ga0495587_0294948 | 3300046536 | Bacteria | 907 |
| 519 | Ga0495598_0027923 | 3300046537 | Bacteria | 1561 |
| 520 | Ga0495621_0024492 | 3300046539 | Unclassified | 2017 |
| 521 | Ga0495645_0351407 | 3300046543 | Bacteria | 950 |
| 522 | Ga0495633_0097967 | 3300046558 | Bacteria | 1362 |
| 523 | Ga0495668_0000489 | 3300046616 | Bacteria | 49613 |
| 524 | Ga0495668_0005239 | 3300046616 | Bacteria | 8883 |
| 525 | Ga0495634_0252229 | 3300046642 | Bacteria | 1079 |
| 526 | Ga0495611_0019676 | 3300046648 | Unclassified | 2901 |
| 527 | Ga0495635_0098575 | 3300046663 | Bacteria | 1998 |
| 528 | Ga0495657_0212660 | 3300046675 | Bacteria | 1175 |
| 529 | Ga0495658_0015643 | 3300046683 | Bacteria | 3893 |
| 530 | Ga0495670_0029280 | 3300046691 | Bacteria | 2733 |
| 531 | Ga0495604_0234734 | 3300047317 | Bacteria | 1257 |
| 532 | Ga0495674_0208655 | 3300047319 | Bacteria | 1619 |
| 533 | Ga0495672_0020249 | 3300047320 | Unclassified | 4365 |
| 534 | Ga0495676_0192269 | 3300047321 | Bacteria | 1423 |
| 535 | Ga0495684_0176042 | 3300047471 | Bacteria | 1588 |
| 536 | Ga0495602_0144639 | 3300048088 | Bacteria | 1878 |
| 537 | Ga0496114_0427179 | 3300048917 | Unclassified | 1174 |
| 538 | Ga0496114_0613483 | 3300048917 | Bacteria | 959 |
| 539 | Ga0496116_0000004 | 3300048919 | Bacteria | 839841 |
| 540 | Ga0496117_0008160 | 3300048920 | Bacteria | 10001 |
| 541 | Ga0496118_0158513 | 3300048921 | Bacteria | 1404 |
| 542 | Ga0496122_0000643 | 3300048925 | Bacteria | 70960 |
| 543 | Ga0496124_0005999 | 3300048927 | Bacteria | 13400 |
| 544 | Ga0496125_0000012 | 3300048928 | Bacteria | 651142 |
| 545 | Ga0496126_0008650 | 3300048929 | Bacteria | 10939 |
| 546 | Ga0496126_0071166 | 3300048929 | Bacteria | 3097 |
| 547 | Ga0501043_0121447 | 3300049579 | Bacteria | 2049 |
| 548 | Ga0501238_022424 | 3300049671 | Unclassified | 897 |
| 549 | Ga0501249_011458 | 3300049679 | Bacteria | 1861 |
| 550 | Ga0501249_075235 | 3300049679 | Bacteria | 791 |
| 551 | Ga0501266_000026 | 3300049763 | Bacteria | 56690 |
| 552 | nmdc:mga0k408_34935_c1 | 3300050493 | Bacteria | 2880 |
| 553 | nmdc:mga0k408_4631_c1 | 3300050493 | Bacteria | 7285 |
| 554 | nmdc:mga05p37_145992_c1 | 3300050507 | Bacteria | 2897 |
| 555 | nmdc:mga05p37_20024_c2 | 3300050507 | Bacteria | 7172 |
| 556 | nmdc:mga09592_153430_c1 | 3300050508 | Bacteria | 1988 |
| 557 | nmdc:mga09592_63781_c1 | 3300050508 | Bacteria | 3119 |
| 558 | nmdc:mga0qj67_30635_c1 | 3300050509 | Bacteria | 4189 |
| 559 | nmdc:mga0qj67_455057_c1 | 3300050509 | Bacteria | 1031 |
| 560 | nmdc:mga06r32_141170_c1 | 3300050510 | Bacteria | 2385 |
| 561 | nmdc:mga06r32_9671_c1 | 3300050510 | Bacteria | 8709 |
| 562 | nmdc:mga08y16_123242_c1 | 3300050511 | Bacteria | 2697 |
| 563 | nmdc:mga08y16_190227_c1 | 3300050511 | Bacteria | 2129 |
| 564 | nmdc:mga08y16_461948_c1 | 3300050511 | Bacteria | 1294 |
| 565 | Ga0495619_0174875 | 3300053085 | Bacteria | 1485 |
| 566 | Ga0500556_0032665 | 3300053104 | Unclassified | 1780 |
| 567 | Ga0500658_0000009 | 3300053134 | Bacteria | 270303 |
| 568 | Ga0500573_0122281 | 3300053140 | Bacteria | 1448 |
| 569 | Ga0500616_0015278 | 3300053153 | Bacteria | 4394 |
| 570 | Ga0500611_000002 | 3300053727 | Bacteria | 345991 |
| 571 | 2586209281 | 2585427687 | Bacteria | 5544917 |
| 572 | 2722729852 | 2721755487 | Bacteria | 6357185 |
| 573 | 2739590200 | 2739367651 | Bacteria | 6359826 |
| 574 | 2819548406 | 2818991437 | Bacteria | 5805520 |
| 575 | 2833643423 | 2833640130 | Bacteria | 4858325 |
| 576 | 2842723025 | 2842722452 | Bacteria | 6263924 |
| 577 | 2842904268 | 2842903701 | Bacteria | 6986368 |
| 578 | 2842913981 | 2842909656 | Bacteria | 6185908 |
| 579 | 2849283722 | 2849281842 | Bacteria | 6065644 |
| 580 | 2904449527 | 2904445276 | Bacteria | 5310396 |
| 581 | 2919696557 | 2919692658 | Bacteria | 5943958 |
| 582 | 2945999999 | 2945997725 | Bacteria | 6404843 |
| 583 | 2954016598 | 2954016120 | Bacteria | 6446024 |
| 584 | 2984575702 | 2984572630 | Bacteria | 4186940 |
| 585 | 2984609156 | 2984606641 | Bacteria | 4186971 |
| 586 | 3003236667 | 3003233435 | Bacteria | 4458031 |
| 587 | Ga0114129_10003569 | |||
| 588 | SwRhRL2b_contig_916033 | |||
| 589 | rootH2_10295173 | |||
| 590 | rootL2_10134461 | |||
| 591 | rootL2_10248561 | |||
| 592 | Ga0055530_10002378 | |||
| 593 | Ga0065714_10073048 | |||
| 594 | Ga0065715_10043676 | |||
| 595 | Ga0065707_10197600 | |||
| 596 | Ga0070658_10070169 | |||
| 597 | Ga0070676_10006346 | |||
| 598 | Ga0070676_10057970 | |||
| 599 | Ga0070683_100204187 | |||
| 600 | Ga0070683_100361554 | |||
| 601 | Ga0070670_100185565 | |||
| 602 | Ga0070670_100189784 | |||
| 603 | Ga0070670_100279427 | |||
| 604 | Ga0070670_100506257 | |||
| 605 | Ga0070677_10045810 | |||
| 606 | Ga0068869_100019418 | |||
| 607 | Ga0068869_100020425 | |||
| 608 | Ga0068869_100045019 | |||
| 609 | Ga0068869_100405420 | |||
| 610 | Ga0070666_10000050 | |||
| 611 | Ga0070666_10154321 | |||
| 612 | Ga0070666_10234158 | |||
| 613 | Ga0070666_10536510 | |||
| 614 | Ga0070680_100168666 | |||
| 615 | Ga0070682_100002796 | |||
| 616 | Ga0070682_100009802 | |||
| 617 | Ga0070682_100607494 | |||
| 618 | Ga0068868_100003855 | |||
| 619 | Ga0068868_100759719 | |||
| 620 | Ga0070689_100008890 | |||
| 621 | Ga0070689_100040492 | |||
| 622 | Ga0070689_100068440 | |||
| 623 | Ga0070689_100320133 | |||
| 624 | Ga0070689_100474039 | |||
| 625 | Ga0070691_10001334 | |||
| 626 | Ga0070661_100001199 | |||
| 627 | Ga0070661_100197800 | |||
| 628 | Ga0070668_100119220 | |||
| 629 | Ga0070668_100164516 | |||
| 630 | Ga0070668_100338896 | |||
| 631 | Ga0070668_100342551 | |||
| 632 | Ga0070668_100419645 | |||
| 633 | Ga0070669_100137279 | |||
| 634 | Ga0070669_100166432 | |||
| 635 | Ga0070675_100005613 | |||
| 636 | Ga0070675_100071662 | |||
| 637 | Ga0070675_100077798 | |||
| 638 | Ga0070675_100219146 | |||
| 639 | Ga0070671_100019435 | |||
| 640 | Ga0070674_100037295 | |||
| 641 | Ga0070674_100183238 | |||
| 642 | Ga0070673_100043512 | |||
| 643 | Ga0070673_100092033 | |||
| 644 | Ga0070673_100233601 | |||
| 645 | Ga0070673_100280769 | |||
| 646 | Ga0070673_100344835 | |||
| 647 | Ga0070688_100041523 | |||
| 648 | Ga0070688_100051239 | |||
| 649 | Ga0070688_100094014 | |||
| 650 | Ga0070688_100363963 | |||
| 651 | Ga0070659_100002681 | |||
| 652 | Ga0070667_100021876 | |||
| 653 | Ga0070667_100026929 | |||
| 654 | Ga0070667_100090788 | |||
| 655 | Ga0070667_100234997 | |||
| 656 | Ga0070667_100362186 | |||
| 657 | Ga0070701_10146605 | |||
| 658 | Ga0070701_10266789 | |||
| 659 | Ga0070700_100182923 | |||
| 660 | Ga0070663_100399469 | |||
| 661 | Ga0070663_100480737 | |||
| 662 | Ga0070662_100051494 | |||
| 663 | Ga0070662_100178219 | |||
| 664 | Ga0070662_100211480 | |||
| 665 | Ga0070662_100571026 | |||
| 666 | Ga0068867_100015472 | |||
| 667 | Ga0068867_100031824 | |||
| 668 | Ga0068867_100200710 | |||
| 669 | Ga0070685_10011303 | |||
| 670 | Ga0070685_10053404 | |||
| 671 | Ga0070685_10324716 | |||
| 672 | Ga0070698_100000645 | |||
| 673 | Ga0070698_100008979 | |||
| 674 | Ga0070698_100353640 | |||
| 675 | Ga0070699_100144439 | |||
| 676 | Ga0070684_100000298 | |||
| 677 | Ga0070684_100000731 | |||
| 678 | Ga0070684_100044635 | |||
| 679 | Ga0070684_100730437 | |||
| 680 | Ga0068853_100003450 | |||
| 681 | Ga0068853_100066002 | |||
| 682 | Ga0068853_100234714 | |||
| 683 | Ga0070672_100027429 | |||
| 684 | Ga0070672_100036884 | |||
| 685 | Ga0070672_100095973 | |||
| 686 | Ga0070672_100209441 | |||
| 687 | Ga0070672_100282035 | |||
| 688 | Ga0070672_100345308 | |||
| 689 | Ga0070665_100027335 | |||
| 690 | Ga0068855_100039717 | |||
| 691 | Ga0068855_100063789 | |||
| 692 | Ga0068855_100680900 | |||
| 693 | Ga0070664_100000884 | |||
| 694 | Ga0070664_100073067 | |||
| 695 | Ga0070664_100123294 | |||
| 696 | Ga0070664_100142133 | |||
| 697 | Ga0070664_100164630 | |||
| 698 | Ga0070664_100167746 | |||
| 699 | Ga0068857_100001112 | |||
| 700 | Ga0068857_100094094 | |||
| 701 | Ga0068854_100031547 | |||
| 702 | Ga0068854_100272172 | |||
| 703 | Ga0068856_100034845 | |||
| 704 | Ga0068856_100336621 | |||
| 705 | Ga0070702_100042270 | |||
| 706 | Ga0070702_100278061 | |||
| 707 | Ga0068852_100003986 | |||
| 708 | Ga0068852_100075752 | |||
| 709 | Ga0068852_100454203 | |||
| 710 | Ga0068859_100000025 | |||
| 711 | Ga0068859_100069053 | |||
| 712 | Ga0068859_100158238 | |||
| 713 | Ga0068859_100215497 | |||
| 714 | Ga0068859_100218717 | |||
| 715 | Ga0068859_100239690 | |||
| 716 | Ga0068859_100253063 | |||
| 717 | Ga0068859_100364756 | |||
| 718 | Ga0068864_100004501 | |||
| 719 | Ga0068864_100012580 | |||
| 720 | Ga0068864_100057609 | |||
| 721 | Ga0068864_100209380 | |||
| 722 | Ga0068864_100288187 | |||
| 723 | Ga0068866_10042188 | |||
| 724 | Ga0068861_100002289 | |||
| 725 | Ga0068861_100069150 | |||
| 726 | Ga0068861_100128679 | |||
| 727 | Ga0068861_100191358 | |||
| 728 | Ga0068861_100256154 | |||
| 729 | Ga0068870_10066422 | |||
| 730 | Ga0068870_10068942 | |||
| 731 | Ga0068870_10435865 | |||
| 732 | Ga0068863_100004643 | |||
| 733 | Ga0068863_100055607 | |||
| 734 | Ga0068863_100083324 | |||
| 735 | Ga0068863_100524596 | |||
| 736 | Ga0068858_100018416 | |||
| 737 | Ga0068858_100035184 | |||
| 738 | Ga0068858_100351600 | |||
| 739 | Ga0068858_100709999 | |||
| 740 | Ga0068860_100001253 | |||
| 741 | Ga0068860_100010864 | |||
| 742 | Ga0068860_100092893 | |||
| 743 | Ga0068860_100144518 | |||
| 744 | Ga0068860_100262803 | |||
| 745 | Ga0068860_100602638 | |||
| 746 | Ga0068860_100709218 | |||
| 747 | Ga0068862_100008657 | |||
| 748 | Ga0068862_100261570 | |||
| 749 | Ga0068862_100306878 | |||
| 750 | Ga0068862_100324415 | |||
| 751 | Ga0075366_10013347 | |||
| 752 | Ga0097621_100036651 | |||
| 753 | Ga0097621_100062189 | |||
| 754 | Ga0097621_100116118 | |||
| 755 | Ga0097621_100145632 | |||
| 756 | Ga0097621_100241271 | |||
| 757 | Ga0068871_100002075 | |||
| 758 | Ga0068871_100042894 | |||
| 759 | Ga0075428_100006620 | |||
| 760 | Ga0075428_100121289 | |||
| 761 | Ga0075430_100597680 | |||
| 762 | Ga0075431_100000866 | |||
| 763 | Ga0075431_100226049 | |||
| 764 | Ga0075431_100407280 | |||
| 765 | Ga0075434_100122982 | |||
| 766 | Ga0075429_100006687 | |||
| 767 | Ga0075429_100009709 | |||
| 768 | Ga0068865_100004271 | |||
| 769 | Ga0068865_100173255 | |||
| 770 | Ga0068865_100317710 | |||
| 771 | Ga0097620_100000025 | |||
| 772 | Ga0097620_100069050 | |||
| 773 | Ga0097620_100158244 | |||
| 774 | Ga0097620_100215483 | |||
| 775 | Ga0097620_100218737 | |||
| 776 | Ga0097620_100239699 | |||
| 777 | Ga0097620_100253074 | |||
| 778 | Ga0097620_100301980 | |||
| 779 | Ga0097620_100364774 | |||
| 780 | Ga0099824_1006257 | |||
| 781 | Ga0099826_10030236 | |||
| 782 | Ga0105244_10147640 | |||
| 783 | Ga0105240_10364496 | |||
| 784 | Ga0111539_10095344 | |||
| 785 | Ga0111539_10124969 | |||
| 786 | Ga0111539_10177664 | |||
| 787 | Ga0111539_10246021 | |||
| 788 | Ga0111539_10536973 | |||
| 789 | Ga0105247_10005807 | |||
| 790 | Ga0105247_10186462 | |||
| 791 | Ga0114129_10001572 | |||
| 792 | Ga0114129_10093117 | |||
| 793 | Ga0114129_10527605 | |||
| 794 | Ga0105243_10000007 | |||
| 795 | Ga0105243_10685162 | |||
| 796 | Ga0105241_10003958 | |||
| 797 | Ga0105241_10039119 | |||
| 798 | Ga0105241_10081764 | |||
| 799 | Ga0105242_10025664 | |||
| 800 | Ga0105242_10052608 | |||
| 801 | Ga0105242_10077674 | |||
| 802 | Ga0105242_10085056 | |||
| 803 | Ga0105248_10323054 | |||
| 804 | Ga0105237_10014702 | |||
| 805 | Ga0105237_10385929 | |||
| 806 | Ga0105249_10001240 | |||
| 807 | Ga0105249_10006762 | |||
| 808 | Ga0105249_10010036 | |||
| 809 | Ga0105249_10055960 | |||
| 810 | Ga0105249_10108254 | |||
| 811 | Ga0105246_10118181 | |||
| 812 | Ga0105246_10142077 | |||
| 813 | Ga0157373_10025044 | |||
| 814 | Ga0157371_10000119 | |||
| 815 | Ga0157371_10001988 | |||
| 816 | Ga0157371_10278929 | |||
| 817 | Ga0157370_10003284 | |||
| 818 | Ga0157370_10005524 | |||
| 819 | Ga0157370_10011855 | |||
| 820 | Ga0157370_10033654 | |||
| 821 | Ga0157370_10270778 | |||
| 822 | Ga0157369_10000015 | |||
| 823 | Ga0157369_10001151 | |||
| 824 | Ga0157369_10139551 | |||
| 825 | Ga0157374_10000955 | |||
| 826 | Ga0157374_10037758 | |||
| 827 | Ga0157374_10048274 | |||
| 828 | Ga0157374_10118437 | |||
| 829 | Ga0157374_10282089 | |||
| 830 | Ga0157374_10398571 | |||
| 831 | Ga0157378_10026297 | |||
| 832 | Ga0157378_10028270 | |||
| 833 | Ga0157378_10076764 | |||
| 834 | Ga0157378_10246342 | |||
| 835 | Ga0163162_10000344 | |||
| 836 | Ga0163162_10000520 | |||
| 837 | Ga0163162_10029655 | |||
| 838 | Ga0163162_10042164 | |||
| 839 | Ga0163162_10088421 | |||
| 840 | Ga0163162_10128685 | |||
| 841 | Ga0163162_10748766 | |||
| 842 | Ga0163162_10906655 | |||
| 843 | Ga0157372_10053750 | |||
| 844 | Ga0157372_10206085 | |||
| 845 | Ga0157372_10396141 | |||
| 846 | Ga0157372_10450640 | |||
| 847 | Ga0157375_10002578 | |||
| 848 | Ga0157375_10059161 | |||
| 849 | Ga0157375_10154078 | |||
| 850 | Ga0157375_10283354 | |||
| 851 | Ga0157375_10349638 | |||
| 852 | Ga0157375_10666797 | |||
| 853 | Ga0157375_11190280 | |||
| 854 | Ga0163163_10000075 | |||
| 855 | Ga0163163_10003651 | |||
| 856 | Ga0163163_10112665 | |||
| 857 | Ga0163163_10468591 | |||
| 858 | Ga0163163_10568365 | |||
| 859 | Ga0163163_10924716 | |||
| 860 | Ga0157380_10003006 | |||
| 861 | Ga0157380_10024955 | |||
| 862 | Ga0157380_10109338 | |||
| 863 | Ga0157380_10365077 | |||
| 864 | Ga0157380_10812686 | |||
| 865 | Ga0182008_10228894 | |||
| 866 | Ga0182008_10238826 | |||
| 867 | Ga0157377_10058698 | |||
| 868 | Ga0157377_10230051 | |||
| 869 | Ga0157377_10526978 | |||
| 870 | Ga0157379_10040212 | |||
| 871 | Ga0157379_10119098 | |||
| 872 | Ga0157379_10197689 | |||
| 873 | Ga0157379_10337604 | |||
| 874 | Ga0157376_10018590 | |||
| 875 | Ga0157376_10127726 | |||
| 876 | Ga0157376_10262818 | |||
| 877 | Ga0157376_10394252 | |||
| 878 | Ga0157376_10451444 | |||
| 879 | Ga0182006_1000091 | |||
| 880 | Ga0182006_1000957 | |||
| 881 | Ga0182006_1009862 | |||
| 882 | Ga0182006_1020693 | |||
| 883 | Ga0182006_1027039 | |||
| 884 | Ga0182007_10000010 | |||
| 885 | Ga0182007_10079022 | |||
| 886 | Ga0183373_1003 | |||
| 887 | Ga0163161_10000046 | |||
| 888 | Ga0163161_10000524 | |||
| 889 | Ga0163161_10065492 | |||
| 890 | Ga0163161_10166360 | |||
| 891 | Ga0163161_10579718 | |||
| 892 | Ga0213874_10067769 | |||
| 893 | Ga0209676_1000001 | |||
| 894 | Ga0209050_1000258 | |||
| 895 | Ga0207656_10008263 | |||
| 896 | Ga0207656_10139143 | |||
| 897 | Ga0207642_10160397 | |||
| 898 | Ga0207710_10000852 | |||
| 899 | Ga0207710_10011865 | |||
| 900 | Ga0207680_10000086 | |||
| 901 | Ga0207645_10003860 | |||
| 902 | Ga0207645_10005381 | |||
| 903 | Ga0207643_10004125 | |||
| 904 | Ga0207643_10013440 | |||
| 905 | Ga0207705_10060161 | |||
| 906 | Ga0207654_10004379 | |||
| 907 | Ga0207654_10325428 | |||
| 908 | Ga0207671_10014756 | |||
| 909 | Ga0207660_10003834 | |||
| 910 | Ga0207662_10119676 | |||
| 911 | Ga0207662_10340387 | |||
| 912 | Ga0207657_10039267 | |||
| 913 | Ga0207649_10005426 | |||
| 914 | Ga0207681_10050307 | |||
| 915 | Ga0207681_10051508 | |||
| 916 | Ga0207681_10235295 | |||
| 917 | Ga0207650_10022251 | |||
| 918 | Ga0207650_10095305 | |||
| 919 | Ga0207650_10245133 | |||
| 920 | Ga0207659_10014568 | |||
| 921 | Ga0207659_10170473 | |||
| 922 | Ga0207659_10231065 | |||
| 923 | Ga0207659_10248748 | |||
| 924 | Ga0207644_10129273 | |||
| 925 | Ga0207644_10284844 | |||
| 926 | Ga0207690_10088001 | |||
| 927 | Ga0207706_10027723 | |||
| 928 | Ga0207706_10055015 | |||
| 929 | Ga0207686_10063626 | |||
| 930 | Ga0207709_10000049 | |||
| 931 | Ga0207670_10018985 | |||
| 932 | Ga0207670_10062831 | |||
| 933 | Ga0207670_10154888 | |||
| 934 | Ga0207670_10232503 | |||
| 935 | Ga0207669_10029366 | |||
| 936 | Ga0207669_10192922 | |||
| 937 | Ga0207704_10140745 | |||
| 938 | Ga0207704_10339899 | |||
| 939 | Ga0207704_10673350 | |||
| 940 | Ga0207691_10009095 | |||
| 941 | Ga0207691_10030538 | |||
| 942 | Ga0207691_10054732 | |||
| 943 | Ga0207691_10076270 | |||
| 944 | Ga0207691_10206809 | |||
| 945 | Ga0207711_10248045 | |||
| 946 | Ga0207711_10592806 | |||
| 947 | Ga0207689_10003687 | |||
| 948 | Ga0207689_10015930 | |||
| 949 | Ga0207689_10021969 | |||
| 950 | Ga0207689_10022578 | |||
| 951 | Ga0207689_10030997 | |||
| 952 | Ga0207689_10053617 | |||
| 953 | Ga0207689_10063806 | |||
| 954 | Ga0207689_10215348 | |||
| 955 | Ga0207661_10000738 | |||
| 956 | Ga0207661_10134380 | |||
| 957 | Ga0207661_10806490 | |||
| 958 | Ga0207679_10000902 | |||
| 959 | Ga0207679_10118525 | |||
| 960 | Ga0207651_10031755 | |||
| 961 | Ga0207651_10046016 | |||
| 962 | Ga0207651_10085259 | |||
| 963 | Ga0207651_10140712 | |||
| 964 | Ga0207651_10240782 | |||
| 965 | Ga0207651_10242813 | |||
| 966 | Ga0207651_10402542 | |||
| 967 | Ga0207712_10003644 | |||
| 968 | Ga0207712_10004435 | |||
| 969 | Ga0207712_10026024 | |||
| 970 | Ga0207712_10092555 | |||
| 971 | Ga0207712_10212793 | |||
| 972 | Ga0207668_10025492 | |||
| 973 | Ga0207668_10244561 | |||
| 974 | Ga0207668_10599625 | |||
| 975 | Ga0207658_10007791 | |||
| 976 | Ga0207658_10139245 | |||
| 977 | Ga0207658_10158804 | |||
| 978 | Ga0207658_10213616 | |||
| 979 | Ga0207658_10295179 | |||
| 980 | Ga0207658_10574199 | |||
| 981 | Ga0207677_10015160 | |||
| 982 | Ga0207677_10035761 | |||
| 983 | Ga0207677_10080673 | |||
| 984 | Ga0207677_10094807 | |||
| 985 | Ga0207677_10154854 | |||
| 986 | Ga0207677_10401044 | |||
| 987 | Ga0207677_10814595 | |||
| 988 | Ga0207703_10010342 | |||
| 989 | Ga0207703_10190877 | |||
| 990 | Ga0207639_10021442 | |||
| 991 | Ga0207639_10096718 | |||
| 992 | Ga0207639_10224744 | |||
| 993 | Ga0207639_10273882 | |||
| 994 | Ga0207678_10200488 | |||
| 995 | Ga0207678_10548129 | |||
| 996 | Ga0207702_10176909 | |||
| 997 | Ga0207641_10000380 | |||
| 998 | Ga0207641_10000661 | |||
| 999 | Ga0207641_10025398 | |||
| 1000 | Ga0207641_10030996 | |||
| 1001 | Ga0207641_10048141 | |||
| 1002 | Ga0207641_10098470 | |||
| 1003 | Ga0207641_10509108 | |||
| 1004 | Ga0207648_10003599 | |||
| 1005 | Ga0207648_10012445 | |||
| 1006 | Ga0207648_10015417 | |||
| 1007 | Ga0207648_10106191 | |||
| 1008 | Ga0207648_10110130 | |||
| 1009 | Ga0207648_10505465 | |||
| 1010 | Ga0207676_10009979 | |||
| 1011 | Ga0207676_10033373 | |||
| 1012 | Ga0207676_10133718 | |||
| 1013 | Ga0207674_10003262 | |||
| 1014 | Ga0207674_10050878 | |||
| 1015 | Ga0207674_10233105 | |||
| 1016 | Ga0207674_10233249 | |||
| 1017 | Ga0207674_10542551 | |||
| 1018 | Ga0207675_100002458 | |||
| 1019 | Ga0207675_100018725 | |||
| 1020 | Ga0207675_100041774 | |||
| 1021 | Ga0207675_100262827 | |||
| 1022 | Ga0207675_100429269 | |||
| 1023 | Ga0207683_10003509 | |||
| 1024 | Ga0207683_10049417 | |||
| 1025 | Ga0207698_10002995 | |||
| 1026 | Ga0207698_10046073 | |||
| 1027 | Ga0207698_10210347 | |||
| 1028 | Ga0209968_1011867 | |||
| 1029 | Ga0209282_1023473 | |||
| 1030 | Ga0268266_10064584 | |||
| 1031 | Ga0268266_10160973 | |||
| 1032 | Ga0268266_10323502 | |||
| 1033 | Ga0268265_10005161 | |||
| 1034 | Ga0268264_10002545 | |||
| 1035 | Ga0268264_10080368 | |||
| 1036 | Ga0268264_10122469 | |||
| 1037 | Ga0268264_10349691 | |||
| 1038 | Ga0265334_10003361 | |||
| 1039 | Ga0307515_10009312 | |||
| 1040 | Ga0265338_10015045 | |||
| 1041 | Ga0265338_10378291 | |||
| 1042 | Ga0316177_1113690 | |||
| 1043 | Ga0316176_1047226 | |||
| 1044 | Ga0316183_1086246 | |||
| 1045 | Ga0316181_1058577 | |||
| 1046 | Ga0316182_1223135 | |||
| 1047 | Ga0265327_10000819 | |||
| 1048 | Ga0265327_10006440 | |||
| 1049 | Ga0307513_10134888 | |||
| 1050 | Ga0316576_10300097 | |||
| 1051 | Ga0307405_10000049 | |||
| 1052 | Ga0307413_10002048 | |||
| 1053 | Ga0307407_10000024 | |||
| 1054 | Ga0307412_10182492 | |||
| 1055 | Ga0307416_100000037 | |||
| 1056 | Ga0307416_100006959 | |||
| 1057 | Ga0307414_10001034 | |||
| 1058 | Ga0307414_10004809 | |||
| 1059 | Ga0307414_10006990 | |||
| 1060 | Ga0307414_10014942 | |||
| 1061 | Ga0307414_10034778 | |||
| 1062 | Ga0307414_10068525 | |||
| 1063 | Ga0307414_10091226 | |||
| 1064 | Ga0307414_10189672 | |||
| 1065 | Ga0307414_10212078 | |||
| 1066 | Ga0307411_10000012 | |||
| 1067 | Ga0373930_0011000 | |||
| 1068 | Ga0373955_0156004 | |||
| 1069 | Ga0373962_0106226 | |||
| 1070 | Ga0316574_0062061 | |||
| 1071 | Ga0373937_0011902 | |||
| 1072 | Ga0373937_0091931 | |||
| 1073 | Ga0373937_0104510 | |||
| 1074 | Ga0373937_0127322 | |||
| 1075 | Ga0373925_0088452 | |||
| 1076 | Ga0436363_0242255 | |||
| 1077 | Ga0439439_0089016 | |||
| 1078 | Ga0439447_000165 | |||
| 1079 | Ga0439466_0002676 | |||
| 1080 | Ga0439465_0008949 | |||
| 1081 | Ga0451802_1277840 | |||
| 1082 | Ga0451843_0161377 | |||
| 1083 | Ga0439449_0013962 | |||
| 1084 | Ga0439449_0014815 | |||
| 1085 | Ga0439457_000827 | |||
| 1086 | Ga0439446_0038219 | |||
| 1087 | Ga0451577_0003838 | |||
| 1088 | Ga0453684_0000676 | |||
| 1089 | Ga0453684_0183994 | |||
| 1090 | Ga0451576_0000083 | |||
| 1091 | Ga0451576_0252743 | |||
| 1092 | Ga0451576_0434918 | |||
| 1093 | Ga0451576_0672238 | |||
| 1094 | Ga0495627_002629 | |||
| 1095 | Ga0495629_0294425 | |||
| 1096 | Ga0495638_0069041 | |||
| 1097 | Ga0495664_0306898 | |||
| 1098 | Ga0495608_0390618 | |||
| 1099 | Ga0495610_0000045 | |||
| 1100 | Ga0495610_0001236 | |||
| 1101 | Ga0495618_0136374 | |||
| 1102 | Ga0495630_0089950 | |||
| 1103 | Ga0495587_0116277 | |||
| 1104 | Ga0495587_0294948 | |||
| 1105 | Ga0495598_0027923 | |||
| 1106 | Ga0495621_0024492 | |||
| 1107 | Ga0495645_0351407 | |||
| 1108 | Ga0495633_0097967 | |||
| 1109 | Ga0495668_0000489 | |||
| 1110 | Ga0495668_0005239 | |||
| 1111 | Ga0495634_0252229 | |||
| 1112 | Ga0495611_0019676 | |||
| 1113 | Ga0495635_0098575 | |||
| 1114 | Ga0495657_0212660 | |||
| 1115 | Ga0495658_0015643 | |||
| 1116 | Ga0495670_0029280 | |||
| 1117 | Ga0495604_0234734 | |||
| 1118 | Ga0495674_0208655 | |||
| 1119 | Ga0495672_0020249 | |||
| 1120 | Ga0495676_0192269 | |||
| 1121 | Ga0495684_0176042 | |||
| 1122 | Ga0495602_0144639 | |||
| 1123 | Ga0496114_0427179 | |||
| 1124 | Ga0496114_0613483 | |||
| 1125 | Ga0496116_0000004 | |||
| 1126 | Ga0496117_0008160 | |||
| 1127 | Ga0496118_0158513 | |||
| 1128 | Ga0496122_0000643 | |||
| 1129 | Ga0496124_0005999 | |||
| 1130 | Ga0496125_0000012 | |||
| 1131 | Ga0496126_0008650 | |||
| 1132 | Ga0496126_0071166 | |||
| 1133 | Ga0501043_0121447 | |||
| 1134 | Ga0501238_022424 | |||
| 1135 | Ga0501249_011458 | |||
| 1136 | Ga0501249_075235 | |||
| 1137 | Ga0501266_000026 | |||
| 1138 | nmdc:mga0k408_34935_c1 | |||
| 1139 | nmdc:mga0k408_4631_c1 | |||
| 1140 | nmdc:mga05p37_145992_c1 | |||
| 1141 | nmdc:mga05p37_20024_c2 | |||
| 1142 | nmdc:mga09592_153430_c1 | |||
| 1143 | nmdc:mga09592_63781_c1 | |||
| 1144 | nmdc:mga0qj67_30635_c1 | |||
| 1145 | nmdc:mga0qj67_455057_c1 | |||
| 1146 | nmdc:mga06r32_141170_c1 | |||
| 1147 | nmdc:mga06r32_9671_c1 | |||
| 1148 | nmdc:mga08y16_123242_c1 | |||
| 1149 | nmdc:mga08y16_190227_c1 | |||
| 1150 | nmdc:mga08y16_461948_c1 | |||
| 1151 | Ga0495619_0174875 | |||
| 1152 | Ga0500556_0032665 | |||
| 1153 | Ga0500658_0000009 | |||
| 1154 | Ga0500573_0122281 | |||
| 1155 | Ga0500616_0015278 | |||
| 1156 | Ga0500611_000002 | |||
| 1157 | 2586209281 | |||
| 1158 | 2722729852 | |||
| 1159 | 2739590200 | |||
| 1160 | 2819548406 | |||
| 1161 | 2833643423 | |||
| 1162 | 2842723025 | |||
| 1163 | 2842904268 | |||
| 1164 | 2842913981 | |||
| 1165 | 2849283722 | |||
| 1166 | 2904449527 | |||
| 1167 | 2919696557 | |||
| 1168 | 2945999999 | |||
| 1169 | 2954016598 | |||
| 1170 | 2984575702 | |||
| 1171 | 2984609156 | |||
| 1172 | 3003236667 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6fmt-assembly1.cif.gz_A | imisx-ep of hg-baca soaking sad | 0.5268 | 1 | 241 |
| 6fmt-assembly1.cif.gz_A | imisx-ep of hg-baca soaking sad | 0.5202 | 1 | 241 |
| 6cb2-assembly1.cif.gz_A | crystal structure of escherichia coli uppp | 0.5192 | 1 | 241 |
| 6cb2-assembly1.cif.gz_A | crystal structure of escherichia coli uppp | 0.5128 | 1 | 241 |
| 6t1z-assembly1.cif.gz_A | lmrp from l. lactis, in an outward-open conformation, bound to hoechst 33342 | 0.4063 | 33 | 244 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q55EC8_162_384_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4576 | 29 | 243 | 1.20.1250.20 |
| af_Q54E81_92_279_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4508 | 39 | 240 | 1.20.1250.20 |
| af_Q86WB7_254_431_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4322 | 43 | 240 | 1.20.1250.20 |
| af_Q54E81_92_279_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4317 | 39 | 240 | 1.20.1250.20 |
| af_Q86WB7_254_431_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4259 | 43 | 240 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519V1F2-F1-model_v4 | Probable membrane transporter protein | 0.9888 | 3 | 190 |
GO:0005886
|
| AF-A0A3D3PCJ3-F1-model_v4 | Probable membrane transporter protein | 0.9757 | 4 | 244 |
GO:0005886
|
| AF-A0A7J5EEQ8-F1-model_v4 | Probable membrane transporter protein | 0.9711 | 1 | 187 |
GO:0005886
|
| AF-A0A519V1F2-F1-model_v4 | Probable membrane transporter protein | 0.9634 | 3 | 190 |
GO:0005886
|
| AF-A0A3D3PCJ3-F1-model_v4 | Probable membrane transporter protein | 0.96 | 4 | 244 |
GO:0005886
|