F466550

General Info

Members Datasets Scaffolds Average Seq Length
586 305 1172 294

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10081326|Ga0105238_100813262
Length 345
Sequence VRILNIAAFILETACIRSRRVMKPFRIPGRARWIRLVPPLCALALGAQCTKHARADEGYIPVEGGRIWYHRVGSGTGTPLVLLHGGPGSCSYYLKPLLALSADRPVIIYDQLGCGKSDRPTDTTLFTVDRYVRELQTLRDSLGLREIHLLGHSWGAMLAEAYMATHPKGVRSLILSSPLVTTAQWEHDADSLLRALPDSMRDAIARHEADHTTSSPEYVSATRAYYDLYLSRTHPHPTADNDSSSAGFGRQVYEYMWGPSEFTSTGTLKTFDATAWLRDIRVPTLFIAGEFDEATPASTRNFSRLVPGAEFVMIPGSGHMTTKDNPDALRSEIRAFLSRVEHRQP

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
86 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
155 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
156 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
157 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
161 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
162 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
163 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
164 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
165 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
170 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
188 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
189 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
199 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
200 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
201 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
202 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
277 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
278 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
279 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
293 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
294 2738541295 Bacillus sp. OK085 Isolate Unclassified
295 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
296 2738543017 Bacillus sp. OV186 Isolate Unclassified
297 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
298 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
299 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
300 2857586860 Bacillus sp. R-71935 Isolate Unclassified
301 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
302 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
303 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
304 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
305 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 0.51
Isolates 2.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.71
Nodule 0
Rhizoplane 8.53
Rhizosphere 85.84
Stem 0
Stem Tuber 0
Unclassified 9.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10081326 3300009551 Bacteria 3229
2 JGI25151J46595_10000173 3300003187 Bacteria 83223
3 JGI25151J46595_10002674 3300003187 Bacteria 10436
4 JGI25151J46595_10009911 3300003187 Bacteria 4472
5 Ga0055532_1000222 3300003758 Bacteria 43041
6 Ga0070683_100002597 3300005329 Bacteria 14436
7 Ga0070683_100018897 3300005329 Bacteria 6114
8 Ga0070683_100079568 3300005329 Bacteria 3067
9 Ga0070683_100087734 3300005329 Bacteria 2918
10 Ga0070683_100093955 3300005329 Bacteria 2818
11 Ga0070690_100047267 3300005330 Bacteria 2738
12 Ga0070690_100052824 3300005330 Bacteria 2599
13 Ga0070670_100376556 3300005331 Bacteria 1250
14 Ga0068869_100109751 3300005334 Bacteria 2097
15 Ga0070680_100017218 3300005336 Bacteria 5695
16 Ga0070682_100043431 3300005337 Bacteria 2779
17 Ga0070682_100062132 3300005337 Bacteria 2365
18 Ga0068868_100065499 3300005338 Bacteria 2886
19 Ga0070660_100025356 3300005339 Bacteria 4408
20 Ga0070691_10008877 3300005341 Bacteria 4603
21 Ga0070661_100296579 3300005344 Bacteria 1257
22 Ga0070692_10068094 3300005345 Bacteria 1891
23 Ga0070669_100049397 3300005353 Bacteria 3071
24 Ga0070675_100051130 3300005354 Archaea 3395
25 Ga0070671_100091465 3300005355 Bacteria 2548
26 Ga0070671_100228141 3300005355 Bacteria 1580
27 Ga0070674_100056521 3300005356 Bacteria 2721
28 Ga0070688_100083545 3300005365 Bacteria 2072
29 Ga0070688_100237866 3300005365 Bacteria 1291
30 Ga0070659_100015781 3300005366 Bacteria 5661
31 Ga0070667_100271811 3300005367 Bacteria 1520
32 Ga0070709_10199131 3300005434 Bacteria 1417
33 Ga0070709_10286927 3300005434 Bacteria 1198
34 Ga0070714_100000571 3300005435 Bacteria 26507
35 Ga0070714_100002820 3300005435 Bacteria 12818
36 Ga0070714_100067834 3300005435 Bacteria 3077
37 Ga0070714_100094772 3300005435 Bacteria 2620
38 Ga0070714_100180216 3300005435 Bacteria 1922
39 Ga0070714_100409964 3300005435 Unclassified 1282
40 Ga0070713_100043606 3300005436 Bacteria 3668
41 Ga0070710_10027804 3300005437 Bacteria 3020
42 Ga0070710_10287874 3300005437 Unclassified 1068
43 Ga0070711_100039436 3300005439 Bacteria 3182
44 Ga0070711_100053549 3300005439 Bacteria 2781
45 Ga0070711_100163873 3300005439 Bacteria 1688
46 Ga0070705_100405507 3300005440 Bacteria 1011
47 Ga0070700_100004496 3300005441 Bacteria 7286
48 Ga0070700_100069087 3300005441 Bacteria 2248
49 Ga0070708_100014095 3300005445 Bacteria 6571
50 Ga0070708_100014940 3300005445 Bacteria 6401
51 Ga0070663_100024512 3300005455 Bacteria 4063
52 Ga0070663_100307092 3300005455 Bacteria 1272
53 Ga0070681_10055285 3300005458 Bacteria 3953
54 Ga0070681_10072316 3300005458 Bacteria 3411
55 Ga0068867_100074493 3300005459 Bacteria 2545
56 Ga0068867_100229584 3300005459 Bacteria 1500
57 Ga0070685_10131545 3300005466 Bacteria 1565
58 Ga0070706_100057684 3300005467 Bacteria 3583
59 Ga0070706_100057873 3300005467 Bacteria 3577
60 Ga0070707_100042841 3300005468 Bacteria 4334
61 Ga0070707_100100164 3300005468 Unclassified 2807
62 Ga0070707_100162848 3300005468 Bacteria 2173
63 Ga0070698_100135858 3300005471 Unclassified 2413
64 Ga0070699_100003864 3300005518 Bacteria 13243
65 Ga0070699_100007060 3300005518 Bacteria 9755
66 Ga0070679_100047335 3300005530 Bacteria 4286
67 Ga0070684_100001074 3300005535 Bacteria 19597
68 Ga0070684_100006518 3300005535 Bacteria 9037
69 Ga0070684_100377328 3300005535 Bacteria 1306
70 Ga0070697_100001583 3300005536 Bacteria 17360
71 Ga0070697_100036080 3300005536 Bacteria 3992
72 Ga0068853_100016283 3300005539 Bacteria 6117
73 Ga0068853_100081251 3300005539 Bacteria 2837
74 Ga0070672_100053220 3300005543 Bacteria 3164
75 Ga0070686_100090643 3300005544 Bacteria 2044
76 Ga0070686_100426749 3300005544 Bacteria 1014
77 Ga0070695_100071446 3300005545 Bacteria 2273
78 Ga0070696_100078778 3300005546 Bacteria 2330
79 Ga0070693_100213897 3300005547 Bacteria 1259
80 Ga0070693_100303846 3300005547 Unclassified 1076
81 Ga0070665_100477429 3300005548 Bacteria 1257
82 Ga0070704_100049987 3300005549 Bacteria 2936
83 Ga0068855_100015489 3300005563 Bacteria 9180
84 Ga0068855_100096710 3300005563 Bacteria 3401
85 Ga0070664_100015623 3300005564 Bacteria 6213
86 Ga0070664_100114208 3300005564 Bacteria 2359
87 Ga0070664_100163970 3300005564 Bacteria 1968
88 Ga0070664_100586577 3300005564 Bacteria 1033
89 Ga0068857_100002220 3300005577 Bacteria 15819
90 Ga0068857_100125271 3300005577 Bacteria 2315
91 Ga0068857_100233282 3300005577 Bacteria 1683
92 Ga0068854_100039770 3300005578 Bacteria 3314
93 Ga0068854_100065348 3300005578 Bacteria 2645
94 Ga0070702_100001796 3300005615 Bacteria 8914
95 Ga0070702_100278840 3300005615 Unclassified 1147
96 Ga0068852_100059364 3300005616 Bacteria 3317
97 Ga0068859_100122024 3300005617 Bacteria 2672
98 Ga0068864_100429037 3300005618 Bacteria 1261
99 Ga0068866_10110406 3300005718 Bacteria 1533
100 Ga0068866_10130754 3300005718 Unclassified 1427
101 Ga0068870_10053268 3300005840 Unclassified 2148
102 Ga0068863_100074896 3300005841 Unclassified 3203
103 Ga0068863_100106905 3300005841 Unclassified 2662
104 Ga0068863_100127900 3300005841 Bacteria 2424
105 Ga0068858_100030341 3300005842 Bacteria 5020
106 Ga0068862_100234495 3300005844 Bacteria 1666
107 Ga0068862_100456813 3300005844 Unclassified 1205
108 Ga0081455_10152746 3300005937 Bacteria 1778
109 Ga0081540_1000960 3300005983 Bacteria 26024
110 Ga0070717_10002454 3300006028 Bacteria 13084
111 Ga0070717_10011982 3300006028 Bacteria 6600
112 Ga0070717_10022255 3300006028 Bacteria 5006
113 Ga0070717_10054509 3300006028 Bacteria 3297
114 Ga0070717_10444205 3300006028 Unclassified 1168
115 Ga0070715_10044301 3300006163 Bacteria 1880
116 Ga0070715_10053777 3300006163 Bacteria 1741
117 Ga0070716_100065190 3300006173 Bacteria 2120
118 Ga0070716_100159222 3300006173 Unclassified 1461
119 Ga0070712_100003739 3300006175 Bacteria 9372
120 Ga0070712_100059056 3300006175 Bacteria 2699
121 Ga0070712_100395149 3300006175 Bacteria 1141
122 Ga0075428_100031316 3300006844 Bacteria 5881
123 Ga0075433_10126495 3300006852 Bacteria 2270
124 Ga0075433_10127449 3300006852 Bacteria 2260
125 Ga0075434_100020090 3300006871 Bacteria 6471
126 Ga0075434_100054770 3300006871 Bacteria 3962
127 Ga0075434_100059553 3300006871 Bacteria 3796
128 Ga0075434_100325564 3300006871 Unclassified 1557
129 Ga0075436_100011983 3300006914 Bacteria 5947
130 Ga0075436_100024664 3300006914 Bacteria 4135
131 Ga0075436_100121197 3300006914 Bacteria 1830
132 Ga0097620_100122016 3300006931 Bacteria 2672
133 Ga0075435_100001474 3300007076 Bacteria 15114
134 Ga0075435_100382717 3300007076 Bacteria 1209
135 Ga0075435_100406161 3300007076 Unclassified 1172
136 Ga0105251_10006734 3300009011 Bacteria 7253
137 Ga0105240_10036431 3300009093 Bacteria 6328
138 Ga0105240_10050679 3300009093 Bacteria 5231
139 Ga0111539_10123872 3300009094 Bacteria 3030
140 Ga0105245_10031209 3300009098 Bacteria 4715
141 Ga0105245_10056804 3300009098 Bacteria 3519
142 Ga0105243_10264779 3300009148 Bacteria 1541
143 Ga0105243_10316543 3300009148 Bacteria 1420
144 Ga0105243_10357994 3300009148 Unclassified 1342
145 Ga0105242_10349308 3300009176 Bacteria 1365
146 Ga0105248_10245419 3300009177 Bacteria 2016
147 Ga0105237_10730539 3300009545 Bacteria 996
148 Ga0105238_10024946 3300009551 Bacteria 6094
149 Ga0105238_10177798 3300009551 Archaea 2105
150 Ga0105249_10067884 3300009553 Unclassified 3286
151 Ga0105239_10081700 3300010375 Bacteria 3557
152 Ga0105239_10090796 3300010375 Bacteria 3370
153 Ga0105239_10198183 3300010375 Unclassified 2249
154 Ga0105246_10040995 3300011119 Bacteria 3128
155 Ga0105246_10234326 3300011119 Bacteria 1447
156 Ga0157340_1000629 3300012473 Bacteria 1412
157 Ga0157341_1000713 3300012494 Unclassified 1781
158 Ga0157373_10173909 3300013100 Bacteria 1515
159 Ga0157370_10104729 3300013104 Bacteria 2648
160 Ga0157369_10015673 3300013105 Bacteria 8541
161 Ga0157369_10032006 3300013105 Bacteria 5786
162 Ga0163162_10678033 3300013306 Unclassified 1153
163 Ga0157372_10036896 3300013307 Bacteria 5390
164 Ga0157372_10050511 3300013307 Bacteria 4626
165 Ga0157372_10064531 3300013307 Bacteria 4108
166 Ga0157372_10383973 3300013307 Unclassified 1636
167 Ga0157375_10203252 3300013308 Unclassified 2137
168 Ga0157375_10235167 3300013308 Bacteria 1991
169 Ga0157375_10254717 3300013308 Bacteria 1916
170 Ga0157375_10559765 3300013308 Bacteria 1304
171 Ga0182008_10018503 3300014497 Bacteria 3607
172 Ga0182008_10121672 3300014497 Bacteria 1297
173 Ga0157377_10199815 3300014745 Bacteria 1268
174 Ga0157376_10039381 3300014969 Bacteria 3854
175 Ga0157376_10121232 3300014969 Bacteria 2318
176 Ga0206356_11051677 3300020070 Bacteria 1490
177 Ga0206354_11605644 3300020081 Bacteria 1194
178 Ga0213875_10025073 3300021388 Bacteria 2842
179 Ga0213875_10083614 3300021388 Bacteria 1489
180 Ga0213875_10163877 3300021388 Archaea 1043
181 Ga0224572_1000484 3300024225 Bacteria 4731
182 Ga0209147_100185 3300025229 Bacteria 74400
183 Ga0209675_1016815 3300025291 Bacteria 2114
184 Ga0209676_1000894 3300025292 Bacteria 37859
185 Ga0209025_1000156 3300025294 Bacteria 168932
186 Ga0209025_1000266 3300025294 Bacteria 122782
187 Ga0209025_1002044 3300025294 Bacteria 22998
188 Ga0207692_10012847 3300025898 Bacteria 3612
189 Ga0207692_10048694 3300025898 Bacteria 2135
190 Ga0207692_10119751 3300025898 Bacteria 1472
191 Ga0207642_10049850 3300025899 Bacteria 1885
192 Ga0207710_10199758 3300025900 Unclassified 987
193 Ga0207688_10065380 3300025901 Bacteria 2055
194 Ga0207688_10065505 3300025901 Bacteria 2053
195 Ga0207688_10099700 3300025901 Bacteria 1676
196 Ga0207647_10046501 3300025904 Bacteria 2704
197 Ga0207699_10014503 3300025906 Bacteria 4064
198 Ga0207699_10045334 3300025906 Bacteria 2566
199 Ga0207684_10098692 3300025910 Bacteria 2494
200 Ga0207707_10029522 3300025912 Bacteria 4795
201 Ga0207707_10207299 3300025912 Unclassified 1708
202 Ga0207695_10039026 3300025913 Bacteria 5106
203 Ga0207671_10384868 3300025914 Unclassified 1115
204 Ga0207693_10006652 3300025915 Bacteria 9549
205 Ga0207693_10015287 3300025915 Bacteria 6159
206 Ga0207693_10015563 3300025915 Bacteria 6101
207 Ga0207693_10291620 3300025915 Unclassified 1279
208 Ga0207663_10035875 3300025916 Bacteria 2979
209 Ga0207660_10017464 3300025917 Bacteria 4768
210 Ga0207662_10005891 3300025918 Bacteria 6575
211 Ga0207657_10025473 3300025919 Bacteria 5455
212 Ga0207657_10035368 3300025919 Bacteria 4480
213 Ga0207657_10229767 3300025919 Bacteria 1484
214 Ga0207652_10010567 3300025921 Bacteria 7430
215 Ga0207652_10090861 3300025921 Unclassified 2684
216 Ga0207652_10205800 3300025921 Bacteria 1771
217 Ga0207646_10014587 3300025922 Bacteria 7452
218 Ga0207646_10029359 3300025922 Bacteria 5000
219 Ga0207646_10144966 3300025922 Unclassified 2140
220 Ga0207694_10042063 3300025924 Bacteria 3523
221 Ga0207687_10112473 3300025927 Bacteria 2024
222 Ga0207700_10010846 3300025928 Bacteria 5781
223 Ga0207700_10020917 3300025928 Bacteria 4455
224 Ga0207700_10055317 3300025928 Bacteria 2983
225 Ga0207700_10074372 3300025928 Bacteria 2628
226 Ga0207700_10191624 3300025928 Bacteria 1718
227 Ga0207700_10357704 3300025928 Bacteria 1272
228 Ga0207664_10000445 3300025929 Bacteria 29415
229 Ga0207664_10025999 3300025929 Bacteria 4418
230 Ga0207664_10047957 3300025929 Bacteria 3358
231 Ga0207664_10160424 3300025929 Bacteria 1918
232 Ga0207664_10210468 3300025929 Bacteria 1682
233 Ga0207664_10250292 3300025929 Bacteria 1546
234 Ga0207644_10214275 3300025931 Bacteria 1524
235 Ga0207690_10267689 3300025932 Bacteria 1326
236 Ga0207686_10032216 3300025934 Bacteria 3118
237 Ga0207686_10066459 3300025934 Bacteria 2303
238 Ga0207670_10482737 3300025936 Bacteria 1004
239 Ga0207669_10023264 3300025937 Bacteria 3307
240 Ga0207704_10206725 3300025938 Bacteria 1441
241 Ga0207665_10007675 3300025939 Bacteria 7121
242 Ga0207665_10025061 3300025939 Bacteria 3934
243 Ga0207665_10051925 3300025939 Bacteria 2761
244 Ga0207691_10041336 3300025940 Bacteria 4257
245 Ga0207691_10097817 3300025940 Bacteria 2623
246 Ga0207689_10002974 3300025942 Bacteria 15633
247 Ga0207661_10016523 3300025944 Bacteria 5446
248 Ga0207661_10102502 3300025944 Bacteria 2406
249 Ga0207661_10169543 3300025944 Bacteria 1899
250 Ga0207679_10052131 3300025945 Bacteria 2999
251 Ga0207679_10124260 3300025945 Bacteria 2060
252 Ga0207651_10151291 3300025960 Bacteria 1807
253 Ga0207712_10202979 3300025961 Bacteria 1573
254 Ga0207640_10101012 3300025981 Bacteria 2023
255 Ga0207677_10039108 3300026023 Bacteria 3116
256 Ga0207677_10473069 3300026023 Bacteria 1078
257 Ga0207703_10181253 3300026035 Bacteria 1859
258 Ga0207703_10240455 3300026035 Bacteria 1628
259 Ga0207639_10000790 3300026041 Bacteria 21568
260 Ga0207639_10275171 3300026041 Bacteria 1478
261 Ga0207678_10004476 3300026067 Bacteria 12564
262 Ga0207708_10005669 3300026075 Bacteria 9221
263 Ga0207708_10008536 3300026075 Bacteria 7582
264 Ga0207702_10004942 3300026078 Bacteria 11714
265 Ga0207641_10033927 3300026088 Bacteria 4243
266 Ga0207641_10474744 3300026088 Unclassified 1211
267 Ga0207648_10061374 3300026089 Bacteria 3278
268 Ga0207648_10065089 3300026089 Bacteria 3178
269 Ga0207648_10077566 3300026089 Bacteria 2897
270 Ga0207676_10275368 3300026095 Bacteria 1526
271 Ga0207676_10676640 3300026095 Bacteria 998
272 Ga0207674_10000753 3300026116 Bacteria 42280
273 Ga0207674_10001849 3300026116 Bacteria 26988
274 Ga0207674_10011814 3300026116 Bacteria 9792
275 Ga0207674_10369859 3300026116 Bacteria 1386
276 Ga0207675_100058732 3300026118 Bacteria 3590
277 Ga0207675_100129362 3300026118 Bacteria 2394
278 Ga0207683_10001068 3300026121 Bacteria 24993
279 Ga0207698_10159078 3300026142 Bacteria 1973
280 Ga0207698_10244053 3300026142 Bacteria 1639
281 Ga0207698_10526769 3300026142 Bacteria 1154
282 Ga0268265_10131784 3300028380 Bacteria 2079
283 Ga0268264_10297598 3300028381 Bacteria 1518
284 Ga0316579_10002064 3300031691 Bacteria 7529
285 Ga0316579_10085107 3300031691 Bacteria 1508
286 Ga0316576_10009479 3300031727 Bacteria 6286
287 Ga0316578_10002124 3300031728 Bacteria 8516
288 Ga0316578_10013717 3300031728 Unclassified 4306
289 Ga0316577_10069910 3300031733 Bacteria 1960
290 Ga0307409_100156960 3300031995 Bacteria 1984
291 Ga0307416_100070030 3300032002 Bacteria 2906
292 Ga0316580_10006054 3300032139 Bacteria 3553
293 Ga0373958_0003432 3300034819 Bacteria 2284
294 Ga0373926_0000233 3300035083 Bacteria 13283
295 Ga0373926_0020150 3300035083 Viruses 2303
296 Ga0373928_0003496 3300035084 Bacteria 2993
297 Ga0373929_0013105 3300035085 Bacteria 1585
298 Ga0373934_0001197 3300035086 Bacteria 9395
299 Ga0373940_0009897 3300035088 Bacteria 2229
300 Ga0373940_0024993 3300035088 Bacteria 1553
301 Ga0373923_0000368 3300035111 Bacteria 10255
302 Ga0373923_0064601 3300035111 Bacteria 1561
303 Ga0373936_0000332 3300035113 Bacteria 15992
304 Ga0373936_0000759 3300035113 Bacteria 11330
305 Ga0373936_0001867 3300035113 Bacteria 7771
306 Ga0373939_0094187 3300035114 Unclassified 1017
307 Ga0373945_0003452 3300035116 Bacteria 4970
308 Ga0373945_0004321 3300035116 Bacteria 4515
309 Ga0373945_0012136 3300035116 Viruses 2857
310 Ga0373953_0012436 3300035117 Bacteria 3014
311 Ga0373953_0026368 3300035117 Bacteria 2226
312 Ga0373956_0023579 3300035119 Bacteria 2642
313 Ga0373957_0000649 3300035120 Bacteria 8918
314 Ga0373957_0053204 3300035120 Bacteria 1553
315 Ga0373960_0047677 3300035121 Bacteria 1261
316 Ga0373943_0002340 3300035170 Bacteria 8608
317 Ga0373943_0351433 3300035170 Unclassified 845
318 Ga0373946_0000335 3300035171 Bacteria 15151
319 Ga0373946_0000938 3300035171 Bacteria 9982
320 Ga0373955_0008851 3300035172 Bacteria 4693
321 Ga0373955_0022019 3300035172 Bacteria 3226
322 Ga0373955_0024714 3300035172 Bacteria 3075
323 Ga0373942_0010327 3300035207 Bacteria 2196
324 Ga0373961_0058086 3300035241 Unclassified 1166
325 Ga0373961_0067867 3300035241 Bacteria 1097
326 Ga0316574_0032187 3300035398 Bacteria 3185
327 Ga0316574_0124480 3300035398 Bacteria 1656
328 Ga0373924_0000149 3300035410 Bacteria 20536
329 Ga0373935_0001103 3300035692 Bacteria 14736
330 Ga0373935_0014038 3300035692 Bacteria 4837
331 Ga0373927_0002493 3300035695 Bacteria 13436
332 Ga0373927_0002623 3300035695 Bacteria 13111
333 Ga0373927_0003833 3300035695 Bacteria 10679
334 Ga0373933_0111668 3300035724 Bacteria 1705
335 Ga0373933_0365269 3300035724 Bacteria 939
336 Ga0373947_0001226 3300035725 Bacteria 15805
337 Ga0373947_0002538 3300035725 Bacteria 10969
338 Ga0373937_0081189 3300036401 Bacteria 2999
339 Ga0373937_0103854 3300036401 Bacteria 2639
340 Ga0373937_0141771 3300036401 Bacteria 2249
341 Ga0373937_0169732 3300036401 Bacteria 2047
342 Ga0372808_006094 3300036459 Archaea 1615
343 Ga0316582_0065888 3300036647 Unclassified 2333
344 Ga0316584_0006901 3300036712 Bacteria 7718
345 Ga0373925_0000090 3300037068 Bacteria 97041
346 Ga0373925_0000850 3300037068 Bacteria 27976
347 Ga0373925_0001846 3300037068 Bacteria 17627
348 Ga0373925_0208439 3300037068 Bacteria 1556
349 Ga0373925_0338974 3300037068 Unclassified 1219
350 Ga0395899_0160555 3300037312 Unclassified 1588
351 Ga0395900_0042286 3300037418 Bacteria 4694
352 Ga0395898_0001544 3300037466 Bacteria 31660
353 Ga0395905_0043751 3300037471 Unclassified 4200
354 Ga0436364_0169355 3300037853 Archaea 1269
355 Ga0436364_0615851 3300037853 Bacteria 4228
356 Ga0436364_0780939 3300037853 Bacteria 2034
357 Ga0436364_1010902 3300037853 Bacteria 1346
358 Ga0436364_1265507 3300037853 Bacteria 48294
359 Ga0395901_0034710 3300038443 Bacteria 5209
360 Ga0395901_0538629 3300038443 Bacteria 1184
361 Ga0436365_1875564 3300039437 Bacteria 1574
362 Ga0451789_0997059 3300041443 Bacteria 2374
363 Ga0451793_0874875 3300041452 Bacteria 1746
364 Ga0451802_1084279 3300041460 Bacteria 1585
365 Ga0451839_1302848 3300041496 Bacteria 1465
366 Ga0451847_0962632 3300041503 Unclassified 1208
367 Ga0466972_0115555 3300044658 Bacteria 1267
368 Ga0466972_0118046 3300044658 Bacteria 1252
369 Ga0466965_0100617 3300044683 Bacteria 1478
370 Ga0466961_0025745 3300044693 Bacteria 3782
371 Ga0466963_0000657 3300044694 Bacteria 16663
372 Ga0466963_0004204 3300044694 Bacteria 8347
373 Ga0466963_0057602 3300044694 Bacteria 2588
374 Ga0466963_0231642 3300044694 Bacteria 1294
375 Ga0466964_0007740 3300044706 Bacteria 4020
376 Ga0466964_0009644 3300044706 Bacteria 3637
377 Ga0453684_0000637 3300044712 Bacteria 126612
378 Ga0453684_0248124 3300044712 Bacteria 2046
379 Ga0466971_0015433 3300044719 Bacteria 3363
380 Ga0466968_0054715 3300044735 Bacteria 1711
381 Ga0466968_0069678 3300044735 Bacteria 1529
382 Ga0466970_0029600 3300044765 Bacteria 2884
383 Ga0466970_0047398 3300044765 Bacteria 2290
384 Ga0466957_0019411 3300044842 Bacteria 3999
385 Ga0466960_0005280 3300044901 Bacteria 5107
386 Ga0466960_0007387 3300044901 Bacteria 4463
387 Ga0466959_0135036 3300045049 Archaea 1747
388 Ga0466958_0011146 3300045836 Bacteria 5058
389 Ga0466958_0074237 3300045836 Bacteria 2084
390 Ga0466958_0084848 3300045836 Bacteria 1953
391 Ga0466958_0124292 3300045836 Archaea 1617
392 Ga0466967_0004460 3300045976 Bacteria 9444
393 Ga0466967_0012064 3300045976 Bacteria 6587
394 Ga0466967_0040417 3300045976 Bacteria 4015
395 Ga0466967_0172197 3300045976 Bacteria 2038
396 Ga0466967_0183233 3300045976 Bacteria 1976
397 Ga0466967_0239497 3300045976 Unclassified 1730
398 Ga0466967_0269459 3300045976 Bacteria 1631
399 Ga0495592_0023534 3300046454 Bacteria 4685
400 Ga0495592_0062662 3300046454 Bacteria 2729
401 Ga0495603_0001384 3300046455 Bacteria 14074
402 Ga0495629_0176487 3300046459 Unclassified 1481
403 Ga0495629_0197259 3300046459 Unclassified 1392
404 Ga0495641_0005794 3300046461 Bacteria 8201
405 Ga0495641_0006776 3300046461 Bacteria 7342
406 Ga0495651_0011607 3300046462 Bacteria 6770
407 Ga0495651_0221417 3300046462 Bacteria 1309
408 Ga0495653_0001704 3300046463 Bacteria 17301
409 Ga0495653_0004084 3300046463 Bacteria 11807
410 Ga0495653_0050859 3300046463 Unclassified 3185
411 Ga0495580_0009285 3300046472 Bacteria 7738
412 Ga0495582_0000407 3300046473 Bacteria 23526
413 Ga0495639_0000391 3300046475 Bacteria 20675
414 Ga0495662_0000493 3300046476 Bacteria 17984
415 Ga0495664_0000415 3300046477 Bacteria 20829
416 Ga0495664_0002387 3300046477 Bacteria 10069
417 Ga0495664_0023838 3300046477 Bacteria 3553
418 Ga0495664_0046607 3300046477 Bacteria 2572
419 Ga0495594_0021785 3300046499 Bacteria 3422
420 Ga0495608_0008633 3300046511 Bacteria 7133
421 Ga0495608_0027903 3300046511 Bacteria 3838
422 Ga0495608_0074766 3300046511 Bacteria 2208
423 Ga0495618_0008569 3300046514 Bacteria 6175
424 Ga0495618_0024245 3300046514 Bacteria 3755
425 Ga0495618_0054451 3300046514 Bacteria 2532
426 Ga0495628_0021128 3300046516 Bacteria 5360
427 Ga0495628_0022468 3300046516 Bacteria 5181
428 Ga0495628_0252153 3300046516 Bacteria 1317
429 Ga0495630_0008416 3300046517 Bacteria 7397
430 Ga0495630_0100056 3300046517 Bacteria 2193
431 Ga0495666_0003061 3300046526 Bacteria 8407
432 Ga0495652_0041143 3300046529 Bacteria 3991
433 Ga0495652_0072729 3300046529 Bacteria 2864
434 Ga0495652_0306066 3300046529 Unclassified 1153
435 Ga0495665_0000203 3300046531 Bacteria 30479
436 Ga0495665_0072436 3300046531 Bacteria 1814
437 Ga0495640_0002455 3300046533 Bacteria 14897
438 Ga0495640_0078569 3300046533 Bacteria 2198
439 Ga0495586_0021660 3300046535 Bacteria 3428
440 Ga0495587_0031738 3300046536 Bacteria 3196
441 Ga0495587_0032805 3300046536 Bacteria 3137
442 Ga0495645_0002225 3300046543 Bacteria 13197
443 Ga0495645_0026724 3300046543 Bacteria 4190
444 Ga0495645_0093314 3300046543 Bacteria 2148
445 Ga0495645_0310668 3300046543 Unclassified 1027
446 Ga0495667_0003066 3300046559 Bacteria 11209
447 Ga0495667_0003068 3300046559 Bacteria 11207
448 Ga0495667_0004958 3300046559 Bacteria 9000
449 Ga0495667_0027446 3300046559 Bacteria 3836
450 Ga0495667_0066885 3300046559 Bacteria 2349
451 Ga0495634_0062452 3300046642 Bacteria 2473
452 Ga0495634_0098453 3300046642 Bacteria 1892
453 Ga0495634_0182134 3300046642 Bacteria 1314
454 Ga0495635_0001917 3300046663 Bacteria 14144
455 Ga0495635_0019018 3300046663 Bacteria 4794
456 Ga0495635_0019571 3300046663 Bacteria 4717
457 Ga0495635_0115915 3300046663 Bacteria 1828
458 Ga0495635_0132894 3300046663 Bacteria 1696
459 Ga0495588_0096936 3300046674 Unclassified 1547
460 Ga0495657_0001013 3300046675 Bacteria 24756
461 Ga0495657_0037137 3300046675 Bacteria 3360
462 Ga0495599_0007561 3300046678 Bacteria 6592
463 Ga0495599_0009462 3300046678 Bacteria 5955
464 Ga0495599_0010549 3300046678 Bacteria 5652
465 Ga0495623_0040098 3300046679 Bacteria 2991
466 Ga0495623_0109161 3300046679 Bacteria 1678
467 Ga0495646_0002110 3300046680 Bacteria 12063
468 Ga0495646_0011112 3300046680 Bacteria 5717
469 Ga0495613_0112327 3300046689 Bacteria 1962
470 Ga0495624_0004261 3300046690 Bacteria 10510
471 Ga0495624_0013807 3300046690 Bacteria 5499
472 Ga0495600_0003141 3300046809 Bacteria 9663
473 Ga0495600_0007737 3300046809 Bacteria 6580
474 Ga0495600_0014351 3300046809 Bacteria 4992
475 Ga0495581_0000558 3300047315 Bacteria 19300
476 Ga0495581_0017466 3300047315 Bacteria 4167
477 Ga0495604_0001612 3300047317 Bacteria 18606
478 Ga0495604_0052410 3300047317 Bacteria 3159
479 Ga0495604_0066332 3300047317 Bacteria 2746
480 Ga0495674_0000802 3300047319 Bacteria 29886
481 Ga0495674_0004462 3300047319 Bacteria 13465
482 Ga0495674_0004962 3300047319 Bacteria 12804
483 Ga0495676_0002197 3300047321 Bacteria 17289
484 Ga0495676_0037932 3300047321 Bacteria 4006
485 Ga0495676_0213163 3300047321 Bacteria 1335
486 Ga0495680_0004401 3300047322 Bacteria 13481
487 Ga0495680_0006672 3300047322 Bacteria 10690
488 Ga0495680_0007158 3300047322 Bacteria 10278
489 Ga0495680_0016763 3300047322 Bacteria 6281
490 Ga0495680_0175183 3300047322 Bacteria 1551
491 Ga0495680_0231820 3300047322 Unclassified 1314
492 Ga0495684_0002648 3300047471 Bacteria 14216
493 Ga0495684_0002672 3300047471 Bacteria 14126
494 Ga0495684_0010540 3300047471 Bacteria 7145
495 Ga0495684_0028645 3300047471 Bacteria 4276
496 Ga0495593_0002039 3300047673 Bacteria 12048
497 Ga0495593_0059112 3300047673 Bacteria 2009
498 Ga0495602_0071990 3300048088 Bacteria 2950
499 Ga0495602_0299592 3300048088 Bacteria 1177
500 Ga0496100_0014151 3300048903 Bacteria 4624
501 Ga0496100_0141744 3300048903 Bacteria 1704
502 Ga0496100_0143078 3300048903 Bacteria 1697
503 Ga0496100_0277858 3300048903 Bacteria 1247
504 Ga0496100_0299441 3300048903 Bacteria 1203
505 Ga0496101_0012202 3300048904 Bacteria 5729
506 Ga0496101_0084220 3300048904 Bacteria 2354
507 Ga0496101_0288148 3300048904 Bacteria 1284
508 Ga0496101_0296175 3300048904 Bacteria 1266
509 Ga0496102_0453020 3300048905 Bacteria 1204
510 Ga0496104_0049895 3300048907 Bacteria 3947
511 Ga0496104_0104002 3300048907 Bacteria 2720
512 Ga0496104_0419782 3300048907 Bacteria 1250
513 Ga0496105_0011938 3300048908 Bacteria 6878
514 Ga0496106_0003655 3300048909 Bacteria 11467
515 Ga0496106_0014877 3300048909 Bacteria 5756
516 Ga0496106_0100496 3300048909 Bacteria 2243
517 Ga0496107_0072268 3300048910 Bacteria 2508
518 Ga0496107_0110430 3300048910 Bacteria 2020
519 Ga0496107_0166516 3300048910 Bacteria 1634
520 Ga0496107_0238738 3300048910 Bacteria 1352
521 Ga0496108_0057249 3300048911 Bacteria 3275
522 Ga0496108_0120493 3300048911 Unclassified 2250
523 Ga0496108_0429081 3300048911 Unclassified 1154
524 Ga0496109_0007222 3300048912 Bacteria 9393
525 Ga0496109_0040707 3300048912 Bacteria 4209
526 Ga0496109_0076060 3300048912 Bacteria 3087
527 Ga0496109_0287387 3300048912 Bacteria 1550
528 Ga0496109_0303163 3300048912 Bacteria 1507
529 Ga0496110_0003005 3300048913 Bacteria 12787
530 Ga0496110_0177865 3300048913 Bacteria 1931
531 Ga0496110_0219237 3300048913 Bacteria 1730
532 Ga0496111_0043112 3300048914 Bacteria 3242
533 Ga0496111_0046891 3300048914 Bacteria 3112
534 Ga0496112_0148808 3300048915 Unclassified 2309
535 Ga0496112_0260199 3300048915 Bacteria 1684
536 Ga0496113_0125108 3300048916 Bacteria 2013
537 Ga0496113_0328851 3300048916 Unclassified 1225
538 Ga0496114_0012612 3300048917 Bacteria 6770
539 Ga0496114_0086187 3300048917 Bacteria 2661
540 Ga0496114_0106243 3300048917 Bacteria 2402
541 Ga0496114_0356030 3300048917 Bacteria 1295
542 Ga0496114_0550517 3300048917 Bacteria 1019
543 Ga0496115_0026429 3300048918 Bacteria 4531
544 Ga0496115_0108049 3300048918 Bacteria 2284
545 Ga0496115_0493052 3300048918 Bacteria 985
546 Ga0496126_0178026 3300048929 Unclassified 1808
547 Ga0501034_0230371 3300049571 Bacteria 1802
548 Ga0501067_0000005 3300049583 Bacteria 127875
549 Ga0501067_0044797 3300049583 Bacteria 2458
550 Ga0501068_0001488 3300049584 Bacteria 12471
551 Ga0501069_0000023 3300049585 Bacteria 118054
552 Ga0501069_0004380 3300049585 Bacteria 7290
553 Ga0501070_0024826 3300049586 Bacteria 5026
554 Ga0501080_0123392 3300049742 Unclassified 2399
555 Ga0501083_0021124 3300049744 Bacteria 4525
556 nmdc:mga05p37_127560_c1 3300050507 Bacteria 3123
557 nmdc:mga05p37_17739_c1 3300050507 Bacteria 8590
558 nmdc:mga0qj67_159128_c1 3300050509 Bacteria 1833
559 nmdc:mga0qj67_429219_c1 3300050509 Bacteria 1065
560 nmdc:mga08y16_327080_c1 3300050511 Unclassified 1577
561 nmdc:mga0n895_147676_c1 3300050512 Bacteria 2381
562 nmdc:mga0n895_153921_c1 3300050512 Bacteria 2330
563 nmdc:mga0n895_227030_c1 3300050512 Bacteria 1895
564 nmdc:mga08x19_15855_c1 3300050514 Bacteria 4589
565 nmdc:mga0a205_40408_c1 3300050515 Bacteria 4490
566 Ga0495601_0041771 3300053077 Bacteria 2875
567 Ga0495612_0005877 3300053078 Bacteria 5062
568 Ga0495619_0003799 3300053085 Bacteria 9713
569 Ga0495619_0053133 3300053085 Bacteria 2679
570 Ga0501082_0005337 3300060353 Bacteria 11166
571 Ga0530510_0027875 3300061734 Bacteria 4048
572 Ga0530510_0106621 3300061734 Bacteria 2050
573 Ga0530510_0242621 3300061734 Unclassified 1342
574 2595087967 2593339131 Bacteria 5116855
575 2738813096 2738541295 Bacteria 5730091
576 2738839929 2738541299 Bacteria 4020721
577 2739268093 2738543017 Bacteria 4271950
578 2757565936 2757320391 Bacteria 4746095
579 2777762279 2775507177 Bacteria 4384303
580 2777839444 2775507192 Bacteria 4622234
581 2857587001 2857586860 Bacteria 4354574
582 2936341762 2936340661 Bacteria 5139038
583 2936365957 2936361878 Bacteria 5632809
584 2964378470 2964375228 Bacteria 4909004
585 2977257565 2977254563 Bacteria 4828420
586 2990278538 2990275345 Bacteria 4887158
587 Ga0105238_10081326
588 JGI25151J46595_10000173
589 JGI25151J46595_10002674
590 JGI25151J46595_10009911
591 Ga0055532_1000222
592 Ga0070683_100002597
593 Ga0070683_100018897
594 Ga0070683_100079568
595 Ga0070683_100087734
596 Ga0070683_100093955
597 Ga0070690_100047267
598 Ga0070690_100052824
599 Ga0070670_100376556
600 Ga0068869_100109751
601 Ga0070680_100017218
602 Ga0070682_100043431
603 Ga0070682_100062132
604 Ga0068868_100065499
605 Ga0070660_100025356
606 Ga0070691_10008877
607 Ga0070661_100296579
608 Ga0070692_10068094
609 Ga0070669_100049397
610 Ga0070675_100051130
611 Ga0070671_100091465
612 Ga0070671_100228141
613 Ga0070674_100056521
614 Ga0070688_100083545
615 Ga0070688_100237866
616 Ga0070659_100015781
617 Ga0070667_100271811
618 Ga0070709_10199131
619 Ga0070709_10286927
620 Ga0070714_100000571
621 Ga0070714_100002820
622 Ga0070714_100067834
623 Ga0070714_100094772
624 Ga0070714_100180216
625 Ga0070714_100409964
626 Ga0070713_100043606
627 Ga0070710_10027804
628 Ga0070710_10287874
629 Ga0070711_100039436
630 Ga0070711_100053549
631 Ga0070711_100163873
632 Ga0070705_100405507
633 Ga0070700_100004496
634 Ga0070700_100069087
635 Ga0070708_100014095
636 Ga0070708_100014940
637 Ga0070663_100024512
638 Ga0070663_100307092
639 Ga0070681_10055285
640 Ga0070681_10072316
641 Ga0068867_100074493
642 Ga0068867_100229584
643 Ga0070685_10131545
644 Ga0070706_100057684
645 Ga0070706_100057873
646 Ga0070707_100042841
647 Ga0070707_100100164
648 Ga0070707_100162848
649 Ga0070698_100135858
650 Ga0070699_100003864
651 Ga0070699_100007060
652 Ga0070679_100047335
653 Ga0070684_100001074
654 Ga0070684_100006518
655 Ga0070684_100377328
656 Ga0070697_100001583
657 Ga0070697_100036080
658 Ga0068853_100016283
659 Ga0068853_100081251
660 Ga0070672_100053220
661 Ga0070686_100090643
662 Ga0070686_100426749
663 Ga0070695_100071446
664 Ga0070696_100078778
665 Ga0070693_100213897
666 Ga0070693_100303846
667 Ga0070665_100477429
668 Ga0070704_100049987
669 Ga0068855_100015489
670 Ga0068855_100096710
671 Ga0070664_100015623
672 Ga0070664_100114208
673 Ga0070664_100163970
674 Ga0070664_100586577
675 Ga0068857_100002220
676 Ga0068857_100125271
677 Ga0068857_100233282
678 Ga0068854_100039770
679 Ga0068854_100065348
680 Ga0070702_100001796
681 Ga0070702_100278840
682 Ga0068852_100059364
683 Ga0068859_100122024
684 Ga0068864_100429037
685 Ga0068866_10110406
686 Ga0068866_10130754
687 Ga0068870_10053268
688 Ga0068863_100074896
689 Ga0068863_100106905
690 Ga0068863_100127900
691 Ga0068858_100030341
692 Ga0068862_100234495
693 Ga0068862_100456813
694 Ga0081455_10152746
695 Ga0081540_1000960
696 Ga0070717_10002454
697 Ga0070717_10011982
698 Ga0070717_10022255
699 Ga0070717_10054509
700 Ga0070717_10444205
701 Ga0070715_10044301
702 Ga0070715_10053777
703 Ga0070716_100065190
704 Ga0070716_100159222
705 Ga0070712_100003739
706 Ga0070712_100059056
707 Ga0070712_100395149
708 Ga0075428_100031316
709 Ga0075433_10126495
710 Ga0075433_10127449
711 Ga0075434_100020090
712 Ga0075434_100054770
713 Ga0075434_100059553
714 Ga0075434_100325564
715 Ga0075436_100011983
716 Ga0075436_100024664
717 Ga0075436_100121197
718 Ga0097620_100122016
719 Ga0075435_100001474
720 Ga0075435_100382717
721 Ga0075435_100406161
722 Ga0105251_10006734
723 Ga0105240_10036431
724 Ga0105240_10050679
725 Ga0111539_10123872
726 Ga0105245_10031209
727 Ga0105245_10056804
728 Ga0105243_10264779
729 Ga0105243_10316543
730 Ga0105243_10357994
731 Ga0105242_10349308
732 Ga0105248_10245419
733 Ga0105237_10730539
734 Ga0105238_10024946
735 Ga0105238_10177798
736 Ga0105249_10067884
737 Ga0105239_10081700
738 Ga0105239_10090796
739 Ga0105239_10198183
740 Ga0105246_10040995
741 Ga0105246_10234326
742 Ga0157340_1000629
743 Ga0157341_1000713
744 Ga0157373_10173909
745 Ga0157370_10104729
746 Ga0157369_10015673
747 Ga0157369_10032006
748 Ga0163162_10678033
749 Ga0157372_10036896
750 Ga0157372_10050511
751 Ga0157372_10064531
752 Ga0157372_10383973
753 Ga0157375_10203252
754 Ga0157375_10235167
755 Ga0157375_10254717
756 Ga0157375_10559765
757 Ga0182008_10018503
758 Ga0182008_10121672
759 Ga0157377_10199815
760 Ga0157376_10039381
761 Ga0157376_10121232
762 Ga0206356_11051677
763 Ga0206354_11605644
764 Ga0213875_10025073
765 Ga0213875_10083614
766 Ga0213875_10163877
767 Ga0224572_1000484
768 Ga0209147_100185
769 Ga0209675_1016815
770 Ga0209676_1000894
771 Ga0209025_1000156
772 Ga0209025_1000266
773 Ga0209025_1002044
774 Ga0207692_10012847
775 Ga0207692_10048694
776 Ga0207692_10119751
777 Ga0207642_10049850
778 Ga0207710_10199758
779 Ga0207688_10065380
780 Ga0207688_10065505
781 Ga0207688_10099700
782 Ga0207647_10046501
783 Ga0207699_10014503
784 Ga0207699_10045334
785 Ga0207684_10098692
786 Ga0207707_10029522
787 Ga0207707_10207299
788 Ga0207695_10039026
789 Ga0207671_10384868
790 Ga0207693_10006652
791 Ga0207693_10015287
792 Ga0207693_10015563
793 Ga0207693_10291620
794 Ga0207663_10035875
795 Ga0207660_10017464
796 Ga0207662_10005891
797 Ga0207657_10025473
798 Ga0207657_10035368
799 Ga0207657_10229767
800 Ga0207652_10010567
801 Ga0207652_10090861
802 Ga0207652_10205800
803 Ga0207646_10014587
804 Ga0207646_10029359
805 Ga0207646_10144966
806 Ga0207694_10042063
807 Ga0207687_10112473
808 Ga0207700_10010846
809 Ga0207700_10020917
810 Ga0207700_10055317
811 Ga0207700_10074372
812 Ga0207700_10191624
813 Ga0207700_10357704
814 Ga0207664_10000445
815 Ga0207664_10025999
816 Ga0207664_10047957
817 Ga0207664_10160424
818 Ga0207664_10210468
819 Ga0207664_10250292
820 Ga0207644_10214275
821 Ga0207690_10267689
822 Ga0207686_10032216
823 Ga0207686_10066459
824 Ga0207670_10482737
825 Ga0207669_10023264
826 Ga0207704_10206725
827 Ga0207665_10007675
828 Ga0207665_10025061
829 Ga0207665_10051925
830 Ga0207691_10041336
831 Ga0207691_10097817
832 Ga0207689_10002974
833 Ga0207661_10016523
834 Ga0207661_10102502
835 Ga0207661_10169543
836 Ga0207679_10052131
837 Ga0207679_10124260
838 Ga0207651_10151291
839 Ga0207712_10202979
840 Ga0207640_10101012
841 Ga0207677_10039108
842 Ga0207677_10473069
843 Ga0207703_10181253
844 Ga0207703_10240455
845 Ga0207639_10000790
846 Ga0207639_10275171
847 Ga0207678_10004476
848 Ga0207708_10005669
849 Ga0207708_10008536
850 Ga0207702_10004942
851 Ga0207641_10033927
852 Ga0207641_10474744
853 Ga0207648_10061374
854 Ga0207648_10065089
855 Ga0207648_10077566
856 Ga0207676_10275368
857 Ga0207676_10676640
858 Ga0207674_10000753
859 Ga0207674_10001849
860 Ga0207674_10011814
861 Ga0207674_10369859
862 Ga0207675_100058732
863 Ga0207675_100129362
864 Ga0207683_10001068
865 Ga0207698_10159078
866 Ga0207698_10244053
867 Ga0207698_10526769
868 Ga0268265_10131784
869 Ga0268264_10297598
870 Ga0316579_10002064
871 Ga0316579_10085107
872 Ga0316576_10009479
873 Ga0316578_10002124
874 Ga0316578_10013717
875 Ga0316577_10069910
876 Ga0307409_100156960
877 Ga0307416_100070030
878 Ga0316580_10006054
879 Ga0373958_0003432
880 Ga0373926_0000233
881 Ga0373926_0020150
882 Ga0373928_0003496
883 Ga0373929_0013105
884 Ga0373934_0001197
885 Ga0373940_0009897
886 Ga0373940_0024993
887 Ga0373923_0000368
888 Ga0373923_0064601
889 Ga0373936_0000332
890 Ga0373936_0000759
891 Ga0373936_0001867
892 Ga0373939_0094187
893 Ga0373945_0003452
894 Ga0373945_0004321
895 Ga0373945_0012136
896 Ga0373953_0012436
897 Ga0373953_0026368
898 Ga0373956_0023579
899 Ga0373957_0000649
900 Ga0373957_0053204
901 Ga0373960_0047677
902 Ga0373943_0002340
903 Ga0373943_0351433
904 Ga0373946_0000335
905 Ga0373946_0000938
906 Ga0373955_0008851
907 Ga0373955_0022019
908 Ga0373955_0024714
909 Ga0373942_0010327
910 Ga0373961_0058086
911 Ga0373961_0067867
912 Ga0316574_0032187
913 Ga0316574_0124480
914 Ga0373924_0000149
915 Ga0373935_0001103
916 Ga0373935_0014038
917 Ga0373927_0002493
918 Ga0373927_0002623
919 Ga0373927_0003833
920 Ga0373933_0111668
921 Ga0373933_0365269
922 Ga0373947_0001226
923 Ga0373947_0002538
924 Ga0373937_0081189
925 Ga0373937_0103854
926 Ga0373937_0141771
927 Ga0373937_0169732
928 Ga0372808_006094
929 Ga0316582_0065888
930 Ga0316584_0006901
931 Ga0373925_0000090
932 Ga0373925_0000850
933 Ga0373925_0001846
934 Ga0373925_0208439
935 Ga0373925_0338974
936 Ga0395899_0160555
937 Ga0395900_0042286
938 Ga0395898_0001544
939 Ga0395905_0043751
940 Ga0436364_0169355
941 Ga0436364_0615851
942 Ga0436364_0780939
943 Ga0436364_1010902
944 Ga0436364_1265507
945 Ga0395901_0034710
946 Ga0395901_0538629
947 Ga0436365_1875564
948 Ga0451789_0997059
949 Ga0451793_0874875
950 Ga0451802_1084279
951 Ga0451839_1302848
952 Ga0451847_0962632
953 Ga0466972_0115555
954 Ga0466972_0118046
955 Ga0466965_0100617
956 Ga0466961_0025745
957 Ga0466963_0000657
958 Ga0466963_0004204
959 Ga0466963_0057602
960 Ga0466963_0231642
961 Ga0466964_0007740
962 Ga0466964_0009644
963 Ga0453684_0000637
964 Ga0453684_0248124
965 Ga0466971_0015433
966 Ga0466968_0054715
967 Ga0466968_0069678
968 Ga0466970_0029600
969 Ga0466970_0047398
970 Ga0466957_0019411
971 Ga0466960_0005280
972 Ga0466960_0007387
973 Ga0466959_0135036
974 Ga0466958_0011146
975 Ga0466958_0074237
976 Ga0466958_0084848
977 Ga0466958_0124292
978 Ga0466967_0004460
979 Ga0466967_0012064
980 Ga0466967_0040417
981 Ga0466967_0172197
982 Ga0466967_0183233
983 Ga0466967_0239497
984 Ga0466967_0269459
985 Ga0495592_0023534
986 Ga0495592_0062662
987 Ga0495603_0001384
988 Ga0495629_0176487
989 Ga0495629_0197259
990 Ga0495641_0005794
991 Ga0495641_0006776
992 Ga0495651_0011607
993 Ga0495651_0221417
994 Ga0495653_0001704
995 Ga0495653_0004084
996 Ga0495653_0050859
997 Ga0495580_0009285
998 Ga0495582_0000407
999 Ga0495639_0000391
1000 Ga0495662_0000493
1001 Ga0495664_0000415
1002 Ga0495664_0002387
1003 Ga0495664_0023838
1004 Ga0495664_0046607
1005 Ga0495594_0021785
1006 Ga0495608_0008633
1007 Ga0495608_0027903
1008 Ga0495608_0074766
1009 Ga0495618_0008569
1010 Ga0495618_0024245
1011 Ga0495618_0054451
1012 Ga0495628_0021128
1013 Ga0495628_0022468
1014 Ga0495628_0252153
1015 Ga0495630_0008416
1016 Ga0495630_0100056
1017 Ga0495666_0003061
1018 Ga0495652_0041143
1019 Ga0495652_0072729
1020 Ga0495652_0306066
1021 Ga0495665_0000203
1022 Ga0495665_0072436
1023 Ga0495640_0002455
1024 Ga0495640_0078569
1025 Ga0495586_0021660
1026 Ga0495587_0031738
1027 Ga0495587_0032805
1028 Ga0495645_0002225
1029 Ga0495645_0026724
1030 Ga0495645_0093314
1031 Ga0495645_0310668
1032 Ga0495667_0003066
1033 Ga0495667_0003068
1034 Ga0495667_0004958
1035 Ga0495667_0027446
1036 Ga0495667_0066885
1037 Ga0495634_0062452
1038 Ga0495634_0098453
1039 Ga0495634_0182134
1040 Ga0495635_0001917
1041 Ga0495635_0019018
1042 Ga0495635_0019571
1043 Ga0495635_0115915
1044 Ga0495635_0132894
1045 Ga0495588_0096936
1046 Ga0495657_0001013
1047 Ga0495657_0037137
1048 Ga0495599_0007561
1049 Ga0495599_0009462
1050 Ga0495599_0010549
1051 Ga0495623_0040098
1052 Ga0495623_0109161
1053 Ga0495646_0002110
1054 Ga0495646_0011112
1055 Ga0495613_0112327
1056 Ga0495624_0004261
1057 Ga0495624_0013807
1058 Ga0495600_0003141
1059 Ga0495600_0007737
1060 Ga0495600_0014351
1061 Ga0495581_0000558
1062 Ga0495581_0017466
1063 Ga0495604_0001612
1064 Ga0495604_0052410
1065 Ga0495604_0066332
1066 Ga0495674_0000802
1067 Ga0495674_0004462
1068 Ga0495674_0004962
1069 Ga0495676_0002197
1070 Ga0495676_0037932
1071 Ga0495676_0213163
1072 Ga0495680_0004401
1073 Ga0495680_0006672
1074 Ga0495680_0007158
1075 Ga0495680_0016763
1076 Ga0495680_0175183
1077 Ga0495680_0231820
1078 Ga0495684_0002648
1079 Ga0495684_0002672
1080 Ga0495684_0010540
1081 Ga0495684_0028645
1082 Ga0495593_0002039
1083 Ga0495593_0059112
1084 Ga0495602_0071990
1085 Ga0495602_0299592
1086 Ga0496100_0014151
1087 Ga0496100_0141744
1088 Ga0496100_0143078
1089 Ga0496100_0277858
1090 Ga0496100_0299441
1091 Ga0496101_0012202
1092 Ga0496101_0084220
1093 Ga0496101_0288148
1094 Ga0496101_0296175
1095 Ga0496102_0453020
1096 Ga0496104_0049895
1097 Ga0496104_0104002
1098 Ga0496104_0419782
1099 Ga0496105_0011938
1100 Ga0496106_0003655
1101 Ga0496106_0014877
1102 Ga0496106_0100496
1103 Ga0496107_0072268
1104 Ga0496107_0110430
1105 Ga0496107_0166516
1106 Ga0496107_0238738
1107 Ga0496108_0057249
1108 Ga0496108_0120493
1109 Ga0496108_0429081
1110 Ga0496109_0007222
1111 Ga0496109_0040707
1112 Ga0496109_0076060
1113 Ga0496109_0287387
1114 Ga0496109_0303163
1115 Ga0496110_0003005
1116 Ga0496110_0177865
1117 Ga0496110_0219237
1118 Ga0496111_0043112
1119 Ga0496111_0046891
1120 Ga0496112_0148808
1121 Ga0496112_0260199
1122 Ga0496113_0125108
1123 Ga0496113_0328851
1124 Ga0496114_0012612
1125 Ga0496114_0086187
1126 Ga0496114_0106243
1127 Ga0496114_0356030
1128 Ga0496114_0550517
1129 Ga0496115_0026429
1130 Ga0496115_0108049
1131 Ga0496115_0493052
1132 Ga0496126_0178026
1133 Ga0501034_0230371
1134 Ga0501067_0000005
1135 Ga0501067_0044797
1136 Ga0501068_0001488
1137 Ga0501069_0000023
1138 Ga0501069_0004380
1139 Ga0501070_0024826
1140 Ga0501080_0123392
1141 Ga0501083_0021124
1142 nmdc:mga05p37_127560_c1
1143 nmdc:mga05p37_17739_c1
1144 nmdc:mga0qj67_159128_c1
1145 nmdc:mga0qj67_429219_c1
1146 nmdc:mga08y16_327080_c1
1147 nmdc:mga0n895_147676_c1
1148 nmdc:mga0n895_153921_c1
1149 nmdc:mga0n895_227030_c1
1150 nmdc:mga08x19_15855_c1
1151 nmdc:mga0a205_40408_c1
1152 Ga0495601_0041771
1153 Ga0495612_0005877
1154 Ga0495619_0003799
1155 Ga0495619_0053133
1156 Ga0501082_0005337
1157 Ga0530510_0027875
1158 Ga0530510_0106621
1159 Ga0530510_0242621
1160 2595087967
1161 2738813096
1162 2738839929
1163 2739268093
1164 2757565936
1165 2777762279
1166 2777839444
1167 2857587001
1168 2936341762
1169 2936365957
1170 2964378470
1171 2977257565
1172 2990278538

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

78

326

0.86

PF08386

Abhydrolase_4

TAP-like protein

246

344

0.83

PF12146

Hydrolase_4

Serine aminopeptidase, S33

78

256

0.79

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

80

332

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wmr-assembly3.cif.gz_C crystal structure of vinj 0.953 4 290
1xqx-assembly1.cif.gz_A crystal structure of f1-mutant s105a complex with pck 0.9522 2 289
1xrp-assembly1.cif.gz_A crystal structure of active site f1-mutant e213q soaked with peptide pro-leu-gly-gly 0.95 2 289
1xrr-assembly1.cif.gz_A crystal structure of active site f1-mutant e245q soaked with peptide pro-pro 0.9495 2 289
1xrl-assembly1.cif.gz_A crystal structure of active site f1-mutant y205f complex with inhibitor pck 0.9476 2 289
ID Description Score Start End Superfamily
af_I6Y8X0_7_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9802 10 288 3.40.50.1820
af_I6Y8X0_7_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9664 10 288 3.40.50.1820
3wmrB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9533 4 290 3.40.50.1820
1xrpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.95 2 289 3.40.50.1820
1xrpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9405 2 289 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2N0L3Y3-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9848 2 291 GO:0004177
GO:0006508
GO:0016020
AF-A0A1G0PGS2-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9761 1 291 GO:0006508
GO:0008233
GO:0016020
AF-A0PL61-F1-model_v4 Proline iminopeptidase PIP 0.9756 36 289 GO:0004177
GO:0006508
GO:0016020
AF-A0A2N1WAJ8-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9744 2 293 GO:0006508
GO:0008233
GO:0016020
AF-A0A538L080-F1-model_v4 Alpha/beta fold hydrolase 0.9718 2 290 GO:0006508
GO:0008233
GO:0016020

Map