F466545

General Info

Members Datasets Scaffolds Average Seq Length
586 256 1172 243

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10003569|Ga0114129_100035697
Length 277
Sequence MSAMEILFYALLFLVAFLYASVGHGGASGYLALMALFNIPVAVMKPTALVLNLFVSLTSFIQFYRGKHFKWKIFLPFALASIPLSFAGGLLSIDGMMYKKILGILLLIPVFRFFFFSKTDVTEFKKSNWALSLLIGGTIGFLSGLIGIGGGIILSPILLMLKWTDQKQTAAISALFIFVNSVAGLFGQLTKGIHFNADMYAYVAVAFTGGLAGAYFGALKFKQVILKNILATALLVASLKLIFTGEKPKLNNKAANPSTSLMIFPDKLDYPGTAPGV

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
70 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
158 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
159 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
160 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
161 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
180 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
184 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
185 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
186 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
187 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
227 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
228 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
237 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
238 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
239 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
240 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
241 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
242 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
243 2739367651 Pedobacter sp. OK291 Isolate Unclassified
244 2818991437 Pedobacter terrae 518 Isolate Unclassified
245 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
246 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
247 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
248 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
249 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
250 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
251 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
252 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
253 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
254 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
255 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
256 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 0
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 1.88
Nodule 0.51
Rhizoplane 0.51
Rhizosphere 93
Stem 0
Stem Tuber 0
Unclassified 16.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10003569 3300009147 Bacteria 21902
2 SwRhRL2b_contig_916033 2162886007 Bacteria 1016
3 rootH2_10295173 3300003320 Bacteria 1063
4 rootL2_10134461 3300003322 Bacteria 1287
5 rootL2_10248561 3300003322 Unclassified 1796
6 Ga0055530_10002378 3300003791 Bacteria 12196
7 Ga0065714_10073048 3300005288 Bacteria 3253
8 Ga0065715_10043676 3300005293 Unclassified 1232
9 Ga0065707_10197600 3300005295 Bacteria 1327
10 Ga0070658_10070169 3300005327 Unclassified 2868
11 Ga0070676_10006346 3300005328 Bacteria 6317
12 Ga0070676_10057970 3300005328 Bacteria 2293
13 Ga0070683_100204187 3300005329 Unclassified 1877
14 Ga0070683_100361554 3300005329 Bacteria 1382
15 Ga0070670_100185565 3300005331 Bacteria 1806
16 Ga0070670_100189784 3300005331 Bacteria 1785
17 Ga0070670_100279427 3300005331 Unclassified 1458
18 Ga0070670_100506257 3300005331 Unclassified 1074
19 Ga0070677_10045810 3300005333 Bacteria 1746
20 Ga0068869_100019418 3300005334 Bacteria 4644
21 Ga0068869_100020425 3300005334 Bacteria 4541
22 Ga0068869_100045019 3300005334 Bacteria 3175
23 Ga0068869_100405420 3300005334 Unclassified 1122
24 Ga0070666_10000050 3300005335 Bacteria 100280
25 Ga0070666_10154321 3300005335 Unclassified 1603
26 Ga0070666_10234158 3300005335 Bacteria 1297
27 Ga0070666_10536510 3300005335 Unclassified 850
28 Ga0070680_100168666 3300005336 Bacteria 1841
29 Ga0070682_100002796 3300005337 Bacteria 9669
30 Ga0070682_100009802 3300005337 Bacteria 5423
31 Ga0070682_100607494 3300005337 Bacteria 865
32 Ga0068868_100003855 3300005338 Bacteria 10469
33 Ga0068868_100759719 3300005338 Bacteria 872
34 Ga0070689_100008890 3300005340 Bacteria 7101
35 Ga0070689_100040492 3300005340 Bacteria 3573
36 Ga0070689_100068440 3300005340 Bacteria 2769
37 Ga0070689_100320133 3300005340 Bacteria 1295
38 Ga0070689_100474039 3300005340 Bacteria 1068
39 Ga0070691_10001334 3300005341 Bacteria 10499
40 Ga0070661_100001199 3300005344 Bacteria 18295
41 Ga0070661_100197800 3300005344 Bacteria 1535
42 Ga0070668_100119220 3300005347 Bacteria 2107
43 Ga0070668_100164516 3300005347 Bacteria 1802
44 Ga0070668_100338896 3300005347 Unclassified 1270
45 Ga0070668_100342551 3300005347 Bacteria 1263
46 Ga0070668_100419645 3300005347 Unclassified 1145
47 Ga0070669_100137279 3300005353 Bacteria 1882
48 Ga0070669_100166432 3300005353 Unclassified 1716
49 Ga0070675_100005613 3300005354 Bacteria 9606
50 Ga0070675_100071662 3300005354 Bacteria 2875
51 Ga0070675_100077798 3300005354 Bacteria 2762
52 Ga0070675_100219146 3300005354 Bacteria 1657
53 Ga0070671_100019435 3300005355 Bacteria 5528
54 Ga0070674_100037295 3300005356 Unclassified 3269
55 Ga0070674_100183238 3300005356 Bacteria 1605
56 Ga0070673_100043512 3300005364 Bacteria 3471
57 Ga0070673_100092033 3300005364 Bacteria 2480
58 Ga0070673_100233601 3300005364 Unclassified 1596
59 Ga0070673_100280769 3300005364 Bacteria 1461
60 Ga0070673_100344835 3300005364 Bacteria 1321
61 Ga0070688_100041523 3300005365 Bacteria 2824
62 Ga0070688_100051239 3300005365 Unclassified 2575
63 Ga0070688_100094014 3300005365 Bacteria 1965
64 Ga0070688_100363963 3300005365 Bacteria 1062
65 Ga0070659_100002681 3300005366 Bacteria 12650
66 Ga0070667_100021876 3300005367 Bacteria 5307
67 Ga0070667_100026929 3300005367 Bacteria 4783
68 Ga0070667_100090788 3300005367 Bacteria 2626
69 Ga0070667_100234997 3300005367 Bacteria 1635
70 Ga0070667_100362186 3300005367 Bacteria 1314
71 Ga0070701_10146605 3300005438 Bacteria 1355
72 Ga0070701_10266789 3300005438 Unclassified 1040
73 Ga0070700_100182923 3300005441 Bacteria 1460
74 Ga0070663_100399469 3300005455 Bacteria 1123
75 Ga0070663_100480737 3300005455 Bacteria 1028
76 Ga0070662_100051494 3300005457 Unclassified 2974
77 Ga0070662_100178219 3300005457 Bacteria 1674
78 Ga0070662_100211480 3300005457 Bacteria 1543
79 Ga0070662_100571026 3300005457 Bacteria 949
80 Ga0068867_100015472 3300005459 Bacteria 5411
81 Ga0068867_100031824 3300005459 Bacteria 3811
82 Ga0068867_100200710 3300005459 Unclassified 1596
83 Ga0070685_10011303 3300005466 Bacteria 4674
84 Ga0070685_10053404 3300005466 Bacteria 2341
85 Ga0070685_10324716 3300005466 Bacteria 1044
86 Ga0070698_100000645 3300005471 Bacteria 37282
87 Ga0070698_100008979 3300005471 Bacteria 10751
88 Ga0070698_100353640 3300005471 Bacteria 1401
89 Ga0070699_100144439 3300005518 Bacteria 2102
90 Ga0070684_100000298 3300005535 Bacteria 34479
91 Ga0070684_100000731 3300005535 Bacteria 22754
92 Ga0070684_100044635 3300005535 Unclassified 3835
93 Ga0070684_100730437 3300005535 Bacteria 924
94 Ga0068853_100003450 3300005539 Bacteria 12095
95 Ga0068853_100066002 3300005539 Bacteria 3142
96 Ga0068853_100234714 3300005539 Bacteria 1679
97 Ga0070672_100027429 3300005543 Bacteria 4247
98 Ga0070672_100036884 3300005543 Bacteria 3728
99 Ga0070672_100095973 3300005543 Bacteria 2398
100 Ga0070672_100209441 3300005543 Bacteria 1632
101 Ga0070672_100282035 3300005543 Bacteria 1405
102 Ga0070672_100345308 3300005543 Unclassified 1268
103 Ga0070665_100027335 3300005548 Bacteria 5747
104 Ga0068855_100039717 3300005563 Bacteria 5586
105 Ga0068855_100063789 3300005563 Bacteria 4298
106 Ga0068855_100680900 3300005563 Bacteria 1102
107 Ga0070664_100000884 3300005564 Bacteria 23265
108 Ga0070664_100073067 3300005564 Unclassified 2942
109 Ga0070664_100123294 3300005564 Unclassified 2271
110 Ga0070664_100142133 3300005564 Bacteria 2114
111 Ga0070664_100164630 3300005564 Unclassified 1964
112 Ga0070664_100167746 3300005564 Bacteria 1946
113 Ga0068857_100001112 3300005577 Bacteria 20920
114 Ga0068857_100094094 3300005577 Unclassified 2683
115 Ga0068854_100031547 3300005578 Bacteria 3684
116 Ga0068854_100272172 3300005578 Bacteria 1360
117 Ga0068856_100034845 3300005614 Bacteria 4932
118 Ga0068856_100336621 3300005614 Bacteria 1527
119 Ga0070702_100042270 3300005615 Unclassified 2561
120 Ga0070702_100278061 3300005615 Bacteria 1148
121 Ga0068852_100003986 3300005616 Bacteria 10377
122 Ga0068852_100075752 3300005616 Bacteria 2969
123 Ga0068852_100454203 3300005616 Bacteria 1269
124 Ga0068859_100000025 3300005617 Bacteria 191679
125 Ga0068859_100069053 3300005617 Bacteria 3568
126 Ga0068859_100158238 3300005617 Bacteria 2344
127 Ga0068859_100215497 3300005617 Bacteria 2007
128 Ga0068859_100218717 3300005617 Bacteria 1992
129 Ga0068859_100239690 3300005617 Bacteria 1902
130 Ga0068859_100253063 3300005617 Bacteria 1852
131 Ga0068859_100364756 3300005617 Unclassified 1540
132 Ga0068864_100004501 3300005618 Bacteria 11462
133 Ga0068864_100012580 3300005618 Bacteria 6996
134 Ga0068864_100057609 3300005618 Bacteria 3357
135 Ga0068864_100209380 3300005618 Unclassified 1795
136 Ga0068864_100288187 3300005618 Bacteria 1534
137 Ga0068866_10042188 3300005718 Bacteria 2269
138 Ga0068861_100002289 3300005719 Bacteria 12425
139 Ga0068861_100069150 3300005719 Bacteria 2731
140 Ga0068861_100128679 3300005719 Bacteria 2052
141 Ga0068861_100191358 3300005719 Bacteria 1710
142 Ga0068861_100256154 3300005719 Bacteria 1496
143 Ga0068870_10066422 3300005840 Bacteria 1953
144 Ga0068870_10068942 3300005840 Unclassified 1923
145 Ga0068870_10435865 3300005840 Bacteria 861
146 Ga0068863_100004643 3300005841 Bacteria 13544
147 Ga0068863_100055607 3300005841 Bacteria 3747
148 Ga0068863_100083324 3300005841 Bacteria 3030
149 Ga0068863_100524596 3300005841 Bacteria 1168
150 Ga0068858_100018416 3300005842 Bacteria 6537
151 Ga0068858_100035184 3300005842 Bacteria 4645
152 Ga0068858_100351600 3300005842 Bacteria 1411
153 Ga0068858_100709999 3300005842 Bacteria 979
154 Ga0068860_100001253 3300005843 Bacteria 27686
155 Ga0068860_100010864 3300005843 Bacteria 8978
156 Ga0068860_100092893 3300005843 Bacteria 2875
157 Ga0068860_100144518 3300005843 Unclassified 2288
158 Ga0068860_100262803 3300005843 Bacteria 1683
159 Ga0068860_100602638 3300005843 Bacteria 1104
160 Ga0068860_100709218 3300005843 Unclassified 1016
161 Ga0068862_100008657 3300005844 Bacteria 8417
162 Ga0068862_100261570 3300005844 Unclassified 1580
163 Ga0068862_100306878 3300005844 Bacteria 1462
164 Ga0068862_100324415 3300005844 Bacteria 1422
165 Ga0075366_10013347 3300006195 Bacteria 4675
166 Ga0097621_100036651 3300006237 Unclassified 3924
167 Ga0097621_100062189 3300006237 Bacteria 3065
168 Ga0097621_100116118 3300006237 Bacteria 2266
169 Ga0097621_100145632 3300006237 Bacteria 2028
170 Ga0097621_100241271 3300006237 Unclassified 1580
171 Ga0068871_100002075 3300006358 Bacteria 13555
172 Ga0068871_100042894 3300006358 Unclassified 3634
173 Ga0075428_100006620 3300006844 Bacteria 12891
174 Ga0075428_100121289 3300006844 Bacteria 2847
175 Ga0075430_100597680 3300006846 Bacteria 910
176 Ga0075431_100000866 3300006847 Bacteria 26579
177 Ga0075431_100226049 3300006847 Bacteria 1908
178 Ga0075431_100407280 3300006847 Bacteria 1360
179 Ga0075434_100122982 3300006871 Unclassified 2611
180 Ga0075429_100006687 3300006880 Bacteria 9994
181 Ga0075429_100009709 3300006880 Bacteria 8341
182 Ga0068865_100004271 3300006881 Bacteria 8620
183 Ga0068865_100173255 3300006881 Bacteria 1656
184 Ga0068865_100317710 3300006881 Bacteria 1251
185 Ga0097620_100000025 3300006931 Bacteria 191679
186 Ga0097620_100069050 3300006931 Bacteria 3568
187 Ga0097620_100158244 3300006931 Bacteria 2344
188 Ga0097620_100215483 3300006931 Bacteria 2007
189 Ga0097620_100218737 3300006931 Bacteria 1992
190 Ga0097620_100239699 3300006931 Bacteria 1902
191 Ga0097620_100253074 3300006931 Bacteria 1852
192 Ga0097620_100301980 3300006931 Bacteria 1694
193 Ga0097620_100364774 3300006931 Unclassified 1540
194 Ga0099824_1006257 3300006942 Bacteria 16412
195 Ga0099826_10030236 3300006948 Bacteria 3937
196 Ga0105244_10147640 3300009036 Bacteria 1128
197 Ga0105240_10364496 3300009093 Unclassified 1636
198 Ga0111539_10095344 3300009094 Bacteria 3495
199 Ga0111539_10124969 3300009094 Bacteria 3015
200 Ga0111539_10177664 3300009094 Bacteria 2487
201 Ga0111539_10246021 3300009094 Bacteria 2082
202 Ga0111539_10536973 3300009094 Bacteria 1362
203 Ga0105247_10005807 3300009101 Bacteria 7719
204 Ga0105247_10186462 3300009101 Unclassified 1387
205 Ga0114129_10001572 3300009147 Bacteria 31003
206 Ga0114129_10093117 3300009147 Bacteria 4175
207 Ga0114129_10527605 3300009147 Bacteria 1539
208 Ga0105243_10000007 3300009148 Bacteria 445042
209 Ga0105243_10685162 3300009148 Bacteria 997
210 Ga0105241_10003958 3300009174 Bacteria 10954
211 Ga0105241_10039119 3300009174 Bacteria 3577
212 Ga0105241_10081764 3300009174 Bacteria 2531
213 Ga0105242_10025664 3300009176 Unclassified 4665
214 Ga0105242_10052608 3300009176 Bacteria 3323
215 Ga0105242_10077674 3300009176 Bacteria 2770
216 Ga0105242_10085056 3300009176 Bacteria 2652
217 Ga0105248_10323054 3300009177 Unclassified 1738
218 Ga0105237_10014702 3300009545 Bacteria 8172
219 Ga0105237_10385929 3300009545 Bacteria 1405
220 Ga0105249_10001240 3300009553 Bacteria 22411
221 Ga0105249_10006762 3300009553 Bacteria 9991
222 Ga0105249_10010036 3300009553 Bacteria 8310
223 Ga0105249_10055960 3300009553 Bacteria 3611
224 Ga0105249_10108254 3300009553 Unclassified 2624
225 Ga0105246_10118181 3300011119 Unclassified 1960
226 Ga0105246_10142077 3300011119 Bacteria 1806
227 Ga0157373_10025044 3300013100 Bacteria 4320
228 Ga0157371_10000119 3300013102 Bacteria 120350
229 Ga0157371_10001988 3300013102 Bacteria 20241
230 Ga0157371_10278929 3300013102 Bacteria 1207
231 Ga0157370_10003284 3300013104 Bacteria 19066
232 Ga0157370_10005524 3300013104 Bacteria 14173
233 Ga0157370_10011855 3300013104 Bacteria 9092
234 Ga0157370_10033654 3300013104 Bacteria 4996
235 Ga0157370_10270778 3300013104 Unclassified 1569
236 Ga0157369_10000015 3300013105 Bacteria 262917
237 Ga0157369_10001151 3300013105 Bacteria 33014
238 Ga0157369_10139551 3300013105 Bacteria 2565
239 Ga0157374_10000955 3300013296 Bacteria 25080
240 Ga0157374_10037758 3300013296 Bacteria 4436
241 Ga0157374_10048274 3300013296 Unclassified 3950
242 Ga0157374_10118437 3300013296 Bacteria 2554
243 Ga0157374_10282089 3300013296 Bacteria 1640
244 Ga0157374_10398571 3300013296 Bacteria 1373
245 Ga0157378_10026297 3300013297 Bacteria 5130
246 Ga0157378_10028270 3300013297 Bacteria 4945
247 Ga0157378_10076764 3300013297 Bacteria 3011
248 Ga0157378_10246342 3300013297 Bacteria 1709
249 Ga0163162_10000344 3300013306 Bacteria 42218
250 Ga0163162_10000520 3300013306 Bacteria 35697
251 Ga0163162_10029655 3300013306 Bacteria 5416
252 Ga0163162_10042164 3300013306 Bacteria 4566
253 Ga0163162_10088421 3300013306 Unclassified 3177
254 Ga0163162_10128685 3300013306 Bacteria 2640
255 Ga0163162_10748766 3300013306 Unclassified 1096
256 Ga0163162_10906655 3300013306 Bacteria 994
257 Ga0157372_10053750 3300013307 Bacteria 4491
258 Ga0157372_10206085 3300013307 Bacteria 2279
259 Ga0157372_10396141 3300013307 Bacteria 1609
260 Ga0157372_10450640 3300013307 Bacteria 1500
261 Ga0157375_10002578 3300013308 Bacteria 15745
262 Ga0157375_10059161 3300013308 Bacteria 3795
263 Ga0157375_10154078 3300013308 Bacteria 2436
264 Ga0157375_10283354 3300013308 Bacteria 1820
265 Ga0157375_10349638 3300013308 Bacteria 1644
266 Ga0157375_10666797 3300013308 Bacteria 1195
267 Ga0157375_11190280 3300013308 Unclassified 894
268 Ga0163163_10000075 3300014325 Bacteria 109545
269 Ga0163163_10003651 3300014325 Bacteria 13084
270 Ga0163163_10112665 3300014325 Bacteria 2750
271 Ga0163163_10468591 3300014325 Bacteria 1320
272 Ga0163163_10568365 3300014325 Bacteria 1197
273 Ga0163163_10924716 3300014325 Bacteria 935
274 Ga0157380_10003006 3300014326 Bacteria 11479
275 Ga0157380_10024955 3300014326 Bacteria 4529
276 Ga0157380_10109338 3300014326 Unclassified 2319
277 Ga0157380_10365077 3300014326 Bacteria 1356
278 Ga0157380_10812686 3300014326 Bacteria 953
279 Ga0182008_10228894 3300014497 Bacteria 953
280 Ga0182008_10238826 3300014497 Bacteria 934
281 Ga0157377_10058698 3300014745 Unclassified 2191
282 Ga0157377_10230051 3300014745 Bacteria 1191
283 Ga0157377_10526978 3300014745 Bacteria 830
284 Ga0157379_10040212 3300014968 Bacteria 4172
285 Ga0157379_10119098 3300014968 Bacteria 2375
286 Ga0157379_10197689 3300014968 Bacteria 1817
287 Ga0157379_10337604 3300014968 Bacteria 1378
288 Ga0157376_10018590 3300014969 Bacteria 5333
289 Ga0157376_10127726 3300014969 Bacteria 2264
290 Ga0157376_10262818 3300014969 Bacteria 1618
291 Ga0157376_10394252 3300014969 Bacteria 1337
292 Ga0157376_10451444 3300014969 Bacteria 1254
293 Ga0182006_1000091 3300015261 Bacteria 109227
294 Ga0182006_1000957 3300015261 Bacteria 19179
295 Ga0182006_1009862 3300015261 Bacteria 4270
296 Ga0182006_1020693 3300015261 Unclassified 2753
297 Ga0182006_1027039 3300015261 Bacteria 2345
298 Ga0182007_10000010 3300015262 Bacteria 286070
299 Ga0182007_10079022 3300015262 Bacteria 1079
300 Ga0183373_1003 3300015682 Bacteria 558813
301 Ga0163161_10000046 3300017792 Bacteria 127211
302 Ga0163161_10000524 3300017792 Bacteria 31293
303 Ga0163161_10065492 3300017792 Bacteria 2652
304 Ga0163161_10166360 3300017792 Bacteria 1684
305 Ga0163161_10579718 3300017792 Unclassified 923
306 Ga0213874_10067769 3300021377 Bacteria 1132
307 Ga0209676_1000001 3300025292 Bacteria 1852142
308 Ga0209050_1000258 3300025298 Bacteria 113741
309 Ga0207656_10008263 3300025321 Bacteria 3822
310 Ga0207656_10139143 3300025321 Bacteria 1143
311 Ga0207642_10160397 3300025899 Bacteria 1207
312 Ga0207710_10000852 3300025900 Bacteria 16442
313 Ga0207710_10011865 3300025900 Bacteria 3666
314 Ga0207680_10000086 3300025903 Bacteria 42622
315 Ga0207645_10003860 3300025907 Bacteria 11217
316 Ga0207645_10005381 3300025907 Bacteria 9293
317 Ga0207643_10004125 3300025908 Bacteria 7826
318 Ga0207643_10013440 3300025908 Bacteria 4434
319 Ga0207705_10060161 3300025909 Unclassified 2743
320 Ga0207654_10004379 3300025911 Bacteria 7116
321 Ga0207654_10325428 3300025911 Bacteria 1052
322 Ga0207671_10014756 3300025914 Bacteria 6159
323 Ga0207660_10003834 3300025917 Bacteria 9803
324 Ga0207662_10119676 3300025918 Unclassified 1650
325 Ga0207662_10340387 3300025918 Unclassified 1005
326 Ga0207657_10039267 3300025919 Bacteria 4209
327 Ga0207649_10005426 3300025920 Bacteria 6902
328 Ga0207681_10050307 3300025923 Unclassified 2819
329 Ga0207681_10051508 3300025923 Bacteria 2790
330 Ga0207681_10235295 3300025923 Bacteria 1423
331 Ga0207650_10022251 3300025925 Unclassified 4485
332 Ga0207650_10095305 3300025925 Bacteria 2281
333 Ga0207650_10245133 3300025925 Bacteria 1449
334 Ga0207659_10014568 3300025926 Bacteria 5076
335 Ga0207659_10170473 3300025926 Unclassified 1717
336 Ga0207659_10231065 3300025926 Bacteria 1492
337 Ga0207659_10248748 3300025926 Bacteria 1442
338 Ga0207644_10129273 3300025931 Bacteria 1932
339 Ga0207644_10284844 3300025931 Bacteria 1328
340 Ga0207690_10088001 3300025932 Bacteria 2187
341 Ga0207706_10027723 3300025933 Bacteria 5064
342 Ga0207706_10055015 3300025933 Bacteria 3511
343 Ga0207686_10063626 3300025934 Bacteria 2347
344 Ga0207709_10000049 3300025935 Bacteria 237124
345 Ga0207670_10018985 3300025936 Bacteria 4191
346 Ga0207670_10062831 3300025936 Bacteria 2539
347 Ga0207670_10154888 3300025936 Bacteria 1704
348 Ga0207670_10232503 3300025936 Bacteria 1416
349 Ga0207669_10029366 3300025937 Bacteria 3040
350 Ga0207669_10192922 3300025937 Unclassified 1471
351 Ga0207704_10140745 3300025938 Bacteria 1687
352 Ga0207704_10339899 3300025938 Bacteria 1165
353 Ga0207704_10673350 3300025938 Unclassified 854
354 Ga0207691_10009095 3300025940 Bacteria 9534
355 Ga0207691_10030538 3300025940 Bacteria 5035
356 Ga0207691_10054732 3300025940 Bacteria 3639
357 Ga0207691_10076270 3300025940 Bacteria 3021
358 Ga0207691_10206809 3300025940 Bacteria 1706
359 Ga0207711_10248045 3300025941 Unclassified 1634
360 Ga0207711_10592806 3300025941 Unclassified 1034
361 Ga0207689_10003687 3300025942 Bacteria 13959
362 Ga0207689_10015930 3300025942 Bacteria 6365
363 Ga0207689_10021969 3300025942 Bacteria 5365
364 Ga0207689_10022578 3300025942 Bacteria 5288
365 Ga0207689_10030997 3300025942 Unclassified 4455
366 Ga0207689_10053617 3300025942 Bacteria 3322
367 Ga0207689_10063806 3300025942 Unclassified 3031
368 Ga0207689_10215348 3300025942 Unclassified 1587
369 Ga0207661_10000738 3300025944 Bacteria 21229
370 Ga0207661_10134380 3300025944 Bacteria 2123
371 Ga0207661_10806490 3300025944 Bacteria 864
372 Ga0207679_10000902 3300025945 Bacteria 18967
373 Ga0207679_10118525 3300025945 Unclassified 2103
374 Ga0207651_10031755 3300025960 Bacteria 3381
375 Ga0207651_10046016 3300025960 Unclassified 2931
376 Ga0207651_10085259 3300025960 Bacteria 2291
377 Ga0207651_10140712 3300025960 Bacteria 1863
378 Ga0207651_10240782 3300025960 Bacteria 1474
379 Ga0207651_10242813 3300025960 Bacteria 1469
380 Ga0207651_10402542 3300025960 Bacteria 1165
381 Ga0207712_10003644 3300025961 Bacteria 9703
382 Ga0207712_10004435 3300025961 Bacteria 8865
383 Ga0207712_10026024 3300025961 Bacteria 3894
384 Ga0207712_10092555 3300025961 Bacteria 2229
385 Ga0207712_10212793 3300025961 Bacteria 1541
386 Ga0207668_10025492 3300025972 Unclassified 3828
387 Ga0207668_10244561 3300025972 Bacteria 1453
388 Ga0207668_10599625 3300025972 Unclassified 959
389 Ga0207658_10007791 3300025986 Bacteria 7294
390 Ga0207658_10139245 3300025986 Bacteria 1961
391 Ga0207658_10158804 3300025986 Unclassified 1851
392 Ga0207658_10213616 3300025986 Unclassified 1618
393 Ga0207658_10295179 3300025986 Bacteria 1394
394 Ga0207658_10574199 3300025986 Bacteria 1011
395 Ga0207677_10015160 3300026023 Unclassified 4524
396 Ga0207677_10035761 3300026023 Bacteria 3229
397 Ga0207677_10080673 3300026023 Bacteria 2332
398 Ga0207677_10094807 3300026023 Bacteria 2179
399 Ga0207677_10154854 3300026023 Bacteria 1773
400 Ga0207677_10401044 3300026023 Unclassified 1163
401 Ga0207677_10814595 3300026023 Bacteria 837
402 Ga0207703_10010342 3300026035 Bacteria 7304
403 Ga0207703_10190877 3300026035 Bacteria 1814
404 Ga0207639_10021442 3300026041 Bacteria 4641
405 Ga0207639_10096718 3300026041 Bacteria 2376
406 Ga0207639_10224744 3300026041 Bacteria 1624
407 Ga0207639_10273882 3300026041 Bacteria 1482
408 Ga0207678_10200488 3300026067 Bacteria 1706
409 Ga0207678_10548129 3300026067 Bacteria 1011
410 Ga0207702_10176909 3300026078 Bacteria 1961
411 Ga0207641_10000380 3300026088 Bacteria 52801
412 Ga0207641_10000661 3300026088 Bacteria 37590
413 Ga0207641_10025398 3300026088 Bacteria 4885
414 Ga0207641_10030996 3300026088 Bacteria 4433
415 Ga0207641_10048141 3300026088 Bacteria 3597
416 Ga0207641_10098470 3300026088 Bacteria 2571
417 Ga0207641_10509108 3300026088 Bacteria 1170
418 Ga0207648_10003599 3300026089 Bacteria 16209
419 Ga0207648_10012445 3300026089 Bacteria 7966
420 Ga0207648_10015417 3300026089 Bacteria 7031
421 Ga0207648_10106191 3300026089 Bacteria 2464
422 Ga0207648_10110130 3300026089 Unclassified 2418
423 Ga0207648_10505465 3300026089 Bacteria 1106
424 Ga0207676_10009979 3300026095 Bacteria 6756
425 Ga0207676_10033373 3300026095 Bacteria 3888
426 Ga0207676_10133718 3300026095 Unclassified 2113
427 Ga0207674_10003262 3300026116 Bacteria 19959
428 Ga0207674_10050878 3300026116 Unclassified 4230
429 Ga0207674_10233105 3300026116 Bacteria 1789
430 Ga0207674_10233249 3300026116 Unclassified 1788
431 Ga0207674_10542551 3300026116 Unclassified 1123
432 Ga0207675_100002458 3300026118 Bacteria 18348
433 Ga0207675_100018725 3300026118 Bacteria 6463
434 Ga0207675_100041774 3300026118 Unclassified 4281
435 Ga0207675_100262827 3300026118 Bacteria 1673
436 Ga0207675_100429269 3300026118 Bacteria 1306
437 Ga0207683_10003509 3300026121 Bacteria 13675
438 Ga0207683_10049417 3300026121 Bacteria 3682
439 Ga0207698_10002995 3300026142 Bacteria 10135
440 Ga0207698_10046073 3300026142 Bacteria 3290
441 Ga0207698_10210347 3300026142 Unclassified 1749
442 Ga0209968_1011867 3300027526 Bacteria 1354
443 Ga0209282_1023473 3300027666 Bacteria 3877
444 Ga0268266_10064584 3300028379 Unclassified 3163
445 Ga0268266_10160973 3300028379 Bacteria 2030
446 Ga0268266_10323502 3300028379 Bacteria 1444
447 Ga0268265_10005161 3300028380 Bacteria 8945
448 Ga0268264_10002545 3300028381 Bacteria 15994
449 Ga0268264_10080368 3300028381 Bacteria 2784
450 Ga0268264_10122469 3300028381 Unclassified 2294
451 Ga0268264_10349691 3300028381 Bacteria 1406
452 Ga0265334_10003361 3300028573 Bacteria 7298
453 Ga0307515_10009312 3300028794 Bacteria 19000
454 Ga0265338_10015045 3300028800 Bacteria 8540
455 Ga0265338_10378291 3300028800 Bacteria 1013
456 Ga0316177_1113690 3300030731 Bacteria 4373
457 Ga0316176_1047226 3300030732 Bacteria 14320
458 Ga0316183_1086246 3300030742 Bacteria 40321
459 Ga0316181_1058577 3300030744 Bacteria 14287
460 Ga0316182_1223135 3300030745 Bacteria 1524
461 Ga0265327_10000819 3300031251 Bacteria 46924
462 Ga0265327_10006440 3300031251 Bacteria 9383
463 Ga0307513_10134888 3300031456 Bacteria 2406
464 Ga0316576_10300097 3300031727 Bacteria 1201
465 Ga0307405_10000049 3300031731 Bacteria 66592
466 Ga0307413_10002048 3300031824 Bacteria 8039
467 Ga0307407_10000024 3300031903 Bacteria 113716
468 Ga0307412_10182492 3300031911 Bacteria 1580
469 Ga0307416_100000037 3300032002 Bacteria 137513
470 Ga0307416_100006959 3300032002 Bacteria 7132
471 Ga0307414_10001034 3300032004 Bacteria 14217
472 Ga0307414_10004809 3300032004 Bacteria 7371
473 Ga0307414_10006990 3300032004 Bacteria 6326
474 Ga0307414_10014942 3300032004 Bacteria 4674
475 Ga0307414_10034778 3300032004 Bacteria 3346
476 Ga0307414_10068525 3300032004 Bacteria 2546
477 Ga0307414_10091226 3300032004 Unclassified 2264
478 Ga0307414_10189672 3300032004 Bacteria 1662
479 Ga0307414_10212078 3300032004 Bacteria 1583
480 Ga0307411_10000012 3300032005 Bacteria 161467
481 Ga0373930_0011000 3300034816 Bacteria 1627
482 Ga0373955_0156004 3300035172 Unclassified 1345
483 Ga0373962_0106226 3300035242 Unclassified 881
484 Ga0316574_0062061 3300035398 Bacteria 2348
485 Ga0373937_0011902 3300036401 Bacteria 7636
486 Ga0373937_0091931 3300036401 Bacteria 2812
487 Ga0373937_0104510 3300036401 Bacteria 2631
488 Ga0373937_0127322 3300036401 Unclassified 2377
489 Ga0373925_0088452 3300037068 Bacteria 2366
490 Ga0436363_0242255 3300039450 Bacteria 862
491 Ga0439439_0089016 3300041406 Unclassified 841
492 Ga0439447_000165 3300041407 Bacteria 22643
493 Ga0439466_0002676 3300041411 Bacteria 6965
494 Ga0439465_0008949 3300041413 Bacteria 3155
495 Ga0451802_1277840 3300041460 Bacteria 881
496 Ga0451843_0161377 3300041509 Bacteria 1001
497 Ga0439449_0013962 3300042007 Bacteria 3021
498 Ga0439449_0014815 3300042007 Bacteria 2930
499 Ga0439457_000827 3300042014 Bacteria 9289
500 Ga0439446_0038219 3300042156 Bacteria 1407
501 Ga0451577_0003838 3300042876 Bacteria 16343
502 Ga0453684_0000676 3300044712 Bacteria 122215
503 Ga0453684_0183994 3300044712 Unclassified 2450
504 Ga0451576_0000083 3300045051 Bacteria 236908
505 Ga0451576_0252743 3300045051 Unclassified 1842
506 Ga0451576_0434918 3300045051 Bacteria 1377
507 Ga0451576_0672238 3300045051 Unclassified 1088
508 Ga0495627_002629 3300046453 Bacteria 8446
509 Ga0495629_0294425 3300046459 Bacteria 1112
510 Ga0495638_0069041 3300046460 Unclassified 2166
511 Ga0495664_0306898 3300046477 Unclassified 958
512 Ga0495608_0390618 3300046511 Bacteria 852
513 Ga0495610_0000045 3300046512 Bacteria 155304
514 Ga0495610_0001236 3300046512 Bacteria 22946
515 Ga0495618_0136374 3300046514 Bacteria 1570
516 Ga0495630_0089950 3300046517 Bacteria 2319
517 Ga0495587_0116277 3300046536 Bacteria 1534
518 Ga0495587_0294948 3300046536 Bacteria 907
519 Ga0495598_0027923 3300046537 Bacteria 1561
520 Ga0495621_0024492 3300046539 Unclassified 2017
521 Ga0495645_0351407 3300046543 Bacteria 950
522 Ga0495633_0097967 3300046558 Bacteria 1362
523 Ga0495668_0000489 3300046616 Bacteria 49613
524 Ga0495668_0005239 3300046616 Bacteria 8883
525 Ga0495634_0252229 3300046642 Bacteria 1079
526 Ga0495611_0019676 3300046648 Unclassified 2901
527 Ga0495635_0098575 3300046663 Bacteria 1998
528 Ga0495657_0212660 3300046675 Bacteria 1175
529 Ga0495658_0015643 3300046683 Bacteria 3893
530 Ga0495670_0029280 3300046691 Bacteria 2733
531 Ga0495604_0234734 3300047317 Bacteria 1257
532 Ga0495674_0208655 3300047319 Bacteria 1619
533 Ga0495672_0020249 3300047320 Unclassified 4365
534 Ga0495676_0192269 3300047321 Bacteria 1423
535 Ga0495684_0176042 3300047471 Bacteria 1588
536 Ga0495602_0144639 3300048088 Bacteria 1878
537 Ga0496114_0427179 3300048917 Unclassified 1174
538 Ga0496114_0613483 3300048917 Bacteria 959
539 Ga0496116_0000004 3300048919 Bacteria 839841
540 Ga0496117_0008160 3300048920 Bacteria 10001
541 Ga0496118_0158513 3300048921 Bacteria 1404
542 Ga0496122_0000643 3300048925 Bacteria 70960
543 Ga0496124_0005999 3300048927 Bacteria 13400
544 Ga0496125_0000012 3300048928 Bacteria 651142
545 Ga0496126_0008650 3300048929 Bacteria 10939
546 Ga0496126_0071166 3300048929 Bacteria 3097
547 Ga0501043_0121447 3300049579 Bacteria 2049
548 Ga0501238_022424 3300049671 Unclassified 897
549 Ga0501249_011458 3300049679 Bacteria 1861
550 Ga0501249_075235 3300049679 Bacteria 791
551 Ga0501266_000026 3300049763 Bacteria 56690
552 nmdc:mga0k408_34935_c1 3300050493 Bacteria 2880
553 nmdc:mga0k408_4631_c1 3300050493 Bacteria 7285
554 nmdc:mga05p37_145992_c1 3300050507 Bacteria 2897
555 nmdc:mga05p37_20024_c2 3300050507 Bacteria 7172
556 nmdc:mga09592_153430_c1 3300050508 Bacteria 1988
557 nmdc:mga09592_63781_c1 3300050508 Bacteria 3119
558 nmdc:mga0qj67_30635_c1 3300050509 Bacteria 4189
559 nmdc:mga0qj67_455057_c1 3300050509 Bacteria 1031
560 nmdc:mga06r32_141170_c1 3300050510 Bacteria 2385
561 nmdc:mga06r32_9671_c1 3300050510 Bacteria 8709
562 nmdc:mga08y16_123242_c1 3300050511 Bacteria 2697
563 nmdc:mga08y16_190227_c1 3300050511 Bacteria 2129
564 nmdc:mga08y16_461948_c1 3300050511 Bacteria 1294
565 Ga0495619_0174875 3300053085 Bacteria 1485
566 Ga0500556_0032665 3300053104 Unclassified 1780
567 Ga0500658_0000009 3300053134 Bacteria 270303
568 Ga0500573_0122281 3300053140 Bacteria 1448
569 Ga0500616_0015278 3300053153 Bacteria 4394
570 Ga0500611_000002 3300053727 Bacteria 345991
571 2586209281 2585427687 Bacteria 5544917
572 2722729852 2721755487 Bacteria 6357185
573 2739590200 2739367651 Bacteria 6359826
574 2819548406 2818991437 Bacteria 5805520
575 2833643423 2833640130 Bacteria 4858325
576 2842723025 2842722452 Bacteria 6263924
577 2842904268 2842903701 Bacteria 6986368
578 2842913981 2842909656 Bacteria 6185908
579 2849283722 2849281842 Bacteria 6065644
580 2904449527 2904445276 Bacteria 5310396
581 2919696557 2919692658 Bacteria 5943958
582 2945999999 2945997725 Bacteria 6404843
583 2954016598 2954016120 Bacteria 6446024
584 2984575702 2984572630 Bacteria 4186940
585 2984609156 2984606641 Bacteria 4186971
586 3003236667 3003233435 Bacteria 4458031
587 Ga0114129_10003569
588 SwRhRL2b_contig_916033
589 rootH2_10295173
590 rootL2_10134461
591 rootL2_10248561
592 Ga0055530_10002378
593 Ga0065714_10073048
594 Ga0065715_10043676
595 Ga0065707_10197600
596 Ga0070658_10070169
597 Ga0070676_10006346
598 Ga0070676_10057970
599 Ga0070683_100204187
600 Ga0070683_100361554
601 Ga0070670_100185565
602 Ga0070670_100189784
603 Ga0070670_100279427
604 Ga0070670_100506257
605 Ga0070677_10045810
606 Ga0068869_100019418
607 Ga0068869_100020425
608 Ga0068869_100045019
609 Ga0068869_100405420
610 Ga0070666_10000050
611 Ga0070666_10154321
612 Ga0070666_10234158
613 Ga0070666_10536510
614 Ga0070680_100168666
615 Ga0070682_100002796
616 Ga0070682_100009802
617 Ga0070682_100607494
618 Ga0068868_100003855
619 Ga0068868_100759719
620 Ga0070689_100008890
621 Ga0070689_100040492
622 Ga0070689_100068440
623 Ga0070689_100320133
624 Ga0070689_100474039
625 Ga0070691_10001334
626 Ga0070661_100001199
627 Ga0070661_100197800
628 Ga0070668_100119220
629 Ga0070668_100164516
630 Ga0070668_100338896
631 Ga0070668_100342551
632 Ga0070668_100419645
633 Ga0070669_100137279
634 Ga0070669_100166432
635 Ga0070675_100005613
636 Ga0070675_100071662
637 Ga0070675_100077798
638 Ga0070675_100219146
639 Ga0070671_100019435
640 Ga0070674_100037295
641 Ga0070674_100183238
642 Ga0070673_100043512
643 Ga0070673_100092033
644 Ga0070673_100233601
645 Ga0070673_100280769
646 Ga0070673_100344835
647 Ga0070688_100041523
648 Ga0070688_100051239
649 Ga0070688_100094014
650 Ga0070688_100363963
651 Ga0070659_100002681
652 Ga0070667_100021876
653 Ga0070667_100026929
654 Ga0070667_100090788
655 Ga0070667_100234997
656 Ga0070667_100362186
657 Ga0070701_10146605
658 Ga0070701_10266789
659 Ga0070700_100182923
660 Ga0070663_100399469
661 Ga0070663_100480737
662 Ga0070662_100051494
663 Ga0070662_100178219
664 Ga0070662_100211480
665 Ga0070662_100571026
666 Ga0068867_100015472
667 Ga0068867_100031824
668 Ga0068867_100200710
669 Ga0070685_10011303
670 Ga0070685_10053404
671 Ga0070685_10324716
672 Ga0070698_100000645
673 Ga0070698_100008979
674 Ga0070698_100353640
675 Ga0070699_100144439
676 Ga0070684_100000298
677 Ga0070684_100000731
678 Ga0070684_100044635
679 Ga0070684_100730437
680 Ga0068853_100003450
681 Ga0068853_100066002
682 Ga0068853_100234714
683 Ga0070672_100027429
684 Ga0070672_100036884
685 Ga0070672_100095973
686 Ga0070672_100209441
687 Ga0070672_100282035
688 Ga0070672_100345308
689 Ga0070665_100027335
690 Ga0068855_100039717
691 Ga0068855_100063789
692 Ga0068855_100680900
693 Ga0070664_100000884
694 Ga0070664_100073067
695 Ga0070664_100123294
696 Ga0070664_100142133
697 Ga0070664_100164630
698 Ga0070664_100167746
699 Ga0068857_100001112
700 Ga0068857_100094094
701 Ga0068854_100031547
702 Ga0068854_100272172
703 Ga0068856_100034845
704 Ga0068856_100336621
705 Ga0070702_100042270
706 Ga0070702_100278061
707 Ga0068852_100003986
708 Ga0068852_100075752
709 Ga0068852_100454203
710 Ga0068859_100000025
711 Ga0068859_100069053
712 Ga0068859_100158238
713 Ga0068859_100215497
714 Ga0068859_100218717
715 Ga0068859_100239690
716 Ga0068859_100253063
717 Ga0068859_100364756
718 Ga0068864_100004501
719 Ga0068864_100012580
720 Ga0068864_100057609
721 Ga0068864_100209380
722 Ga0068864_100288187
723 Ga0068866_10042188
724 Ga0068861_100002289
725 Ga0068861_100069150
726 Ga0068861_100128679
727 Ga0068861_100191358
728 Ga0068861_100256154
729 Ga0068870_10066422
730 Ga0068870_10068942
731 Ga0068870_10435865
732 Ga0068863_100004643
733 Ga0068863_100055607
734 Ga0068863_100083324
735 Ga0068863_100524596
736 Ga0068858_100018416
737 Ga0068858_100035184
738 Ga0068858_100351600
739 Ga0068858_100709999
740 Ga0068860_100001253
741 Ga0068860_100010864
742 Ga0068860_100092893
743 Ga0068860_100144518
744 Ga0068860_100262803
745 Ga0068860_100602638
746 Ga0068860_100709218
747 Ga0068862_100008657
748 Ga0068862_100261570
749 Ga0068862_100306878
750 Ga0068862_100324415
751 Ga0075366_10013347
752 Ga0097621_100036651
753 Ga0097621_100062189
754 Ga0097621_100116118
755 Ga0097621_100145632
756 Ga0097621_100241271
757 Ga0068871_100002075
758 Ga0068871_100042894
759 Ga0075428_100006620
760 Ga0075428_100121289
761 Ga0075430_100597680
762 Ga0075431_100000866
763 Ga0075431_100226049
764 Ga0075431_100407280
765 Ga0075434_100122982
766 Ga0075429_100006687
767 Ga0075429_100009709
768 Ga0068865_100004271
769 Ga0068865_100173255
770 Ga0068865_100317710
771 Ga0097620_100000025
772 Ga0097620_100069050
773 Ga0097620_100158244
774 Ga0097620_100215483
775 Ga0097620_100218737
776 Ga0097620_100239699
777 Ga0097620_100253074
778 Ga0097620_100301980
779 Ga0097620_100364774
780 Ga0099824_1006257
781 Ga0099826_10030236
782 Ga0105244_10147640
783 Ga0105240_10364496
784 Ga0111539_10095344
785 Ga0111539_10124969
786 Ga0111539_10177664
787 Ga0111539_10246021
788 Ga0111539_10536973
789 Ga0105247_10005807
790 Ga0105247_10186462
791 Ga0114129_10001572
792 Ga0114129_10093117
793 Ga0114129_10527605
794 Ga0105243_10000007
795 Ga0105243_10685162
796 Ga0105241_10003958
797 Ga0105241_10039119
798 Ga0105241_10081764
799 Ga0105242_10025664
800 Ga0105242_10052608
801 Ga0105242_10077674
802 Ga0105242_10085056
803 Ga0105248_10323054
804 Ga0105237_10014702
805 Ga0105237_10385929
806 Ga0105249_10001240
807 Ga0105249_10006762
808 Ga0105249_10010036
809 Ga0105249_10055960
810 Ga0105249_10108254
811 Ga0105246_10118181
812 Ga0105246_10142077
813 Ga0157373_10025044
814 Ga0157371_10000119
815 Ga0157371_10001988
816 Ga0157371_10278929
817 Ga0157370_10003284
818 Ga0157370_10005524
819 Ga0157370_10011855
820 Ga0157370_10033654
821 Ga0157370_10270778
822 Ga0157369_10000015
823 Ga0157369_10001151
824 Ga0157369_10139551
825 Ga0157374_10000955
826 Ga0157374_10037758
827 Ga0157374_10048274
828 Ga0157374_10118437
829 Ga0157374_10282089
830 Ga0157374_10398571
831 Ga0157378_10026297
832 Ga0157378_10028270
833 Ga0157378_10076764
834 Ga0157378_10246342
835 Ga0163162_10000344
836 Ga0163162_10000520
837 Ga0163162_10029655
838 Ga0163162_10042164
839 Ga0163162_10088421
840 Ga0163162_10128685
841 Ga0163162_10748766
842 Ga0163162_10906655
843 Ga0157372_10053750
844 Ga0157372_10206085
845 Ga0157372_10396141
846 Ga0157372_10450640
847 Ga0157375_10002578
848 Ga0157375_10059161
849 Ga0157375_10154078
850 Ga0157375_10283354
851 Ga0157375_10349638
852 Ga0157375_10666797
853 Ga0157375_11190280
854 Ga0163163_10000075
855 Ga0163163_10003651
856 Ga0163163_10112665
857 Ga0163163_10468591
858 Ga0163163_10568365
859 Ga0163163_10924716
860 Ga0157380_10003006
861 Ga0157380_10024955
862 Ga0157380_10109338
863 Ga0157380_10365077
864 Ga0157380_10812686
865 Ga0182008_10228894
866 Ga0182008_10238826
867 Ga0157377_10058698
868 Ga0157377_10230051
869 Ga0157377_10526978
870 Ga0157379_10040212
871 Ga0157379_10119098
872 Ga0157379_10197689
873 Ga0157379_10337604
874 Ga0157376_10018590
875 Ga0157376_10127726
876 Ga0157376_10262818
877 Ga0157376_10394252
878 Ga0157376_10451444
879 Ga0182006_1000091
880 Ga0182006_1000957
881 Ga0182006_1009862
882 Ga0182006_1020693
883 Ga0182006_1027039
884 Ga0182007_10000010
885 Ga0182007_10079022
886 Ga0183373_1003
887 Ga0163161_10000046
888 Ga0163161_10000524
889 Ga0163161_10065492
890 Ga0163161_10166360
891 Ga0163161_10579718
892 Ga0213874_10067769
893 Ga0209676_1000001
894 Ga0209050_1000258
895 Ga0207656_10008263
896 Ga0207656_10139143
897 Ga0207642_10160397
898 Ga0207710_10000852
899 Ga0207710_10011865
900 Ga0207680_10000086
901 Ga0207645_10003860
902 Ga0207645_10005381
903 Ga0207643_10004125
904 Ga0207643_10013440
905 Ga0207705_10060161
906 Ga0207654_10004379
907 Ga0207654_10325428
908 Ga0207671_10014756
909 Ga0207660_10003834
910 Ga0207662_10119676
911 Ga0207662_10340387
912 Ga0207657_10039267
913 Ga0207649_10005426
914 Ga0207681_10050307
915 Ga0207681_10051508
916 Ga0207681_10235295
917 Ga0207650_10022251
918 Ga0207650_10095305
919 Ga0207650_10245133
920 Ga0207659_10014568
921 Ga0207659_10170473
922 Ga0207659_10231065
923 Ga0207659_10248748
924 Ga0207644_10129273
925 Ga0207644_10284844
926 Ga0207690_10088001
927 Ga0207706_10027723
928 Ga0207706_10055015
929 Ga0207686_10063626
930 Ga0207709_10000049
931 Ga0207670_10018985
932 Ga0207670_10062831
933 Ga0207670_10154888
934 Ga0207670_10232503
935 Ga0207669_10029366
936 Ga0207669_10192922
937 Ga0207704_10140745
938 Ga0207704_10339899
939 Ga0207704_10673350
940 Ga0207691_10009095
941 Ga0207691_10030538
942 Ga0207691_10054732
943 Ga0207691_10076270
944 Ga0207691_10206809
945 Ga0207711_10248045
946 Ga0207711_10592806
947 Ga0207689_10003687
948 Ga0207689_10015930
949 Ga0207689_10021969
950 Ga0207689_10022578
951 Ga0207689_10030997
952 Ga0207689_10053617
953 Ga0207689_10063806
954 Ga0207689_10215348
955 Ga0207661_10000738
956 Ga0207661_10134380
957 Ga0207661_10806490
958 Ga0207679_10000902
959 Ga0207679_10118525
960 Ga0207651_10031755
961 Ga0207651_10046016
962 Ga0207651_10085259
963 Ga0207651_10140712
964 Ga0207651_10240782
965 Ga0207651_10242813
966 Ga0207651_10402542
967 Ga0207712_10003644
968 Ga0207712_10004435
969 Ga0207712_10026024
970 Ga0207712_10092555
971 Ga0207712_10212793
972 Ga0207668_10025492
973 Ga0207668_10244561
974 Ga0207668_10599625
975 Ga0207658_10007791
976 Ga0207658_10139245
977 Ga0207658_10158804
978 Ga0207658_10213616
979 Ga0207658_10295179
980 Ga0207658_10574199
981 Ga0207677_10015160
982 Ga0207677_10035761
983 Ga0207677_10080673
984 Ga0207677_10094807
985 Ga0207677_10154854
986 Ga0207677_10401044
987 Ga0207677_10814595
988 Ga0207703_10010342
989 Ga0207703_10190877
990 Ga0207639_10021442
991 Ga0207639_10096718
992 Ga0207639_10224744
993 Ga0207639_10273882
994 Ga0207678_10200488
995 Ga0207678_10548129
996 Ga0207702_10176909
997 Ga0207641_10000380
998 Ga0207641_10000661
999 Ga0207641_10025398
1000 Ga0207641_10030996
1001 Ga0207641_10048141
1002 Ga0207641_10098470
1003 Ga0207641_10509108
1004 Ga0207648_10003599
1005 Ga0207648_10012445
1006 Ga0207648_10015417
1007 Ga0207648_10106191
1008 Ga0207648_10110130
1009 Ga0207648_10505465
1010 Ga0207676_10009979
1011 Ga0207676_10033373
1012 Ga0207676_10133718
1013 Ga0207674_10003262
1014 Ga0207674_10050878
1015 Ga0207674_10233105
1016 Ga0207674_10233249
1017 Ga0207674_10542551
1018 Ga0207675_100002458
1019 Ga0207675_100018725
1020 Ga0207675_100041774
1021 Ga0207675_100262827
1022 Ga0207675_100429269
1023 Ga0207683_10003509
1024 Ga0207683_10049417
1025 Ga0207698_10002995
1026 Ga0207698_10046073
1027 Ga0207698_10210347
1028 Ga0209968_1011867
1029 Ga0209282_1023473
1030 Ga0268266_10064584
1031 Ga0268266_10160973
1032 Ga0268266_10323502
1033 Ga0268265_10005161
1034 Ga0268264_10002545
1035 Ga0268264_10080368
1036 Ga0268264_10122469
1037 Ga0268264_10349691
1038 Ga0265334_10003361
1039 Ga0307515_10009312
1040 Ga0265338_10015045
1041 Ga0265338_10378291
1042 Ga0316177_1113690
1043 Ga0316176_1047226
1044 Ga0316183_1086246
1045 Ga0316181_1058577
1046 Ga0316182_1223135
1047 Ga0265327_10000819
1048 Ga0265327_10006440
1049 Ga0307513_10134888
1050 Ga0316576_10300097
1051 Ga0307405_10000049
1052 Ga0307413_10002048
1053 Ga0307407_10000024
1054 Ga0307412_10182492
1055 Ga0307416_100000037
1056 Ga0307416_100006959
1057 Ga0307414_10001034
1058 Ga0307414_10004809
1059 Ga0307414_10006990
1060 Ga0307414_10014942
1061 Ga0307414_10034778
1062 Ga0307414_10068525
1063 Ga0307414_10091226
1064 Ga0307414_10189672
1065 Ga0307414_10212078
1066 Ga0307411_10000012
1067 Ga0373930_0011000
1068 Ga0373955_0156004
1069 Ga0373962_0106226
1070 Ga0316574_0062061
1071 Ga0373937_0011902
1072 Ga0373937_0091931
1073 Ga0373937_0104510
1074 Ga0373937_0127322
1075 Ga0373925_0088452
1076 Ga0436363_0242255
1077 Ga0439439_0089016
1078 Ga0439447_000165
1079 Ga0439466_0002676
1080 Ga0439465_0008949
1081 Ga0451802_1277840
1082 Ga0451843_0161377
1083 Ga0439449_0013962
1084 Ga0439449_0014815
1085 Ga0439457_000827
1086 Ga0439446_0038219
1087 Ga0451577_0003838
1088 Ga0453684_0000676
1089 Ga0453684_0183994
1090 Ga0451576_0000083
1091 Ga0451576_0252743
1092 Ga0451576_0434918
1093 Ga0451576_0672238
1094 Ga0495627_002629
1095 Ga0495629_0294425
1096 Ga0495638_0069041
1097 Ga0495664_0306898
1098 Ga0495608_0390618
1099 Ga0495610_0000045
1100 Ga0495610_0001236
1101 Ga0495618_0136374
1102 Ga0495630_0089950
1103 Ga0495587_0116277
1104 Ga0495587_0294948
1105 Ga0495598_0027923
1106 Ga0495621_0024492
1107 Ga0495645_0351407
1108 Ga0495633_0097967
1109 Ga0495668_0000489
1110 Ga0495668_0005239
1111 Ga0495634_0252229
1112 Ga0495611_0019676
1113 Ga0495635_0098575
1114 Ga0495657_0212660
1115 Ga0495658_0015643
1116 Ga0495670_0029280
1117 Ga0495604_0234734
1118 Ga0495674_0208655
1119 Ga0495672_0020249
1120 Ga0495676_0192269
1121 Ga0495684_0176042
1122 Ga0495602_0144639
1123 Ga0496114_0427179
1124 Ga0496114_0613483
1125 Ga0496116_0000004
1126 Ga0496117_0008160
1127 Ga0496118_0158513
1128 Ga0496122_0000643
1129 Ga0496124_0005999
1130 Ga0496125_0000012
1131 Ga0496126_0008650
1132 Ga0496126_0071166
1133 Ga0501043_0121447
1134 Ga0501238_022424
1135 Ga0501249_011458
1136 Ga0501249_075235
1137 Ga0501266_000026
1138 nmdc:mga0k408_34935_c1
1139 nmdc:mga0k408_4631_c1
1140 nmdc:mga05p37_145992_c1
1141 nmdc:mga05p37_20024_c2
1142 nmdc:mga09592_153430_c1
1143 nmdc:mga09592_63781_c1
1144 nmdc:mga0qj67_30635_c1
1145 nmdc:mga0qj67_455057_c1
1146 nmdc:mga06r32_141170_c1
1147 nmdc:mga06r32_9671_c1
1148 nmdc:mga08y16_123242_c1
1149 nmdc:mga08y16_190227_c1
1150 nmdc:mga08y16_461948_c1
1151 Ga0495619_0174875
1152 Ga0500556_0032665
1153 Ga0500658_0000009
1154 Ga0500573_0122281
1155 Ga0500616_0015278
1156 Ga0500611_000002
1157 2586209281
1158 2722729852
1159 2739590200
1160 2819548406
1161 2833643423
1162 2842723025
1163 2842904268
1164 2842913981
1165 2849283722
1166 2904449527
1167 2919696557
1168 2945999999
1169 2954016598
1170 2984575702
1171 2984609156
1172 3003236667

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

8

241

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5268 1 241
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5202 1 241
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5192 1 241
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5128 1 241
6t1z-assembly1.cif.gz_A lmrp from l. lactis, in an outward-open conformation, bound to hoechst 33342 0.4063 33 244
ID Description Score Start End Superfamily
af_Q55EC8_162_384_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4576 29 243 1.20.1250.20
af_Q54E81_92_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4508 39 240 1.20.1250.20
af_Q86WB7_254_431_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4322 43 240 1.20.1250.20
af_Q54E81_92_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4317 39 240 1.20.1250.20
af_Q86WB7_254_431_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4259 43 240 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A519V1F2-F1-model_v4 Probable membrane transporter protein 0.9888 3 190 GO:0005886
AF-A0A3D3PCJ3-F1-model_v4 Probable membrane transporter protein 0.9757 4 244 GO:0005886
AF-A0A7J5EEQ8-F1-model_v4 Probable membrane transporter protein 0.9711 1 187 GO:0005886
AF-A0A519V1F2-F1-model_v4 Probable membrane transporter protein 0.9634 3 190 GO:0005886
AF-A0A3D3PCJ3-F1-model_v4 Probable membrane transporter protein 0.96 4 244 GO:0005886

Map