F466550
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 586 | 305 | 1172 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10081326|Ga0105238_100813262 |
| Length | 345 |
| Sequence | VRILNIAAFILETACIRSRRVMKPFRIPGRARWIRLVPPLCALALGAQCTKHARADEGYIPVEGGRIWYHRVGSGTGTPLVLLHGGPGSCSYYLKPLLALSADRPVIIYDQLGCGKSDRPTDTTLFTVDRYVRELQTLRDSLGLREIHLLGHSWGAMLAEAYMATHPKGVRSLILSSPLVTTAQWEHDADSLLRALPDSMRDAIARHEADHTTSSPEYVSATRAYYDLYLSRTHPHPTADNDSSSAGFGRQVYEYMWGPSEFTSTGTLKTFDATAWLRDIRVPTLFIAGEFDEATPASTRNFSRLVPGAEFVMIPGSGHMTTKDNPDALRSEIRAFLSRVEHRQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 86 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 99 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 100 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 155 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 156 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 157 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 161 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 163 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 165 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 169 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 170 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 174 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 181 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 184 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 185 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 186 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 188 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 189 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 198 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 202 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 203 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 204 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 205 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 208 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 209 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 210 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 265 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 266 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 270 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 271 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 275 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 293 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 294 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 295 | 2738541299 | Paenisporosarcina sp. OV554 | Isolate | Unclassified |
| 296 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 297 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 298 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 299 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 300 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 301 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 302 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 303 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 304 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 305 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.27 |
| Metatranscriptomes | 0.51 |
| Isolates | 2.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.71 |
| Nodule | 0 |
| Rhizoplane | 8.53 |
| Rhizosphere | 85.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105238_10081326 | 3300009551 | Bacteria | 3229 |
| 2 | JGI25151J46595_10000173 | 3300003187 | Bacteria | 83223 |
| 3 | JGI25151J46595_10002674 | 3300003187 | Bacteria | 10436 |
| 4 | JGI25151J46595_10009911 | 3300003187 | Bacteria | 4472 |
| 5 | Ga0055532_1000222 | 3300003758 | Bacteria | 43041 |
| 6 | Ga0070683_100002597 | 3300005329 | Bacteria | 14436 |
| 7 | Ga0070683_100018897 | 3300005329 | Bacteria | 6114 |
| 8 | Ga0070683_100079568 | 3300005329 | Bacteria | 3067 |
| 9 | Ga0070683_100087734 | 3300005329 | Bacteria | 2918 |
| 10 | Ga0070683_100093955 | 3300005329 | Bacteria | 2818 |
| 11 | Ga0070690_100047267 | 3300005330 | Bacteria | 2738 |
| 12 | Ga0070690_100052824 | 3300005330 | Bacteria | 2599 |
| 13 | Ga0070670_100376556 | 3300005331 | Bacteria | 1250 |
| 14 | Ga0068869_100109751 | 3300005334 | Bacteria | 2097 |
| 15 | Ga0070680_100017218 | 3300005336 | Bacteria | 5695 |
| 16 | Ga0070682_100043431 | 3300005337 | Bacteria | 2779 |
| 17 | Ga0070682_100062132 | 3300005337 | Bacteria | 2365 |
| 18 | Ga0068868_100065499 | 3300005338 | Bacteria | 2886 |
| 19 | Ga0070660_100025356 | 3300005339 | Bacteria | 4408 |
| 20 | Ga0070691_10008877 | 3300005341 | Bacteria | 4603 |
| 21 | Ga0070661_100296579 | 3300005344 | Bacteria | 1257 |
| 22 | Ga0070692_10068094 | 3300005345 | Bacteria | 1891 |
| 23 | Ga0070669_100049397 | 3300005353 | Bacteria | 3071 |
| 24 | Ga0070675_100051130 | 3300005354 | Archaea | 3395 |
| 25 | Ga0070671_100091465 | 3300005355 | Bacteria | 2548 |
| 26 | Ga0070671_100228141 | 3300005355 | Bacteria | 1580 |
| 27 | Ga0070674_100056521 | 3300005356 | Bacteria | 2721 |
| 28 | Ga0070688_100083545 | 3300005365 | Bacteria | 2072 |
| 29 | Ga0070688_100237866 | 3300005365 | Bacteria | 1291 |
| 30 | Ga0070659_100015781 | 3300005366 | Bacteria | 5661 |
| 31 | Ga0070667_100271811 | 3300005367 | Bacteria | 1520 |
| 32 | Ga0070709_10199131 | 3300005434 | Bacteria | 1417 |
| 33 | Ga0070709_10286927 | 3300005434 | Bacteria | 1198 |
| 34 | Ga0070714_100000571 | 3300005435 | Bacteria | 26507 |
| 35 | Ga0070714_100002820 | 3300005435 | Bacteria | 12818 |
| 36 | Ga0070714_100067834 | 3300005435 | Bacteria | 3077 |
| 37 | Ga0070714_100094772 | 3300005435 | Bacteria | 2620 |
| 38 | Ga0070714_100180216 | 3300005435 | Bacteria | 1922 |
| 39 | Ga0070714_100409964 | 3300005435 | Unclassified | 1282 |
| 40 | Ga0070713_100043606 | 3300005436 | Bacteria | 3668 |
| 41 | Ga0070710_10027804 | 3300005437 | Bacteria | 3020 |
| 42 | Ga0070710_10287874 | 3300005437 | Unclassified | 1068 |
| 43 | Ga0070711_100039436 | 3300005439 | Bacteria | 3182 |
| 44 | Ga0070711_100053549 | 3300005439 | Bacteria | 2781 |
| 45 | Ga0070711_100163873 | 3300005439 | Bacteria | 1688 |
| 46 | Ga0070705_100405507 | 3300005440 | Bacteria | 1011 |
| 47 | Ga0070700_100004496 | 3300005441 | Bacteria | 7286 |
| 48 | Ga0070700_100069087 | 3300005441 | Bacteria | 2248 |
| 49 | Ga0070708_100014095 | 3300005445 | Bacteria | 6571 |
| 50 | Ga0070708_100014940 | 3300005445 | Bacteria | 6401 |
| 51 | Ga0070663_100024512 | 3300005455 | Bacteria | 4063 |
| 52 | Ga0070663_100307092 | 3300005455 | Bacteria | 1272 |
| 53 | Ga0070681_10055285 | 3300005458 | Bacteria | 3953 |
| 54 | Ga0070681_10072316 | 3300005458 | Bacteria | 3411 |
| 55 | Ga0068867_100074493 | 3300005459 | Bacteria | 2545 |
| 56 | Ga0068867_100229584 | 3300005459 | Bacteria | 1500 |
| 57 | Ga0070685_10131545 | 3300005466 | Bacteria | 1565 |
| 58 | Ga0070706_100057684 | 3300005467 | Bacteria | 3583 |
| 59 | Ga0070706_100057873 | 3300005467 | Bacteria | 3577 |
| 60 | Ga0070707_100042841 | 3300005468 | Bacteria | 4334 |
| 61 | Ga0070707_100100164 | 3300005468 | Unclassified | 2807 |
| 62 | Ga0070707_100162848 | 3300005468 | Bacteria | 2173 |
| 63 | Ga0070698_100135858 | 3300005471 | Unclassified | 2413 |
| 64 | Ga0070699_100003864 | 3300005518 | Bacteria | 13243 |
| 65 | Ga0070699_100007060 | 3300005518 | Bacteria | 9755 |
| 66 | Ga0070679_100047335 | 3300005530 | Bacteria | 4286 |
| 67 | Ga0070684_100001074 | 3300005535 | Bacteria | 19597 |
| 68 | Ga0070684_100006518 | 3300005535 | Bacteria | 9037 |
| 69 | Ga0070684_100377328 | 3300005535 | Bacteria | 1306 |
| 70 | Ga0070697_100001583 | 3300005536 | Bacteria | 17360 |
| 71 | Ga0070697_100036080 | 3300005536 | Bacteria | 3992 |
| 72 | Ga0068853_100016283 | 3300005539 | Bacteria | 6117 |
| 73 | Ga0068853_100081251 | 3300005539 | Bacteria | 2837 |
| 74 | Ga0070672_100053220 | 3300005543 | Bacteria | 3164 |
| 75 | Ga0070686_100090643 | 3300005544 | Bacteria | 2044 |
| 76 | Ga0070686_100426749 | 3300005544 | Bacteria | 1014 |
| 77 | Ga0070695_100071446 | 3300005545 | Bacteria | 2273 |
| 78 | Ga0070696_100078778 | 3300005546 | Bacteria | 2330 |
| 79 | Ga0070693_100213897 | 3300005547 | Bacteria | 1259 |
| 80 | Ga0070693_100303846 | 3300005547 | Unclassified | 1076 |
| 81 | Ga0070665_100477429 | 3300005548 | Bacteria | 1257 |
| 82 | Ga0070704_100049987 | 3300005549 | Bacteria | 2936 |
| 83 | Ga0068855_100015489 | 3300005563 | Bacteria | 9180 |
| 84 | Ga0068855_100096710 | 3300005563 | Bacteria | 3401 |
| 85 | Ga0070664_100015623 | 3300005564 | Bacteria | 6213 |
| 86 | Ga0070664_100114208 | 3300005564 | Bacteria | 2359 |
| 87 | Ga0070664_100163970 | 3300005564 | Bacteria | 1968 |
| 88 | Ga0070664_100586577 | 3300005564 | Bacteria | 1033 |
| 89 | Ga0068857_100002220 | 3300005577 | Bacteria | 15819 |
| 90 | Ga0068857_100125271 | 3300005577 | Bacteria | 2315 |
| 91 | Ga0068857_100233282 | 3300005577 | Bacteria | 1683 |
| 92 | Ga0068854_100039770 | 3300005578 | Bacteria | 3314 |
| 93 | Ga0068854_100065348 | 3300005578 | Bacteria | 2645 |
| 94 | Ga0070702_100001796 | 3300005615 | Bacteria | 8914 |
| 95 | Ga0070702_100278840 | 3300005615 | Unclassified | 1147 |
| 96 | Ga0068852_100059364 | 3300005616 | Bacteria | 3317 |
| 97 | Ga0068859_100122024 | 3300005617 | Bacteria | 2672 |
| 98 | Ga0068864_100429037 | 3300005618 | Bacteria | 1261 |
| 99 | Ga0068866_10110406 | 3300005718 | Bacteria | 1533 |
| 100 | Ga0068866_10130754 | 3300005718 | Unclassified | 1427 |
| 101 | Ga0068870_10053268 | 3300005840 | Unclassified | 2148 |
| 102 | Ga0068863_100074896 | 3300005841 | Unclassified | 3203 |
| 103 | Ga0068863_100106905 | 3300005841 | Unclassified | 2662 |
| 104 | Ga0068863_100127900 | 3300005841 | Bacteria | 2424 |
| 105 | Ga0068858_100030341 | 3300005842 | Bacteria | 5020 |
| 106 | Ga0068862_100234495 | 3300005844 | Bacteria | 1666 |
| 107 | Ga0068862_100456813 | 3300005844 | Unclassified | 1205 |
| 108 | Ga0081455_10152746 | 3300005937 | Bacteria | 1778 |
| 109 | Ga0081540_1000960 | 3300005983 | Bacteria | 26024 |
| 110 | Ga0070717_10002454 | 3300006028 | Bacteria | 13084 |
| 111 | Ga0070717_10011982 | 3300006028 | Bacteria | 6600 |
| 112 | Ga0070717_10022255 | 3300006028 | Bacteria | 5006 |
| 113 | Ga0070717_10054509 | 3300006028 | Bacteria | 3297 |
| 114 | Ga0070717_10444205 | 3300006028 | Unclassified | 1168 |
| 115 | Ga0070715_10044301 | 3300006163 | Bacteria | 1880 |
| 116 | Ga0070715_10053777 | 3300006163 | Bacteria | 1741 |
| 117 | Ga0070716_100065190 | 3300006173 | Bacteria | 2120 |
| 118 | Ga0070716_100159222 | 3300006173 | Unclassified | 1461 |
| 119 | Ga0070712_100003739 | 3300006175 | Bacteria | 9372 |
| 120 | Ga0070712_100059056 | 3300006175 | Bacteria | 2699 |
| 121 | Ga0070712_100395149 | 3300006175 | Bacteria | 1141 |
| 122 | Ga0075428_100031316 | 3300006844 | Bacteria | 5881 |
| 123 | Ga0075433_10126495 | 3300006852 | Bacteria | 2270 |
| 124 | Ga0075433_10127449 | 3300006852 | Bacteria | 2260 |
| 125 | Ga0075434_100020090 | 3300006871 | Bacteria | 6471 |
| 126 | Ga0075434_100054770 | 3300006871 | Bacteria | 3962 |
| 127 | Ga0075434_100059553 | 3300006871 | Bacteria | 3796 |
| 128 | Ga0075434_100325564 | 3300006871 | Unclassified | 1557 |
| 129 | Ga0075436_100011983 | 3300006914 | Bacteria | 5947 |
| 130 | Ga0075436_100024664 | 3300006914 | Bacteria | 4135 |
| 131 | Ga0075436_100121197 | 3300006914 | Bacteria | 1830 |
| 132 | Ga0097620_100122016 | 3300006931 | Bacteria | 2672 |
| 133 | Ga0075435_100001474 | 3300007076 | Bacteria | 15114 |
| 134 | Ga0075435_100382717 | 3300007076 | Bacteria | 1209 |
| 135 | Ga0075435_100406161 | 3300007076 | Unclassified | 1172 |
| 136 | Ga0105251_10006734 | 3300009011 | Bacteria | 7253 |
| 137 | Ga0105240_10036431 | 3300009093 | Bacteria | 6328 |
| 138 | Ga0105240_10050679 | 3300009093 | Bacteria | 5231 |
| 139 | Ga0111539_10123872 | 3300009094 | Bacteria | 3030 |
| 140 | Ga0105245_10031209 | 3300009098 | Bacteria | 4715 |
| 141 | Ga0105245_10056804 | 3300009098 | Bacteria | 3519 |
| 142 | Ga0105243_10264779 | 3300009148 | Bacteria | 1541 |
| 143 | Ga0105243_10316543 | 3300009148 | Bacteria | 1420 |
| 144 | Ga0105243_10357994 | 3300009148 | Unclassified | 1342 |
| 145 | Ga0105242_10349308 | 3300009176 | Bacteria | 1365 |
| 146 | Ga0105248_10245419 | 3300009177 | Bacteria | 2016 |
| 147 | Ga0105237_10730539 | 3300009545 | Bacteria | 996 |
| 148 | Ga0105238_10024946 | 3300009551 | Bacteria | 6094 |
| 149 | Ga0105238_10177798 | 3300009551 | Archaea | 2105 |
| 150 | Ga0105249_10067884 | 3300009553 | Unclassified | 3286 |
| 151 | Ga0105239_10081700 | 3300010375 | Bacteria | 3557 |
| 152 | Ga0105239_10090796 | 3300010375 | Bacteria | 3370 |
| 153 | Ga0105239_10198183 | 3300010375 | Unclassified | 2249 |
| 154 | Ga0105246_10040995 | 3300011119 | Bacteria | 3128 |
| 155 | Ga0105246_10234326 | 3300011119 | Bacteria | 1447 |
| 156 | Ga0157340_1000629 | 3300012473 | Bacteria | 1412 |
| 157 | Ga0157341_1000713 | 3300012494 | Unclassified | 1781 |
| 158 | Ga0157373_10173909 | 3300013100 | Bacteria | 1515 |
| 159 | Ga0157370_10104729 | 3300013104 | Bacteria | 2648 |
| 160 | Ga0157369_10015673 | 3300013105 | Bacteria | 8541 |
| 161 | Ga0157369_10032006 | 3300013105 | Bacteria | 5786 |
| 162 | Ga0163162_10678033 | 3300013306 | Unclassified | 1153 |
| 163 | Ga0157372_10036896 | 3300013307 | Bacteria | 5390 |
| 164 | Ga0157372_10050511 | 3300013307 | Bacteria | 4626 |
| 165 | Ga0157372_10064531 | 3300013307 | Bacteria | 4108 |
| 166 | Ga0157372_10383973 | 3300013307 | Unclassified | 1636 |
| 167 | Ga0157375_10203252 | 3300013308 | Unclassified | 2137 |
| 168 | Ga0157375_10235167 | 3300013308 | Bacteria | 1991 |
| 169 | Ga0157375_10254717 | 3300013308 | Bacteria | 1916 |
| 170 | Ga0157375_10559765 | 3300013308 | Bacteria | 1304 |
| 171 | Ga0182008_10018503 | 3300014497 | Bacteria | 3607 |
| 172 | Ga0182008_10121672 | 3300014497 | Bacteria | 1297 |
| 173 | Ga0157377_10199815 | 3300014745 | Bacteria | 1268 |
| 174 | Ga0157376_10039381 | 3300014969 | Bacteria | 3854 |
| 175 | Ga0157376_10121232 | 3300014969 | Bacteria | 2318 |
| 176 | Ga0206356_11051677 | 3300020070 | Bacteria | 1490 |
| 177 | Ga0206354_11605644 | 3300020081 | Bacteria | 1194 |
| 178 | Ga0213875_10025073 | 3300021388 | Bacteria | 2842 |
| 179 | Ga0213875_10083614 | 3300021388 | Bacteria | 1489 |
| 180 | Ga0213875_10163877 | 3300021388 | Archaea | 1043 |
| 181 | Ga0224572_1000484 | 3300024225 | Bacteria | 4731 |
| 182 | Ga0209147_100185 | 3300025229 | Bacteria | 74400 |
| 183 | Ga0209675_1016815 | 3300025291 | Bacteria | 2114 |
| 184 | Ga0209676_1000894 | 3300025292 | Bacteria | 37859 |
| 185 | Ga0209025_1000156 | 3300025294 | Bacteria | 168932 |
| 186 | Ga0209025_1000266 | 3300025294 | Bacteria | 122782 |
| 187 | Ga0209025_1002044 | 3300025294 | Bacteria | 22998 |
| 188 | Ga0207692_10012847 | 3300025898 | Bacteria | 3612 |
| 189 | Ga0207692_10048694 | 3300025898 | Bacteria | 2135 |
| 190 | Ga0207692_10119751 | 3300025898 | Bacteria | 1472 |
| 191 | Ga0207642_10049850 | 3300025899 | Bacteria | 1885 |
| 192 | Ga0207710_10199758 | 3300025900 | Unclassified | 987 |
| 193 | Ga0207688_10065380 | 3300025901 | Bacteria | 2055 |
| 194 | Ga0207688_10065505 | 3300025901 | Bacteria | 2053 |
| 195 | Ga0207688_10099700 | 3300025901 | Bacteria | 1676 |
| 196 | Ga0207647_10046501 | 3300025904 | Bacteria | 2704 |
| 197 | Ga0207699_10014503 | 3300025906 | Bacteria | 4064 |
| 198 | Ga0207699_10045334 | 3300025906 | Bacteria | 2566 |
| 199 | Ga0207684_10098692 | 3300025910 | Bacteria | 2494 |
| 200 | Ga0207707_10029522 | 3300025912 | Bacteria | 4795 |
| 201 | Ga0207707_10207299 | 3300025912 | Unclassified | 1708 |
| 202 | Ga0207695_10039026 | 3300025913 | Bacteria | 5106 |
| 203 | Ga0207671_10384868 | 3300025914 | Unclassified | 1115 |
| 204 | Ga0207693_10006652 | 3300025915 | Bacteria | 9549 |
| 205 | Ga0207693_10015287 | 3300025915 | Bacteria | 6159 |
| 206 | Ga0207693_10015563 | 3300025915 | Bacteria | 6101 |
| 207 | Ga0207693_10291620 | 3300025915 | Unclassified | 1279 |
| 208 | Ga0207663_10035875 | 3300025916 | Bacteria | 2979 |
| 209 | Ga0207660_10017464 | 3300025917 | Bacteria | 4768 |
| 210 | Ga0207662_10005891 | 3300025918 | Bacteria | 6575 |
| 211 | Ga0207657_10025473 | 3300025919 | Bacteria | 5455 |
| 212 | Ga0207657_10035368 | 3300025919 | Bacteria | 4480 |
| 213 | Ga0207657_10229767 | 3300025919 | Bacteria | 1484 |
| 214 | Ga0207652_10010567 | 3300025921 | Bacteria | 7430 |
| 215 | Ga0207652_10090861 | 3300025921 | Unclassified | 2684 |
| 216 | Ga0207652_10205800 | 3300025921 | Bacteria | 1771 |
| 217 | Ga0207646_10014587 | 3300025922 | Bacteria | 7452 |
| 218 | Ga0207646_10029359 | 3300025922 | Bacteria | 5000 |
| 219 | Ga0207646_10144966 | 3300025922 | Unclassified | 2140 |
| 220 | Ga0207694_10042063 | 3300025924 | Bacteria | 3523 |
| 221 | Ga0207687_10112473 | 3300025927 | Bacteria | 2024 |
| 222 | Ga0207700_10010846 | 3300025928 | Bacteria | 5781 |
| 223 | Ga0207700_10020917 | 3300025928 | Bacteria | 4455 |
| 224 | Ga0207700_10055317 | 3300025928 | Bacteria | 2983 |
| 225 | Ga0207700_10074372 | 3300025928 | Bacteria | 2628 |
| 226 | Ga0207700_10191624 | 3300025928 | Bacteria | 1718 |
| 227 | Ga0207700_10357704 | 3300025928 | Bacteria | 1272 |
| 228 | Ga0207664_10000445 | 3300025929 | Bacteria | 29415 |
| 229 | Ga0207664_10025999 | 3300025929 | Bacteria | 4418 |
| 230 | Ga0207664_10047957 | 3300025929 | Bacteria | 3358 |
| 231 | Ga0207664_10160424 | 3300025929 | Bacteria | 1918 |
| 232 | Ga0207664_10210468 | 3300025929 | Bacteria | 1682 |
| 233 | Ga0207664_10250292 | 3300025929 | Bacteria | 1546 |
| 234 | Ga0207644_10214275 | 3300025931 | Bacteria | 1524 |
| 235 | Ga0207690_10267689 | 3300025932 | Bacteria | 1326 |
| 236 | Ga0207686_10032216 | 3300025934 | Bacteria | 3118 |
| 237 | Ga0207686_10066459 | 3300025934 | Bacteria | 2303 |
| 238 | Ga0207670_10482737 | 3300025936 | Bacteria | 1004 |
| 239 | Ga0207669_10023264 | 3300025937 | Bacteria | 3307 |
| 240 | Ga0207704_10206725 | 3300025938 | Bacteria | 1441 |
| 241 | Ga0207665_10007675 | 3300025939 | Bacteria | 7121 |
| 242 | Ga0207665_10025061 | 3300025939 | Bacteria | 3934 |
| 243 | Ga0207665_10051925 | 3300025939 | Bacteria | 2761 |
| 244 | Ga0207691_10041336 | 3300025940 | Bacteria | 4257 |
| 245 | Ga0207691_10097817 | 3300025940 | Bacteria | 2623 |
| 246 | Ga0207689_10002974 | 3300025942 | Bacteria | 15633 |
| 247 | Ga0207661_10016523 | 3300025944 | Bacteria | 5446 |
| 248 | Ga0207661_10102502 | 3300025944 | Bacteria | 2406 |
| 249 | Ga0207661_10169543 | 3300025944 | Bacteria | 1899 |
| 250 | Ga0207679_10052131 | 3300025945 | Bacteria | 2999 |
| 251 | Ga0207679_10124260 | 3300025945 | Bacteria | 2060 |
| 252 | Ga0207651_10151291 | 3300025960 | Bacteria | 1807 |
| 253 | Ga0207712_10202979 | 3300025961 | Bacteria | 1573 |
| 254 | Ga0207640_10101012 | 3300025981 | Bacteria | 2023 |
| 255 | Ga0207677_10039108 | 3300026023 | Bacteria | 3116 |
| 256 | Ga0207677_10473069 | 3300026023 | Bacteria | 1078 |
| 257 | Ga0207703_10181253 | 3300026035 | Bacteria | 1859 |
| 258 | Ga0207703_10240455 | 3300026035 | Bacteria | 1628 |
| 259 | Ga0207639_10000790 | 3300026041 | Bacteria | 21568 |
| 260 | Ga0207639_10275171 | 3300026041 | Bacteria | 1478 |
| 261 | Ga0207678_10004476 | 3300026067 | Bacteria | 12564 |
| 262 | Ga0207708_10005669 | 3300026075 | Bacteria | 9221 |
| 263 | Ga0207708_10008536 | 3300026075 | Bacteria | 7582 |
| 264 | Ga0207702_10004942 | 3300026078 | Bacteria | 11714 |
| 265 | Ga0207641_10033927 | 3300026088 | Bacteria | 4243 |
| 266 | Ga0207641_10474744 | 3300026088 | Unclassified | 1211 |
| 267 | Ga0207648_10061374 | 3300026089 | Bacteria | 3278 |
| 268 | Ga0207648_10065089 | 3300026089 | Bacteria | 3178 |
| 269 | Ga0207648_10077566 | 3300026089 | Bacteria | 2897 |
| 270 | Ga0207676_10275368 | 3300026095 | Bacteria | 1526 |
| 271 | Ga0207676_10676640 | 3300026095 | Bacteria | 998 |
| 272 | Ga0207674_10000753 | 3300026116 | Bacteria | 42280 |
| 273 | Ga0207674_10001849 | 3300026116 | Bacteria | 26988 |
| 274 | Ga0207674_10011814 | 3300026116 | Bacteria | 9792 |
| 275 | Ga0207674_10369859 | 3300026116 | Bacteria | 1386 |
| 276 | Ga0207675_100058732 | 3300026118 | Bacteria | 3590 |
| 277 | Ga0207675_100129362 | 3300026118 | Bacteria | 2394 |
| 278 | Ga0207683_10001068 | 3300026121 | Bacteria | 24993 |
| 279 | Ga0207698_10159078 | 3300026142 | Bacteria | 1973 |
| 280 | Ga0207698_10244053 | 3300026142 | Bacteria | 1639 |
| 281 | Ga0207698_10526769 | 3300026142 | Bacteria | 1154 |
| 282 | Ga0268265_10131784 | 3300028380 | Bacteria | 2079 |
| 283 | Ga0268264_10297598 | 3300028381 | Bacteria | 1518 |
| 284 | Ga0316579_10002064 | 3300031691 | Bacteria | 7529 |
| 285 | Ga0316579_10085107 | 3300031691 | Bacteria | 1508 |
| 286 | Ga0316576_10009479 | 3300031727 | Bacteria | 6286 |
| 287 | Ga0316578_10002124 | 3300031728 | Bacteria | 8516 |
| 288 | Ga0316578_10013717 | 3300031728 | Unclassified | 4306 |
| 289 | Ga0316577_10069910 | 3300031733 | Bacteria | 1960 |
| 290 | Ga0307409_100156960 | 3300031995 | Bacteria | 1984 |
| 291 | Ga0307416_100070030 | 3300032002 | Bacteria | 2906 |
| 292 | Ga0316580_10006054 | 3300032139 | Bacteria | 3553 |
| 293 | Ga0373958_0003432 | 3300034819 | Bacteria | 2284 |
| 294 | Ga0373926_0000233 | 3300035083 | Bacteria | 13283 |
| 295 | Ga0373926_0020150 | 3300035083 | Viruses | 2303 |
| 296 | Ga0373928_0003496 | 3300035084 | Bacteria | 2993 |
| 297 | Ga0373929_0013105 | 3300035085 | Bacteria | 1585 |
| 298 | Ga0373934_0001197 | 3300035086 | Bacteria | 9395 |
| 299 | Ga0373940_0009897 | 3300035088 | Bacteria | 2229 |
| 300 | Ga0373940_0024993 | 3300035088 | Bacteria | 1553 |
| 301 | Ga0373923_0000368 | 3300035111 | Bacteria | 10255 |
| 302 | Ga0373923_0064601 | 3300035111 | Bacteria | 1561 |
| 303 | Ga0373936_0000332 | 3300035113 | Bacteria | 15992 |
| 304 | Ga0373936_0000759 | 3300035113 | Bacteria | 11330 |
| 305 | Ga0373936_0001867 | 3300035113 | Bacteria | 7771 |
| 306 | Ga0373939_0094187 | 3300035114 | Unclassified | 1017 |
| 307 | Ga0373945_0003452 | 3300035116 | Bacteria | 4970 |
| 308 | Ga0373945_0004321 | 3300035116 | Bacteria | 4515 |
| 309 | Ga0373945_0012136 | 3300035116 | Viruses | 2857 |
| 310 | Ga0373953_0012436 | 3300035117 | Bacteria | 3014 |
| 311 | Ga0373953_0026368 | 3300035117 | Bacteria | 2226 |
| 312 | Ga0373956_0023579 | 3300035119 | Bacteria | 2642 |
| 313 | Ga0373957_0000649 | 3300035120 | Bacteria | 8918 |
| 314 | Ga0373957_0053204 | 3300035120 | Bacteria | 1553 |
| 315 | Ga0373960_0047677 | 3300035121 | Bacteria | 1261 |
| 316 | Ga0373943_0002340 | 3300035170 | Bacteria | 8608 |
| 317 | Ga0373943_0351433 | 3300035170 | Unclassified | 845 |
| 318 | Ga0373946_0000335 | 3300035171 | Bacteria | 15151 |
| 319 | Ga0373946_0000938 | 3300035171 | Bacteria | 9982 |
| 320 | Ga0373955_0008851 | 3300035172 | Bacteria | 4693 |
| 321 | Ga0373955_0022019 | 3300035172 | Bacteria | 3226 |
| 322 | Ga0373955_0024714 | 3300035172 | Bacteria | 3075 |
| 323 | Ga0373942_0010327 | 3300035207 | Bacteria | 2196 |
| 324 | Ga0373961_0058086 | 3300035241 | Unclassified | 1166 |
| 325 | Ga0373961_0067867 | 3300035241 | Bacteria | 1097 |
| 326 | Ga0316574_0032187 | 3300035398 | Bacteria | 3185 |
| 327 | Ga0316574_0124480 | 3300035398 | Bacteria | 1656 |
| 328 | Ga0373924_0000149 | 3300035410 | Bacteria | 20536 |
| 329 | Ga0373935_0001103 | 3300035692 | Bacteria | 14736 |
| 330 | Ga0373935_0014038 | 3300035692 | Bacteria | 4837 |
| 331 | Ga0373927_0002493 | 3300035695 | Bacteria | 13436 |
| 332 | Ga0373927_0002623 | 3300035695 | Bacteria | 13111 |
| 333 | Ga0373927_0003833 | 3300035695 | Bacteria | 10679 |
| 334 | Ga0373933_0111668 | 3300035724 | Bacteria | 1705 |
| 335 | Ga0373933_0365269 | 3300035724 | Bacteria | 939 |
| 336 | Ga0373947_0001226 | 3300035725 | Bacteria | 15805 |
| 337 | Ga0373947_0002538 | 3300035725 | Bacteria | 10969 |
| 338 | Ga0373937_0081189 | 3300036401 | Bacteria | 2999 |
| 339 | Ga0373937_0103854 | 3300036401 | Bacteria | 2639 |
| 340 | Ga0373937_0141771 | 3300036401 | Bacteria | 2249 |
| 341 | Ga0373937_0169732 | 3300036401 | Bacteria | 2047 |
| 342 | Ga0372808_006094 | 3300036459 | Archaea | 1615 |
| 343 | Ga0316582_0065888 | 3300036647 | Unclassified | 2333 |
| 344 | Ga0316584_0006901 | 3300036712 | Bacteria | 7718 |
| 345 | Ga0373925_0000090 | 3300037068 | Bacteria | 97041 |
| 346 | Ga0373925_0000850 | 3300037068 | Bacteria | 27976 |
| 347 | Ga0373925_0001846 | 3300037068 | Bacteria | 17627 |
| 348 | Ga0373925_0208439 | 3300037068 | Bacteria | 1556 |
| 349 | Ga0373925_0338974 | 3300037068 | Unclassified | 1219 |
| 350 | Ga0395899_0160555 | 3300037312 | Unclassified | 1588 |
| 351 | Ga0395900_0042286 | 3300037418 | Bacteria | 4694 |
| 352 | Ga0395898_0001544 | 3300037466 | Bacteria | 31660 |
| 353 | Ga0395905_0043751 | 3300037471 | Unclassified | 4200 |
| 354 | Ga0436364_0169355 | 3300037853 | Archaea | 1269 |
| 355 | Ga0436364_0615851 | 3300037853 | Bacteria | 4228 |
| 356 | Ga0436364_0780939 | 3300037853 | Bacteria | 2034 |
| 357 | Ga0436364_1010902 | 3300037853 | Bacteria | 1346 |
| 358 | Ga0436364_1265507 | 3300037853 | Bacteria | 48294 |
| 359 | Ga0395901_0034710 | 3300038443 | Bacteria | 5209 |
| 360 | Ga0395901_0538629 | 3300038443 | Bacteria | 1184 |
| 361 | Ga0436365_1875564 | 3300039437 | Bacteria | 1574 |
| 362 | Ga0451789_0997059 | 3300041443 | Bacteria | 2374 |
| 363 | Ga0451793_0874875 | 3300041452 | Bacteria | 1746 |
| 364 | Ga0451802_1084279 | 3300041460 | Bacteria | 1585 |
| 365 | Ga0451839_1302848 | 3300041496 | Bacteria | 1465 |
| 366 | Ga0451847_0962632 | 3300041503 | Unclassified | 1208 |
| 367 | Ga0466972_0115555 | 3300044658 | Bacteria | 1267 |
| 368 | Ga0466972_0118046 | 3300044658 | Bacteria | 1252 |
| 369 | Ga0466965_0100617 | 3300044683 | Bacteria | 1478 |
| 370 | Ga0466961_0025745 | 3300044693 | Bacteria | 3782 |
| 371 | Ga0466963_0000657 | 3300044694 | Bacteria | 16663 |
| 372 | Ga0466963_0004204 | 3300044694 | Bacteria | 8347 |
| 373 | Ga0466963_0057602 | 3300044694 | Bacteria | 2588 |
| 374 | Ga0466963_0231642 | 3300044694 | Bacteria | 1294 |
| 375 | Ga0466964_0007740 | 3300044706 | Bacteria | 4020 |
| 376 | Ga0466964_0009644 | 3300044706 | Bacteria | 3637 |
| 377 | Ga0453684_0000637 | 3300044712 | Bacteria | 126612 |
| 378 | Ga0453684_0248124 | 3300044712 | Bacteria | 2046 |
| 379 | Ga0466971_0015433 | 3300044719 | Bacteria | 3363 |
| 380 | Ga0466968_0054715 | 3300044735 | Bacteria | 1711 |
| 381 | Ga0466968_0069678 | 3300044735 | Bacteria | 1529 |
| 382 | Ga0466970_0029600 | 3300044765 | Bacteria | 2884 |
| 383 | Ga0466970_0047398 | 3300044765 | Bacteria | 2290 |
| 384 | Ga0466957_0019411 | 3300044842 | Bacteria | 3999 |
| 385 | Ga0466960_0005280 | 3300044901 | Bacteria | 5107 |
| 386 | Ga0466960_0007387 | 3300044901 | Bacteria | 4463 |
| 387 | Ga0466959_0135036 | 3300045049 | Archaea | 1747 |
| 388 | Ga0466958_0011146 | 3300045836 | Bacteria | 5058 |
| 389 | Ga0466958_0074237 | 3300045836 | Bacteria | 2084 |
| 390 | Ga0466958_0084848 | 3300045836 | Bacteria | 1953 |
| 391 | Ga0466958_0124292 | 3300045836 | Archaea | 1617 |
| 392 | Ga0466967_0004460 | 3300045976 | Bacteria | 9444 |
| 393 | Ga0466967_0012064 | 3300045976 | Bacteria | 6587 |
| 394 | Ga0466967_0040417 | 3300045976 | Bacteria | 4015 |
| 395 | Ga0466967_0172197 | 3300045976 | Bacteria | 2038 |
| 396 | Ga0466967_0183233 | 3300045976 | Bacteria | 1976 |
| 397 | Ga0466967_0239497 | 3300045976 | Unclassified | 1730 |
| 398 | Ga0466967_0269459 | 3300045976 | Bacteria | 1631 |
| 399 | Ga0495592_0023534 | 3300046454 | Bacteria | 4685 |
| 400 | Ga0495592_0062662 | 3300046454 | Bacteria | 2729 |
| 401 | Ga0495603_0001384 | 3300046455 | Bacteria | 14074 |
| 402 | Ga0495629_0176487 | 3300046459 | Unclassified | 1481 |
| 403 | Ga0495629_0197259 | 3300046459 | Unclassified | 1392 |
| 404 | Ga0495641_0005794 | 3300046461 | Bacteria | 8201 |
| 405 | Ga0495641_0006776 | 3300046461 | Bacteria | 7342 |
| 406 | Ga0495651_0011607 | 3300046462 | Bacteria | 6770 |
| 407 | Ga0495651_0221417 | 3300046462 | Bacteria | 1309 |
| 408 | Ga0495653_0001704 | 3300046463 | Bacteria | 17301 |
| 409 | Ga0495653_0004084 | 3300046463 | Bacteria | 11807 |
| 410 | Ga0495653_0050859 | 3300046463 | Unclassified | 3185 |
| 411 | Ga0495580_0009285 | 3300046472 | Bacteria | 7738 |
| 412 | Ga0495582_0000407 | 3300046473 | Bacteria | 23526 |
| 413 | Ga0495639_0000391 | 3300046475 | Bacteria | 20675 |
| 414 | Ga0495662_0000493 | 3300046476 | Bacteria | 17984 |
| 415 | Ga0495664_0000415 | 3300046477 | Bacteria | 20829 |
| 416 | Ga0495664_0002387 | 3300046477 | Bacteria | 10069 |
| 417 | Ga0495664_0023838 | 3300046477 | Bacteria | 3553 |
| 418 | Ga0495664_0046607 | 3300046477 | Bacteria | 2572 |
| 419 | Ga0495594_0021785 | 3300046499 | Bacteria | 3422 |
| 420 | Ga0495608_0008633 | 3300046511 | Bacteria | 7133 |
| 421 | Ga0495608_0027903 | 3300046511 | Bacteria | 3838 |
| 422 | Ga0495608_0074766 | 3300046511 | Bacteria | 2208 |
| 423 | Ga0495618_0008569 | 3300046514 | Bacteria | 6175 |
| 424 | Ga0495618_0024245 | 3300046514 | Bacteria | 3755 |
| 425 | Ga0495618_0054451 | 3300046514 | Bacteria | 2532 |
| 426 | Ga0495628_0021128 | 3300046516 | Bacteria | 5360 |
| 427 | Ga0495628_0022468 | 3300046516 | Bacteria | 5181 |
| 428 | Ga0495628_0252153 | 3300046516 | Bacteria | 1317 |
| 429 | Ga0495630_0008416 | 3300046517 | Bacteria | 7397 |
| 430 | Ga0495630_0100056 | 3300046517 | Bacteria | 2193 |
| 431 | Ga0495666_0003061 | 3300046526 | Bacteria | 8407 |
| 432 | Ga0495652_0041143 | 3300046529 | Bacteria | 3991 |
| 433 | Ga0495652_0072729 | 3300046529 | Bacteria | 2864 |
| 434 | Ga0495652_0306066 | 3300046529 | Unclassified | 1153 |
| 435 | Ga0495665_0000203 | 3300046531 | Bacteria | 30479 |
| 436 | Ga0495665_0072436 | 3300046531 | Bacteria | 1814 |
| 437 | Ga0495640_0002455 | 3300046533 | Bacteria | 14897 |
| 438 | Ga0495640_0078569 | 3300046533 | Bacteria | 2198 |
| 439 | Ga0495586_0021660 | 3300046535 | Bacteria | 3428 |
| 440 | Ga0495587_0031738 | 3300046536 | Bacteria | 3196 |
| 441 | Ga0495587_0032805 | 3300046536 | Bacteria | 3137 |
| 442 | Ga0495645_0002225 | 3300046543 | Bacteria | 13197 |
| 443 | Ga0495645_0026724 | 3300046543 | Bacteria | 4190 |
| 444 | Ga0495645_0093314 | 3300046543 | Bacteria | 2148 |
| 445 | Ga0495645_0310668 | 3300046543 | Unclassified | 1027 |
| 446 | Ga0495667_0003066 | 3300046559 | Bacteria | 11209 |
| 447 | Ga0495667_0003068 | 3300046559 | Bacteria | 11207 |
| 448 | Ga0495667_0004958 | 3300046559 | Bacteria | 9000 |
| 449 | Ga0495667_0027446 | 3300046559 | Bacteria | 3836 |
| 450 | Ga0495667_0066885 | 3300046559 | Bacteria | 2349 |
| 451 | Ga0495634_0062452 | 3300046642 | Bacteria | 2473 |
| 452 | Ga0495634_0098453 | 3300046642 | Bacteria | 1892 |
| 453 | Ga0495634_0182134 | 3300046642 | Bacteria | 1314 |
| 454 | Ga0495635_0001917 | 3300046663 | Bacteria | 14144 |
| 455 | Ga0495635_0019018 | 3300046663 | Bacteria | 4794 |
| 456 | Ga0495635_0019571 | 3300046663 | Bacteria | 4717 |
| 457 | Ga0495635_0115915 | 3300046663 | Bacteria | 1828 |
| 458 | Ga0495635_0132894 | 3300046663 | Bacteria | 1696 |
| 459 | Ga0495588_0096936 | 3300046674 | Unclassified | 1547 |
| 460 | Ga0495657_0001013 | 3300046675 | Bacteria | 24756 |
| 461 | Ga0495657_0037137 | 3300046675 | Bacteria | 3360 |
| 462 | Ga0495599_0007561 | 3300046678 | Bacteria | 6592 |
| 463 | Ga0495599_0009462 | 3300046678 | Bacteria | 5955 |
| 464 | Ga0495599_0010549 | 3300046678 | Bacteria | 5652 |
| 465 | Ga0495623_0040098 | 3300046679 | Bacteria | 2991 |
| 466 | Ga0495623_0109161 | 3300046679 | Bacteria | 1678 |
| 467 | Ga0495646_0002110 | 3300046680 | Bacteria | 12063 |
| 468 | Ga0495646_0011112 | 3300046680 | Bacteria | 5717 |
| 469 | Ga0495613_0112327 | 3300046689 | Bacteria | 1962 |
| 470 | Ga0495624_0004261 | 3300046690 | Bacteria | 10510 |
| 471 | Ga0495624_0013807 | 3300046690 | Bacteria | 5499 |
| 472 | Ga0495600_0003141 | 3300046809 | Bacteria | 9663 |
| 473 | Ga0495600_0007737 | 3300046809 | Bacteria | 6580 |
| 474 | Ga0495600_0014351 | 3300046809 | Bacteria | 4992 |
| 475 | Ga0495581_0000558 | 3300047315 | Bacteria | 19300 |
| 476 | Ga0495581_0017466 | 3300047315 | Bacteria | 4167 |
| 477 | Ga0495604_0001612 | 3300047317 | Bacteria | 18606 |
| 478 | Ga0495604_0052410 | 3300047317 | Bacteria | 3159 |
| 479 | Ga0495604_0066332 | 3300047317 | Bacteria | 2746 |
| 480 | Ga0495674_0000802 | 3300047319 | Bacteria | 29886 |
| 481 | Ga0495674_0004462 | 3300047319 | Bacteria | 13465 |
| 482 | Ga0495674_0004962 | 3300047319 | Bacteria | 12804 |
| 483 | Ga0495676_0002197 | 3300047321 | Bacteria | 17289 |
| 484 | Ga0495676_0037932 | 3300047321 | Bacteria | 4006 |
| 485 | Ga0495676_0213163 | 3300047321 | Bacteria | 1335 |
| 486 | Ga0495680_0004401 | 3300047322 | Bacteria | 13481 |
| 487 | Ga0495680_0006672 | 3300047322 | Bacteria | 10690 |
| 488 | Ga0495680_0007158 | 3300047322 | Bacteria | 10278 |
| 489 | Ga0495680_0016763 | 3300047322 | Bacteria | 6281 |
| 490 | Ga0495680_0175183 | 3300047322 | Bacteria | 1551 |
| 491 | Ga0495680_0231820 | 3300047322 | Unclassified | 1314 |
| 492 | Ga0495684_0002648 | 3300047471 | Bacteria | 14216 |
| 493 | Ga0495684_0002672 | 3300047471 | Bacteria | 14126 |
| 494 | Ga0495684_0010540 | 3300047471 | Bacteria | 7145 |
| 495 | Ga0495684_0028645 | 3300047471 | Bacteria | 4276 |
| 496 | Ga0495593_0002039 | 3300047673 | Bacteria | 12048 |
| 497 | Ga0495593_0059112 | 3300047673 | Bacteria | 2009 |
| 498 | Ga0495602_0071990 | 3300048088 | Bacteria | 2950 |
| 499 | Ga0495602_0299592 | 3300048088 | Bacteria | 1177 |
| 500 | Ga0496100_0014151 | 3300048903 | Bacteria | 4624 |
| 501 | Ga0496100_0141744 | 3300048903 | Bacteria | 1704 |
| 502 | Ga0496100_0143078 | 3300048903 | Bacteria | 1697 |
| 503 | Ga0496100_0277858 | 3300048903 | Bacteria | 1247 |
| 504 | Ga0496100_0299441 | 3300048903 | Bacteria | 1203 |
| 505 | Ga0496101_0012202 | 3300048904 | Bacteria | 5729 |
| 506 | Ga0496101_0084220 | 3300048904 | Bacteria | 2354 |
| 507 | Ga0496101_0288148 | 3300048904 | Bacteria | 1284 |
| 508 | Ga0496101_0296175 | 3300048904 | Bacteria | 1266 |
| 509 | Ga0496102_0453020 | 3300048905 | Bacteria | 1204 |
| 510 | Ga0496104_0049895 | 3300048907 | Bacteria | 3947 |
| 511 | Ga0496104_0104002 | 3300048907 | Bacteria | 2720 |
| 512 | Ga0496104_0419782 | 3300048907 | Bacteria | 1250 |
| 513 | Ga0496105_0011938 | 3300048908 | Bacteria | 6878 |
| 514 | Ga0496106_0003655 | 3300048909 | Bacteria | 11467 |
| 515 | Ga0496106_0014877 | 3300048909 | Bacteria | 5756 |
| 516 | Ga0496106_0100496 | 3300048909 | Bacteria | 2243 |
| 517 | Ga0496107_0072268 | 3300048910 | Bacteria | 2508 |
| 518 | Ga0496107_0110430 | 3300048910 | Bacteria | 2020 |
| 519 | Ga0496107_0166516 | 3300048910 | Bacteria | 1634 |
| 520 | Ga0496107_0238738 | 3300048910 | Bacteria | 1352 |
| 521 | Ga0496108_0057249 | 3300048911 | Bacteria | 3275 |
| 522 | Ga0496108_0120493 | 3300048911 | Unclassified | 2250 |
| 523 | Ga0496108_0429081 | 3300048911 | Unclassified | 1154 |
| 524 | Ga0496109_0007222 | 3300048912 | Bacteria | 9393 |
| 525 | Ga0496109_0040707 | 3300048912 | Bacteria | 4209 |
| 526 | Ga0496109_0076060 | 3300048912 | Bacteria | 3087 |
| 527 | Ga0496109_0287387 | 3300048912 | Bacteria | 1550 |
| 528 | Ga0496109_0303163 | 3300048912 | Bacteria | 1507 |
| 529 | Ga0496110_0003005 | 3300048913 | Bacteria | 12787 |
| 530 | Ga0496110_0177865 | 3300048913 | Bacteria | 1931 |
| 531 | Ga0496110_0219237 | 3300048913 | Bacteria | 1730 |
| 532 | Ga0496111_0043112 | 3300048914 | Bacteria | 3242 |
| 533 | Ga0496111_0046891 | 3300048914 | Bacteria | 3112 |
| 534 | Ga0496112_0148808 | 3300048915 | Unclassified | 2309 |
| 535 | Ga0496112_0260199 | 3300048915 | Bacteria | 1684 |
| 536 | Ga0496113_0125108 | 3300048916 | Bacteria | 2013 |
| 537 | Ga0496113_0328851 | 3300048916 | Unclassified | 1225 |
| 538 | Ga0496114_0012612 | 3300048917 | Bacteria | 6770 |
| 539 | Ga0496114_0086187 | 3300048917 | Bacteria | 2661 |
| 540 | Ga0496114_0106243 | 3300048917 | Bacteria | 2402 |
| 541 | Ga0496114_0356030 | 3300048917 | Bacteria | 1295 |
| 542 | Ga0496114_0550517 | 3300048917 | Bacteria | 1019 |
| 543 | Ga0496115_0026429 | 3300048918 | Bacteria | 4531 |
| 544 | Ga0496115_0108049 | 3300048918 | Bacteria | 2284 |
| 545 | Ga0496115_0493052 | 3300048918 | Bacteria | 985 |
| 546 | Ga0496126_0178026 | 3300048929 | Unclassified | 1808 |
| 547 | Ga0501034_0230371 | 3300049571 | Bacteria | 1802 |
| 548 | Ga0501067_0000005 | 3300049583 | Bacteria | 127875 |
| 549 | Ga0501067_0044797 | 3300049583 | Bacteria | 2458 |
| 550 | Ga0501068_0001488 | 3300049584 | Bacteria | 12471 |
| 551 | Ga0501069_0000023 | 3300049585 | Bacteria | 118054 |
| 552 | Ga0501069_0004380 | 3300049585 | Bacteria | 7290 |
| 553 | Ga0501070_0024826 | 3300049586 | Bacteria | 5026 |
| 554 | Ga0501080_0123392 | 3300049742 | Unclassified | 2399 |
| 555 | Ga0501083_0021124 | 3300049744 | Bacteria | 4525 |
| 556 | nmdc:mga05p37_127560_c1 | 3300050507 | Bacteria | 3123 |
| 557 | nmdc:mga05p37_17739_c1 | 3300050507 | Bacteria | 8590 |
| 558 | nmdc:mga0qj67_159128_c1 | 3300050509 | Bacteria | 1833 |
| 559 | nmdc:mga0qj67_429219_c1 | 3300050509 | Bacteria | 1065 |
| 560 | nmdc:mga08y16_327080_c1 | 3300050511 | Unclassified | 1577 |
| 561 | nmdc:mga0n895_147676_c1 | 3300050512 | Bacteria | 2381 |
| 562 | nmdc:mga0n895_153921_c1 | 3300050512 | Bacteria | 2330 |
| 563 | nmdc:mga0n895_227030_c1 | 3300050512 | Bacteria | 1895 |
| 564 | nmdc:mga08x19_15855_c1 | 3300050514 | Bacteria | 4589 |
| 565 | nmdc:mga0a205_40408_c1 | 3300050515 | Bacteria | 4490 |
| 566 | Ga0495601_0041771 | 3300053077 | Bacteria | 2875 |
| 567 | Ga0495612_0005877 | 3300053078 | Bacteria | 5062 |
| 568 | Ga0495619_0003799 | 3300053085 | Bacteria | 9713 |
| 569 | Ga0495619_0053133 | 3300053085 | Bacteria | 2679 |
| 570 | Ga0501082_0005337 | 3300060353 | Bacteria | 11166 |
| 571 | Ga0530510_0027875 | 3300061734 | Bacteria | 4048 |
| 572 | Ga0530510_0106621 | 3300061734 | Bacteria | 2050 |
| 573 | Ga0530510_0242621 | 3300061734 | Unclassified | 1342 |
| 574 | 2595087967 | 2593339131 | Bacteria | 5116855 |
| 575 | 2738813096 | 2738541295 | Bacteria | 5730091 |
| 576 | 2738839929 | 2738541299 | Bacteria | 4020721 |
| 577 | 2739268093 | 2738543017 | Bacteria | 4271950 |
| 578 | 2757565936 | 2757320391 | Bacteria | 4746095 |
| 579 | 2777762279 | 2775507177 | Bacteria | 4384303 |
| 580 | 2777839444 | 2775507192 | Bacteria | 4622234 |
| 581 | 2857587001 | 2857586860 | Bacteria | 4354574 |
| 582 | 2936341762 | 2936340661 | Bacteria | 5139038 |
| 583 | 2936365957 | 2936361878 | Bacteria | 5632809 |
| 584 | 2964378470 | 2964375228 | Bacteria | 4909004 |
| 585 | 2977257565 | 2977254563 | Bacteria | 4828420 |
| 586 | 2990278538 | 2990275345 | Bacteria | 4887158 |
| 587 | Ga0105238_10081326 | |||
| 588 | JGI25151J46595_10000173 | |||
| 589 | JGI25151J46595_10002674 | |||
| 590 | JGI25151J46595_10009911 | |||
| 591 | Ga0055532_1000222 | |||
| 592 | Ga0070683_100002597 | |||
| 593 | Ga0070683_100018897 | |||
| 594 | Ga0070683_100079568 | |||
| 595 | Ga0070683_100087734 | |||
| 596 | Ga0070683_100093955 | |||
| 597 | Ga0070690_100047267 | |||
| 598 | Ga0070690_100052824 | |||
| 599 | Ga0070670_100376556 | |||
| 600 | Ga0068869_100109751 | |||
| 601 | Ga0070680_100017218 | |||
| 602 | Ga0070682_100043431 | |||
| 603 | Ga0070682_100062132 | |||
| 604 | Ga0068868_100065499 | |||
| 605 | Ga0070660_100025356 | |||
| 606 | Ga0070691_10008877 | |||
| 607 | Ga0070661_100296579 | |||
| 608 | Ga0070692_10068094 | |||
| 609 | Ga0070669_100049397 | |||
| 610 | Ga0070675_100051130 | |||
| 611 | Ga0070671_100091465 | |||
| 612 | Ga0070671_100228141 | |||
| 613 | Ga0070674_100056521 | |||
| 614 | Ga0070688_100083545 | |||
| 615 | Ga0070688_100237866 | |||
| 616 | Ga0070659_100015781 | |||
| 617 | Ga0070667_100271811 | |||
| 618 | Ga0070709_10199131 | |||
| 619 | Ga0070709_10286927 | |||
| 620 | Ga0070714_100000571 | |||
| 621 | Ga0070714_100002820 | |||
| 622 | Ga0070714_100067834 | |||
| 623 | Ga0070714_100094772 | |||
| 624 | Ga0070714_100180216 | |||
| 625 | Ga0070714_100409964 | |||
| 626 | Ga0070713_100043606 | |||
| 627 | Ga0070710_10027804 | |||
| 628 | Ga0070710_10287874 | |||
| 629 | Ga0070711_100039436 | |||
| 630 | Ga0070711_100053549 | |||
| 631 | Ga0070711_100163873 | |||
| 632 | Ga0070705_100405507 | |||
| 633 | Ga0070700_100004496 | |||
| 634 | Ga0070700_100069087 | |||
| 635 | Ga0070708_100014095 | |||
| 636 | Ga0070708_100014940 | |||
| 637 | Ga0070663_100024512 | |||
| 638 | Ga0070663_100307092 | |||
| 639 | Ga0070681_10055285 | |||
| 640 | Ga0070681_10072316 | |||
| 641 | Ga0068867_100074493 | |||
| 642 | Ga0068867_100229584 | |||
| 643 | Ga0070685_10131545 | |||
| 644 | Ga0070706_100057684 | |||
| 645 | Ga0070706_100057873 | |||
| 646 | Ga0070707_100042841 | |||
| 647 | Ga0070707_100100164 | |||
| 648 | Ga0070707_100162848 | |||
| 649 | Ga0070698_100135858 | |||
| 650 | Ga0070699_100003864 | |||
| 651 | Ga0070699_100007060 | |||
| 652 | Ga0070679_100047335 | |||
| 653 | Ga0070684_100001074 | |||
| 654 | Ga0070684_100006518 | |||
| 655 | Ga0070684_100377328 | |||
| 656 | Ga0070697_100001583 | |||
| 657 | Ga0070697_100036080 | |||
| 658 | Ga0068853_100016283 | |||
| 659 | Ga0068853_100081251 | |||
| 660 | Ga0070672_100053220 | |||
| 661 | Ga0070686_100090643 | |||
| 662 | Ga0070686_100426749 | |||
| 663 | Ga0070695_100071446 | |||
| 664 | Ga0070696_100078778 | |||
| 665 | Ga0070693_100213897 | |||
| 666 | Ga0070693_100303846 | |||
| 667 | Ga0070665_100477429 | |||
| 668 | Ga0070704_100049987 | |||
| 669 | Ga0068855_100015489 | |||
| 670 | Ga0068855_100096710 | |||
| 671 | Ga0070664_100015623 | |||
| 672 | Ga0070664_100114208 | |||
| 673 | Ga0070664_100163970 | |||
| 674 | Ga0070664_100586577 | |||
| 675 | Ga0068857_100002220 | |||
| 676 | Ga0068857_100125271 | |||
| 677 | Ga0068857_100233282 | |||
| 678 | Ga0068854_100039770 | |||
| 679 | Ga0068854_100065348 | |||
| 680 | Ga0070702_100001796 | |||
| 681 | Ga0070702_100278840 | |||
| 682 | Ga0068852_100059364 | |||
| 683 | Ga0068859_100122024 | |||
| 684 | Ga0068864_100429037 | |||
| 685 | Ga0068866_10110406 | |||
| 686 | Ga0068866_10130754 | |||
| 687 | Ga0068870_10053268 | |||
| 688 | Ga0068863_100074896 | |||
| 689 | Ga0068863_100106905 | |||
| 690 | Ga0068863_100127900 | |||
| 691 | Ga0068858_100030341 | |||
| 692 | Ga0068862_100234495 | |||
| 693 | Ga0068862_100456813 | |||
| 694 | Ga0081455_10152746 | |||
| 695 | Ga0081540_1000960 | |||
| 696 | Ga0070717_10002454 | |||
| 697 | Ga0070717_10011982 | |||
| 698 | Ga0070717_10022255 | |||
| 699 | Ga0070717_10054509 | |||
| 700 | Ga0070717_10444205 | |||
| 701 | Ga0070715_10044301 | |||
| 702 | Ga0070715_10053777 | |||
| 703 | Ga0070716_100065190 | |||
| 704 | Ga0070716_100159222 | |||
| 705 | Ga0070712_100003739 | |||
| 706 | Ga0070712_100059056 | |||
| 707 | Ga0070712_100395149 | |||
| 708 | Ga0075428_100031316 | |||
| 709 | Ga0075433_10126495 | |||
| 710 | Ga0075433_10127449 | |||
| 711 | Ga0075434_100020090 | |||
| 712 | Ga0075434_100054770 | |||
| 713 | Ga0075434_100059553 | |||
| 714 | Ga0075434_100325564 | |||
| 715 | Ga0075436_100011983 | |||
| 716 | Ga0075436_100024664 | |||
| 717 | Ga0075436_100121197 | |||
| 718 | Ga0097620_100122016 | |||
| 719 | Ga0075435_100001474 | |||
| 720 | Ga0075435_100382717 | |||
| 721 | Ga0075435_100406161 | |||
| 722 | Ga0105251_10006734 | |||
| 723 | Ga0105240_10036431 | |||
| 724 | Ga0105240_10050679 | |||
| 725 | Ga0111539_10123872 | |||
| 726 | Ga0105245_10031209 | |||
| 727 | Ga0105245_10056804 | |||
| 728 | Ga0105243_10264779 | |||
| 729 | Ga0105243_10316543 | |||
| 730 | Ga0105243_10357994 | |||
| 731 | Ga0105242_10349308 | |||
| 732 | Ga0105248_10245419 | |||
| 733 | Ga0105237_10730539 | |||
| 734 | Ga0105238_10024946 | |||
| 735 | Ga0105238_10177798 | |||
| 736 | Ga0105249_10067884 | |||
| 737 | Ga0105239_10081700 | |||
| 738 | Ga0105239_10090796 | |||
| 739 | Ga0105239_10198183 | |||
| 740 | Ga0105246_10040995 | |||
| 741 | Ga0105246_10234326 | |||
| 742 | Ga0157340_1000629 | |||
| 743 | Ga0157341_1000713 | |||
| 744 | Ga0157373_10173909 | |||
| 745 | Ga0157370_10104729 | |||
| 746 | Ga0157369_10015673 | |||
| 747 | Ga0157369_10032006 | |||
| 748 | Ga0163162_10678033 | |||
| 749 | Ga0157372_10036896 | |||
| 750 | Ga0157372_10050511 | |||
| 751 | Ga0157372_10064531 | |||
| 752 | Ga0157372_10383973 | |||
| 753 | Ga0157375_10203252 | |||
| 754 | Ga0157375_10235167 | |||
| 755 | Ga0157375_10254717 | |||
| 756 | Ga0157375_10559765 | |||
| 757 | Ga0182008_10018503 | |||
| 758 | Ga0182008_10121672 | |||
| 759 | Ga0157377_10199815 | |||
| 760 | Ga0157376_10039381 | |||
| 761 | Ga0157376_10121232 | |||
| 762 | Ga0206356_11051677 | |||
| 763 | Ga0206354_11605644 | |||
| 764 | Ga0213875_10025073 | |||
| 765 | Ga0213875_10083614 | |||
| 766 | Ga0213875_10163877 | |||
| 767 | Ga0224572_1000484 | |||
| 768 | Ga0209147_100185 | |||
| 769 | Ga0209675_1016815 | |||
| 770 | Ga0209676_1000894 | |||
| 771 | Ga0209025_1000156 | |||
| 772 | Ga0209025_1000266 | |||
| 773 | Ga0209025_1002044 | |||
| 774 | Ga0207692_10012847 | |||
| 775 | Ga0207692_10048694 | |||
| 776 | Ga0207692_10119751 | |||
| 777 | Ga0207642_10049850 | |||
| 778 | Ga0207710_10199758 | |||
| 779 | Ga0207688_10065380 | |||
| 780 | Ga0207688_10065505 | |||
| 781 | Ga0207688_10099700 | |||
| 782 | Ga0207647_10046501 | |||
| 783 | Ga0207699_10014503 | |||
| 784 | Ga0207699_10045334 | |||
| 785 | Ga0207684_10098692 | |||
| 786 | Ga0207707_10029522 | |||
| 787 | Ga0207707_10207299 | |||
| 788 | Ga0207695_10039026 | |||
| 789 | Ga0207671_10384868 | |||
| 790 | Ga0207693_10006652 | |||
| 791 | Ga0207693_10015287 | |||
| 792 | Ga0207693_10015563 | |||
| 793 | Ga0207693_10291620 | |||
| 794 | Ga0207663_10035875 | |||
| 795 | Ga0207660_10017464 | |||
| 796 | Ga0207662_10005891 | |||
| 797 | Ga0207657_10025473 | |||
| 798 | Ga0207657_10035368 | |||
| 799 | Ga0207657_10229767 | |||
| 800 | Ga0207652_10010567 | |||
| 801 | Ga0207652_10090861 | |||
| 802 | Ga0207652_10205800 | |||
| 803 | Ga0207646_10014587 | |||
| 804 | Ga0207646_10029359 | |||
| 805 | Ga0207646_10144966 | |||
| 806 | Ga0207694_10042063 | |||
| 807 | Ga0207687_10112473 | |||
| 808 | Ga0207700_10010846 | |||
| 809 | Ga0207700_10020917 | |||
| 810 | Ga0207700_10055317 | |||
| 811 | Ga0207700_10074372 | |||
| 812 | Ga0207700_10191624 | |||
| 813 | Ga0207700_10357704 | |||
| 814 | Ga0207664_10000445 | |||
| 815 | Ga0207664_10025999 | |||
| 816 | Ga0207664_10047957 | |||
| 817 | Ga0207664_10160424 | |||
| 818 | Ga0207664_10210468 | |||
| 819 | Ga0207664_10250292 | |||
| 820 | Ga0207644_10214275 | |||
| 821 | Ga0207690_10267689 | |||
| 822 | Ga0207686_10032216 | |||
| 823 | Ga0207686_10066459 | |||
| 824 | Ga0207670_10482737 | |||
| 825 | Ga0207669_10023264 | |||
| 826 | Ga0207704_10206725 | |||
| 827 | Ga0207665_10007675 | |||
| 828 | Ga0207665_10025061 | |||
| 829 | Ga0207665_10051925 | |||
| 830 | Ga0207691_10041336 | |||
| 831 | Ga0207691_10097817 | |||
| 832 | Ga0207689_10002974 | |||
| 833 | Ga0207661_10016523 | |||
| 834 | Ga0207661_10102502 | |||
| 835 | Ga0207661_10169543 | |||
| 836 | Ga0207679_10052131 | |||
| 837 | Ga0207679_10124260 | |||
| 838 | Ga0207651_10151291 | |||
| 839 | Ga0207712_10202979 | |||
| 840 | Ga0207640_10101012 | |||
| 841 | Ga0207677_10039108 | |||
| 842 | Ga0207677_10473069 | |||
| 843 | Ga0207703_10181253 | |||
| 844 | Ga0207703_10240455 | |||
| 845 | Ga0207639_10000790 | |||
| 846 | Ga0207639_10275171 | |||
| 847 | Ga0207678_10004476 | |||
| 848 | Ga0207708_10005669 | |||
| 849 | Ga0207708_10008536 | |||
| 850 | Ga0207702_10004942 | |||
| 851 | Ga0207641_10033927 | |||
| 852 | Ga0207641_10474744 | |||
| 853 | Ga0207648_10061374 | |||
| 854 | Ga0207648_10065089 | |||
| 855 | Ga0207648_10077566 | |||
| 856 | Ga0207676_10275368 | |||
| 857 | Ga0207676_10676640 | |||
| 858 | Ga0207674_10000753 | |||
| 859 | Ga0207674_10001849 | |||
| 860 | Ga0207674_10011814 | |||
| 861 | Ga0207674_10369859 | |||
| 862 | Ga0207675_100058732 | |||
| 863 | Ga0207675_100129362 | |||
| 864 | Ga0207683_10001068 | |||
| 865 | Ga0207698_10159078 | |||
| 866 | Ga0207698_10244053 | |||
| 867 | Ga0207698_10526769 | |||
| 868 | Ga0268265_10131784 | |||
| 869 | Ga0268264_10297598 | |||
| 870 | Ga0316579_10002064 | |||
| 871 | Ga0316579_10085107 | |||
| 872 | Ga0316576_10009479 | |||
| 873 | Ga0316578_10002124 | |||
| 874 | Ga0316578_10013717 | |||
| 875 | Ga0316577_10069910 | |||
| 876 | Ga0307409_100156960 | |||
| 877 | Ga0307416_100070030 | |||
| 878 | Ga0316580_10006054 | |||
| 879 | Ga0373958_0003432 | |||
| 880 | Ga0373926_0000233 | |||
| 881 | Ga0373926_0020150 | |||
| 882 | Ga0373928_0003496 | |||
| 883 | Ga0373929_0013105 | |||
| 884 | Ga0373934_0001197 | |||
| 885 | Ga0373940_0009897 | |||
| 886 | Ga0373940_0024993 | |||
| 887 | Ga0373923_0000368 | |||
| 888 | Ga0373923_0064601 | |||
| 889 | Ga0373936_0000332 | |||
| 890 | Ga0373936_0000759 | |||
| 891 | Ga0373936_0001867 | |||
| 892 | Ga0373939_0094187 | |||
| 893 | Ga0373945_0003452 | |||
| 894 | Ga0373945_0004321 | |||
| 895 | Ga0373945_0012136 | |||
| 896 | Ga0373953_0012436 | |||
| 897 | Ga0373953_0026368 | |||
| 898 | Ga0373956_0023579 | |||
| 899 | Ga0373957_0000649 | |||
| 900 | Ga0373957_0053204 | |||
| 901 | Ga0373960_0047677 | |||
| 902 | Ga0373943_0002340 | |||
| 903 | Ga0373943_0351433 | |||
| 904 | Ga0373946_0000335 | |||
| 905 | Ga0373946_0000938 | |||
| 906 | Ga0373955_0008851 | |||
| 907 | Ga0373955_0022019 | |||
| 908 | Ga0373955_0024714 | |||
| 909 | Ga0373942_0010327 | |||
| 910 | Ga0373961_0058086 | |||
| 911 | Ga0373961_0067867 | |||
| 912 | Ga0316574_0032187 | |||
| 913 | Ga0316574_0124480 | |||
| 914 | Ga0373924_0000149 | |||
| 915 | Ga0373935_0001103 | |||
| 916 | Ga0373935_0014038 | |||
| 917 | Ga0373927_0002493 | |||
| 918 | Ga0373927_0002623 | |||
| 919 | Ga0373927_0003833 | |||
| 920 | Ga0373933_0111668 | |||
| 921 | Ga0373933_0365269 | |||
| 922 | Ga0373947_0001226 | |||
| 923 | Ga0373947_0002538 | |||
| 924 | Ga0373937_0081189 | |||
| 925 | Ga0373937_0103854 | |||
| 926 | Ga0373937_0141771 | |||
| 927 | Ga0373937_0169732 | |||
| 928 | Ga0372808_006094 | |||
| 929 | Ga0316582_0065888 | |||
| 930 | Ga0316584_0006901 | |||
| 931 | Ga0373925_0000090 | |||
| 932 | Ga0373925_0000850 | |||
| 933 | Ga0373925_0001846 | |||
| 934 | Ga0373925_0208439 | |||
| 935 | Ga0373925_0338974 | |||
| 936 | Ga0395899_0160555 | |||
| 937 | Ga0395900_0042286 | |||
| 938 | Ga0395898_0001544 | |||
| 939 | Ga0395905_0043751 | |||
| 940 | Ga0436364_0169355 | |||
| 941 | Ga0436364_0615851 | |||
| 942 | Ga0436364_0780939 | |||
| 943 | Ga0436364_1010902 | |||
| 944 | Ga0436364_1265507 | |||
| 945 | Ga0395901_0034710 | |||
| 946 | Ga0395901_0538629 | |||
| 947 | Ga0436365_1875564 | |||
| 948 | Ga0451789_0997059 | |||
| 949 | Ga0451793_0874875 | |||
| 950 | Ga0451802_1084279 | |||
| 951 | Ga0451839_1302848 | |||
| 952 | Ga0451847_0962632 | |||
| 953 | Ga0466972_0115555 | |||
| 954 | Ga0466972_0118046 | |||
| 955 | Ga0466965_0100617 | |||
| 956 | Ga0466961_0025745 | |||
| 957 | Ga0466963_0000657 | |||
| 958 | Ga0466963_0004204 | |||
| 959 | Ga0466963_0057602 | |||
| 960 | Ga0466963_0231642 | |||
| 961 | Ga0466964_0007740 | |||
| 962 | Ga0466964_0009644 | |||
| 963 | Ga0453684_0000637 | |||
| 964 | Ga0453684_0248124 | |||
| 965 | Ga0466971_0015433 | |||
| 966 | Ga0466968_0054715 | |||
| 967 | Ga0466968_0069678 | |||
| 968 | Ga0466970_0029600 | |||
| 969 | Ga0466970_0047398 | |||
| 970 | Ga0466957_0019411 | |||
| 971 | Ga0466960_0005280 | |||
| 972 | Ga0466960_0007387 | |||
| 973 | Ga0466959_0135036 | |||
| 974 | Ga0466958_0011146 | |||
| 975 | Ga0466958_0074237 | |||
| 976 | Ga0466958_0084848 | |||
| 977 | Ga0466958_0124292 | |||
| 978 | Ga0466967_0004460 | |||
| 979 | Ga0466967_0012064 | |||
| 980 | Ga0466967_0040417 | |||
| 981 | Ga0466967_0172197 | |||
| 982 | Ga0466967_0183233 | |||
| 983 | Ga0466967_0239497 | |||
| 984 | Ga0466967_0269459 | |||
| 985 | Ga0495592_0023534 | |||
| 986 | Ga0495592_0062662 | |||
| 987 | Ga0495603_0001384 | |||
| 988 | Ga0495629_0176487 | |||
| 989 | Ga0495629_0197259 | |||
| 990 | Ga0495641_0005794 | |||
| 991 | Ga0495641_0006776 | |||
| 992 | Ga0495651_0011607 | |||
| 993 | Ga0495651_0221417 | |||
| 994 | Ga0495653_0001704 | |||
| 995 | Ga0495653_0004084 | |||
| 996 | Ga0495653_0050859 | |||
| 997 | Ga0495580_0009285 | |||
| 998 | Ga0495582_0000407 | |||
| 999 | Ga0495639_0000391 | |||
| 1000 | Ga0495662_0000493 | |||
| 1001 | Ga0495664_0000415 | |||
| 1002 | Ga0495664_0002387 | |||
| 1003 | Ga0495664_0023838 | |||
| 1004 | Ga0495664_0046607 | |||
| 1005 | Ga0495594_0021785 | |||
| 1006 | Ga0495608_0008633 | |||
| 1007 | Ga0495608_0027903 | |||
| 1008 | Ga0495608_0074766 | |||
| 1009 | Ga0495618_0008569 | |||
| 1010 | Ga0495618_0024245 | |||
| 1011 | Ga0495618_0054451 | |||
| 1012 | Ga0495628_0021128 | |||
| 1013 | Ga0495628_0022468 | |||
| 1014 | Ga0495628_0252153 | |||
| 1015 | Ga0495630_0008416 | |||
| 1016 | Ga0495630_0100056 | |||
| 1017 | Ga0495666_0003061 | |||
| 1018 | Ga0495652_0041143 | |||
| 1019 | Ga0495652_0072729 | |||
| 1020 | Ga0495652_0306066 | |||
| 1021 | Ga0495665_0000203 | |||
| 1022 | Ga0495665_0072436 | |||
| 1023 | Ga0495640_0002455 | |||
| 1024 | Ga0495640_0078569 | |||
| 1025 | Ga0495586_0021660 | |||
| 1026 | Ga0495587_0031738 | |||
| 1027 | Ga0495587_0032805 | |||
| 1028 | Ga0495645_0002225 | |||
| 1029 | Ga0495645_0026724 | |||
| 1030 | Ga0495645_0093314 | |||
| 1031 | Ga0495645_0310668 | |||
| 1032 | Ga0495667_0003066 | |||
| 1033 | Ga0495667_0003068 | |||
| 1034 | Ga0495667_0004958 | |||
| 1035 | Ga0495667_0027446 | |||
| 1036 | Ga0495667_0066885 | |||
| 1037 | Ga0495634_0062452 | |||
| 1038 | Ga0495634_0098453 | |||
| 1039 | Ga0495634_0182134 | |||
| 1040 | Ga0495635_0001917 | |||
| 1041 | Ga0495635_0019018 | |||
| 1042 | Ga0495635_0019571 | |||
| 1043 | Ga0495635_0115915 | |||
| 1044 | Ga0495635_0132894 | |||
| 1045 | Ga0495588_0096936 | |||
| 1046 | Ga0495657_0001013 | |||
| 1047 | Ga0495657_0037137 | |||
| 1048 | Ga0495599_0007561 | |||
| 1049 | Ga0495599_0009462 | |||
| 1050 | Ga0495599_0010549 | |||
| 1051 | Ga0495623_0040098 | |||
| 1052 | Ga0495623_0109161 | |||
| 1053 | Ga0495646_0002110 | |||
| 1054 | Ga0495646_0011112 | |||
| 1055 | Ga0495613_0112327 | |||
| 1056 | Ga0495624_0004261 | |||
| 1057 | Ga0495624_0013807 | |||
| 1058 | Ga0495600_0003141 | |||
| 1059 | Ga0495600_0007737 | |||
| 1060 | Ga0495600_0014351 | |||
| 1061 | Ga0495581_0000558 | |||
| 1062 | Ga0495581_0017466 | |||
| 1063 | Ga0495604_0001612 | |||
| 1064 | Ga0495604_0052410 | |||
| 1065 | Ga0495604_0066332 | |||
| 1066 | Ga0495674_0000802 | |||
| 1067 | Ga0495674_0004462 | |||
| 1068 | Ga0495674_0004962 | |||
| 1069 | Ga0495676_0002197 | |||
| 1070 | Ga0495676_0037932 | |||
| 1071 | Ga0495676_0213163 | |||
| 1072 | Ga0495680_0004401 | |||
| 1073 | Ga0495680_0006672 | |||
| 1074 | Ga0495680_0007158 | |||
| 1075 | Ga0495680_0016763 | |||
| 1076 | Ga0495680_0175183 | |||
| 1077 | Ga0495680_0231820 | |||
| 1078 | Ga0495684_0002648 | |||
| 1079 | Ga0495684_0002672 | |||
| 1080 | Ga0495684_0010540 | |||
| 1081 | Ga0495684_0028645 | |||
| 1082 | Ga0495593_0002039 | |||
| 1083 | Ga0495593_0059112 | |||
| 1084 | Ga0495602_0071990 | |||
| 1085 | Ga0495602_0299592 | |||
| 1086 | Ga0496100_0014151 | |||
| 1087 | Ga0496100_0141744 | |||
| 1088 | Ga0496100_0143078 | |||
| 1089 | Ga0496100_0277858 | |||
| 1090 | Ga0496100_0299441 | |||
| 1091 | Ga0496101_0012202 | |||
| 1092 | Ga0496101_0084220 | |||
| 1093 | Ga0496101_0288148 | |||
| 1094 | Ga0496101_0296175 | |||
| 1095 | Ga0496102_0453020 | |||
| 1096 | Ga0496104_0049895 | |||
| 1097 | Ga0496104_0104002 | |||
| 1098 | Ga0496104_0419782 | |||
| 1099 | Ga0496105_0011938 | |||
| 1100 | Ga0496106_0003655 | |||
| 1101 | Ga0496106_0014877 | |||
| 1102 | Ga0496106_0100496 | |||
| 1103 | Ga0496107_0072268 | |||
| 1104 | Ga0496107_0110430 | |||
| 1105 | Ga0496107_0166516 | |||
| 1106 | Ga0496107_0238738 | |||
| 1107 | Ga0496108_0057249 | |||
| 1108 | Ga0496108_0120493 | |||
| 1109 | Ga0496108_0429081 | |||
| 1110 | Ga0496109_0007222 | |||
| 1111 | Ga0496109_0040707 | |||
| 1112 | Ga0496109_0076060 | |||
| 1113 | Ga0496109_0287387 | |||
| 1114 | Ga0496109_0303163 | |||
| 1115 | Ga0496110_0003005 | |||
| 1116 | Ga0496110_0177865 | |||
| 1117 | Ga0496110_0219237 | |||
| 1118 | Ga0496111_0043112 | |||
| 1119 | Ga0496111_0046891 | |||
| 1120 | Ga0496112_0148808 | |||
| 1121 | Ga0496112_0260199 | |||
| 1122 | Ga0496113_0125108 | |||
| 1123 | Ga0496113_0328851 | |||
| 1124 | Ga0496114_0012612 | |||
| 1125 | Ga0496114_0086187 | |||
| 1126 | Ga0496114_0106243 | |||
| 1127 | Ga0496114_0356030 | |||
| 1128 | Ga0496114_0550517 | |||
| 1129 | Ga0496115_0026429 | |||
| 1130 | Ga0496115_0108049 | |||
| 1131 | Ga0496115_0493052 | |||
| 1132 | Ga0496126_0178026 | |||
| 1133 | Ga0501034_0230371 | |||
| 1134 | Ga0501067_0000005 | |||
| 1135 | Ga0501067_0044797 | |||
| 1136 | Ga0501068_0001488 | |||
| 1137 | Ga0501069_0000023 | |||
| 1138 | Ga0501069_0004380 | |||
| 1139 | Ga0501070_0024826 | |||
| 1140 | Ga0501080_0123392 | |||
| 1141 | Ga0501083_0021124 | |||
| 1142 | nmdc:mga05p37_127560_c1 | |||
| 1143 | nmdc:mga05p37_17739_c1 | |||
| 1144 | nmdc:mga0qj67_159128_c1 | |||
| 1145 | nmdc:mga0qj67_429219_c1 | |||
| 1146 | nmdc:mga08y16_327080_c1 | |||
| 1147 | nmdc:mga0n895_147676_c1 | |||
| 1148 | nmdc:mga0n895_153921_c1 | |||
| 1149 | nmdc:mga0n895_227030_c1 | |||
| 1150 | nmdc:mga08x19_15855_c1 | |||
| 1151 | nmdc:mga0a205_40408_c1 | |||
| 1152 | Ga0495601_0041771 | |||
| 1153 | Ga0495612_0005877 | |||
| 1154 | Ga0495619_0003799 | |||
| 1155 | Ga0495619_0053133 | |||
| 1156 | Ga0501082_0005337 | |||
| 1157 | Ga0530510_0027875 | |||
| 1158 | Ga0530510_0106621 | |||
| 1159 | Ga0530510_0242621 | |||
| 1160 | 2595087967 | |||
| 1161 | 2738813096 | |||
| 1162 | 2738839929 | |||
| 1163 | 2739268093 | |||
| 1164 | 2757565936 | |||
| 1165 | 2777762279 | |||
| 1166 | 2777839444 | |||
| 1167 | 2857587001 | |||
| 1168 | 2936341762 | |||
| 1169 | 2936365957 | |||
| 1170 | 2964378470 | |||
| 1171 | 2977257565 | |||
| 1172 | 2990278538 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wmr-assembly3.cif.gz_C | crystal structure of vinj | 0.953 | 4 | 290 |
| 1xqx-assembly1.cif.gz_A | crystal structure of f1-mutant s105a complex with pck | 0.9522 | 2 | 289 |
| 1xrp-assembly1.cif.gz_A | crystal structure of active site f1-mutant e213q soaked with peptide pro-leu-gly-gly | 0.95 | 2 | 289 |
| 1xrr-assembly1.cif.gz_A | crystal structure of active site f1-mutant e245q soaked with peptide pro-pro | 0.9495 | 2 | 289 |
| 1xrl-assembly1.cif.gz_A | crystal structure of active site f1-mutant y205f complex with inhibitor pck | 0.9476 | 2 | 289 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y8X0_7_285_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9802 | 10 | 288 | 3.40.50.1820 |
| af_I6Y8X0_7_285_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9664 | 10 | 288 | 3.40.50.1820 |
| 3wmrB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9533 | 4 | 290 | 3.40.50.1820 |
| 1xrpA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.95 | 2 | 289 | 3.40.50.1820 |
| 1xrpA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9405 | 2 | 289 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N0L3Y3-F1-model_v4 | AB hydrolase-1 domain-containing protein | 0.9848 | 2 | 291 |
GO:0004177
GO:0006508 GO:0016020 |
| AF-A0A1G0PGS2-F1-model_v4 | AB hydrolase-1 domain-containing protein | 0.9761 | 1 | 291 |
GO:0006508
GO:0008233 GO:0016020 |
| AF-A0PL61-F1-model_v4 | Proline iminopeptidase PIP | 0.9756 | 36 | 289 |
GO:0004177
GO:0006508 GO:0016020 |
| AF-A0A2N1WAJ8-F1-model_v4 | AB hydrolase-1 domain-containing protein | 0.9744 | 2 | 293 |
GO:0006508
GO:0008233 GO:0016020 |
| AF-A0A538L080-F1-model_v4 | Alpha/beta fold hydrolase | 0.9718 | 2 | 290 |
GO:0006508
GO:0008233 GO:0016020 |