F466587

General Info

Members Datasets Scaffolds Average Seq Length
586 195 1172 288

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0037678|Ga0495584_0037678_414_1370
Length 318
Sequence MLFRVLRFSVIAGLIRLSFRTLKEHHMTIAFIGLGAMGHHMAARLLASGQPVHVWNRNPDPVQALAAKGAKPAATAAECGIADVVFTMLADDDATRAVMVDGGVLDAMAPGSIHVNMATVSVAFAREMAALHLEKGVGYVAAPVLGRVDVAEAGKLNILAGGSDELIARVQPLLDLMGQKTWRFGDAPEQANAIKLACNLTLACAIEAMGEGSALARAHGIPGEHFIDLITNTLFAGSPVYKGYGGMIAQQRYSPAGFKLSLGQKDVRLAVEAGQDKGLPLAFGDALQGVLKEAVDHGDADLDLAALGKNAARRGGMD

Samples

Sample ID Description Type Environment
1 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
68 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
69 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
70 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
71 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
72 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
84 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
85 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
86 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
87 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
101 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
102 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
103 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
104 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
109 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
146 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
147 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
148 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
171 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
175 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
176 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
177 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
178 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
179 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
180 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
181 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
182 2643221556 Massilia sp. Root1485 Isolate Unclassified
183 2643221684 Massilia sp. Root133 Isolate Unclassified
184 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
185 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
186 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
187 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
188 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
189 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
190 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
191 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
192 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
193 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
194 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
195 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.42
Metatranscriptomes 0
Isolates 3.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.8
Nodule 0.85
Rhizoplane 4.78
Rhizosphere 85.49
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495584_0037678 3300046491 Bacteria 2444
2 JGI25151J46595_10032590 3300003187 Bacteria 2017
3 rootL2_10041077 3300003322 Bacteria 8357
4 rootL2_10087971 3300003322 Bacteria 5731
5 Ga0055525_1000009 3300003759 Bacteria 596899
6 Ga0055526_1003551 3300003771 Bacteria 9828
7 Ga0055526_1007633 3300003771 Bacteria 5578
8 Ga0055526_1011052 3300003771 Bacteria 4120
9 Ga0055526_1017616 3300003771 Bacteria 2718
10 Ga0055537_1000066 3300003773 Bacteria 76478
11 Ga0055524_1000798 3300003775 Bacteria 20887
12 Ga0055524_1006957 3300003775 Bacteria 4863
13 Ga0055536_1000074 3300003781 Bacteria 84660
14 Ga0055534_1000057 3300003784 Bacteria 85576
15 Ga0055534_1000616 3300003784 Bacteria 18373
16 Ga0055528_1000069 3300003790 Bacteria 83002
17 Ga0065165_1002874 3300005262 Bacteria 13269
18 Ga0065165_1060596 3300005262 Bacteria 1038
19 Ga0070658_10044598 3300005327 Bacteria 3584
20 Ga0070658_10095086 3300005327 Bacteria 2459
21 Ga0070680_100242719 3300005336 Bacteria 1523
22 Ga0070660_100043982 3300005339 Bacteria 3413
23 Ga0070660_100085399 3300005339 Bacteria 2482
24 Ga0070661_100008038 3300005344 Bacteria 7283
25 Ga0070659_100054667 3300005366 Bacteria 3145
26 Ga0070659_100082340 3300005366 Bacteria 2571
27 Ga0070663_100396922 3300005455 Bacteria 1127
28 Ga0070663_100514279 3300005455 Bacteria 996
29 Ga0070662_100069084 3300005457 Bacteria 2599
30 Ga0070681_10253314 3300005458 Bacteria 1673
31 Ga0070681_10350429 3300005458 Unclassified 1387
32 Ga0070679_100694136 3300005530 Bacteria 960
33 Ga0068855_100070433 3300005563 Bacteria 4068
34 Ga0070664_100007189 3300005564 Bacteria 8977
35 Ga0070664_100085162 3300005564 Bacteria 2729
36 Ga0068852_100209970 3300005616 Bacteria 1846
37 Ga0079104_1001008 3300006946 Bacteria 21846
38 Ga0105251_10000112 3300009011 Bacteria 80692
39 Ga0105250_10000108 3300009092 Bacteria 75179
40 Ga0105245_10052409 3300009098 Bacteria 3659
41 Ga0105243_10010198 3300009148 Bacteria 7142
42 Ga0105241_10013601 3300009174 Bacteria 5964
43 Ga0105242_10011672 3300009176 Bacteria 6760
44 Ga0105237_10102204 3300009545 Bacteria 2858
45 Ga0105246_10031635 3300011119 Bacteria 3503
46 Ga0157373_10187619 3300013100 Bacteria 1457
47 Ga0157370_10292244 3300013104 Bacteria 1505
48 Ga0209563_100015 3300025230 Bacteria 879901
49 Ga0209677_103314 3300025253 Bacteria 5317
50 Ga0209148_1000930 3300025254 Bacteria 19265
51 Ga0209565_1000006 3300025263 Bacteria 897294
52 Ga0209565_1000267 3300025263 Bacteria 54064
53 Ga0209673_1000004 3300025273 Bacteria 896155
54 Ga0209673_1008504 3300025273 Bacteria 4561
55 Ga0209675_1000006 3300025291 Bacteria 732267
56 Ga0209675_1000210 3300025291 Bacteria 61408
57 Ga0209675_1000644 3300025291 Bacteria 24798
58 Ga0209676_1000012 3300025292 Bacteria 841431
59 Ga0209025_1000306 3300025294 Bacteria 109280
60 Ga0209025_1003153 3300025294 Bacteria 16082
61 Ga0209564_1000102 3300025295 Bacteria 222597
62 Ga0209564_1000567 3300025295 Bacteria 58644
63 Ga0209564_1000859 3300025295 Bacteria 40516
64 Ga0209564_1001254 3300025295 Bacteria 28154
65 Ga0209256_1000037 3300025299 Bacteria 377661
66 Ga0209256_1000059 3300025299 Bacteria 272170
67 Ga0207696_1000214 3300025711 Bacteria 86218
68 Ga0207713_1000087 3300025735 Bacteria 157009
69 Ga0207705_10079300 3300025909 Bacteria 2391
70 Ga0207654_10025131 3300025911 Bacteria 3210
71 Ga0207707_10308503 3300025912 Bacteria 1368
72 Ga0207657_10013950 3300025919 Bacteria 7861
73 Ga0207657_10042023 3300025919 Bacteria 4037
74 Ga0207657_10052973 3300025919 Bacteria 3518
75 Ga0207652_10350929 3300025921 Bacteria 1331
76 Ga0207690_10316150 3300025932 Bacteria 1226
77 Ga0207706_10026624 3300025933 Bacteria 5175
78 Ga0207686_10004224 3300025934 Bacteria 7700
79 Ga0207679_10007524 3300025945 Bacteria 6913
80 Ga0207679_10112966 3300025945 Bacteria 2148
81 Ga0207667_10182371 3300025949 Bacteria 2155
82 Ga0207678_10223133 3300026067 Bacteria 1613
83 Ga0207702_10211438 3300026078 Bacteria 1803
84 Ga0207698_10069061 3300026142 Bacteria 2792
85 Ga0209281_1000050 3300027111 Bacteria 320102
86 Ga0268264_10054229 3300028381 Bacteria 3347
87 Ga0395899_0006007 3300037312 Bacteria 9425
88 Ga0395899_0018471 3300037312 Bacteria 5300
89 Ga0395899_0037951 3300037312 Bacteria 3611
90 Ga0395900_0001327 3300037418 Bacteria 29962
91 Ga0395900_0001337 3300037418 Bacteria 29786
92 Ga0395900_0002040 3300037418 Bacteria 22704
93 Ga0395900_0004302 3300037418 Bacteria 15098
94 Ga0395900_0006110 3300037418 Bacteria 12557
95 Ga0395900_0019473 3300037418 Bacteria 6919
96 Ga0395900_0085878 3300037418 Bacteria 3233
97 Ga0395900_0301168 3300037418 Bacteria 1589
98 Ga0395900_0696165 3300037418 Bacteria 950
99 Ga0395898_0027743 3300037466 Bacteria 5678
100 Ga0395898_0084467 3300037466 Bacteria 3060
101 Ga0395905_0028509 3300037471 Bacteria 5263
102 Ga0395905_0054195 3300037471 Bacteria 3753
103 Ga0395905_0059568 3300037471 Bacteria 3569
104 Ga0395905_0083149 3300037471 Bacteria 2999
105 Ga0395905_0110677 3300037471 Bacteria 2579
106 Ga0395905_0173881 3300037471 Bacteria 2022
107 Ga0395905_0233839 3300037471 Bacteria 1718
108 Ga0395901_0000229 3300038443 Bacteria 70261
109 Ga0395901_0006677 3300038443 Bacteria 11664
110 Ga0395901_0020246 3300038443 Bacteria 6810
111 Ga0395901_0134360 3300038443 Bacteria 2600
112 Ga0395901_0291514 3300038443 Bacteria 1693
113 Ga0395901_0677224 3300038443 Bacteria 1031
114 Ga0439448_0000641 3300042005 Bacteria 8267
115 Ga0439452_000550 3300042010 Bacteria 19946
116 Ga0450904_000055 3300042139 Bacteria 25247
117 Ga0439458_0020283 3300042157 Bacteria 1534
118 Ga0466969_0029768 3300044656 Bacteria 2786
119 Ga0466969_0037847 3300044656 Bacteria 2431
120 Ga0466969_0045292 3300044656 Bacteria 2185
121 Ga0466969_0142480 3300044656 Bacteria 1107
122 Ga0466972_0003218 3300044658 Bacteria 8105
123 Ga0466965_0044176 3300044683 Bacteria 2201
124 Ga0466966_0001914 3300044684 Bacteria 13489
125 Ga0466966_0014154 3300044684 Bacteria 5280
126 Ga0466966_0014262 3300044684 Bacteria 5261
127 Ga0466966_0047078 3300044684 Bacteria 2751
128 Ga0466961_0060574 3300044693 Bacteria 2406
129 Ga0466961_0171721 3300044693 Bacteria 1348
130 Ga0466963_0139726 3300044694 Bacteria 1677
131 Ga0466963_0270883 3300044694 Bacteria 1193
132 Ga0466964_0003176 3300044706 Bacteria 5972
133 Ga0466964_0006190 3300044706 Bacteria 4458
134 Ga0466964_0051611 3300044706 Bacteria 1689
135 Ga0466968_0008925 3300044735 Bacteria 3848
136 Ga0466957_0006853 3300044842 Bacteria 6439
137 Ga0466957_0020946 3300044842 Bacteria 3847
138 Ga0466957_0030026 3300044842 Bacteria 3244
139 Ga0466957_0054810 3300044842 Bacteria 2435
140 Ga0466959_0037617 3300045049 Bacteria 3576
141 Ga0466958_0064745 3300045836 Bacteria 2230
142 Ga0466958_0283315 3300045836 Bacteria 1062
143 Ga0466967_0060963 3300045976 Bacteria 3345
144 Ga0466967_0127400 3300045976 Bacteria 2359
145 Ga0495617_000002 3300046452 Bacteria 710121
146 Ga0495627_000207 3300046453 Bacteria 63763
147 Ga0495603_0203013 3300046455 Bacteria 1145
148 Ga0495590_0000025 3300046457 Bacteria 165221
149 Ga0495590_0015638 3300046457 Bacteria 2750
150 Ga0495591_000246 3300046458 Bacteria 52198
151 Ga0495591_008441 3300046458 Bacteria 4220
152 Ga0495591_011855 3300046458 Bacteria 3276
153 Ga0495629_0058719 3300046459 Bacteria 2689
154 Ga0495629_0170482 3300046459 Bacteria 1510
155 Ga0495638_0016988 3300046460 Bacteria 4864
156 Ga0495638_0045095 3300046460 Bacteria 2775
157 Ga0495653_0008877 3300046463 Bacteria 8223
158 Ga0495653_0112002 3300046463 Bacteria 1959
159 Ga0495653_0142542 3300046463 Bacteria 1683
160 Ga0495650_0000015 3300046471 Bacteria 557595
161 Ga0495650_0000124 3300046471 Bacteria 180310
162 Ga0495650_0012621 3300046471 Bacteria 4530
163 Ga0495582_0002194 3300046473 Bacteria 10926
164 Ga0495582_0006775 3300046473 Bacteria 6372
165 Ga0495605_0000293 3300046474 Bacteria 55067
166 Ga0495605_0002221 3300046474 Bacteria 12119
167 Ga0495605_0003577 3300046474 Bacteria 9209
168 Ga0495605_0013652 3300046474 Bacteria 4468
169 Ga0495605_0025421 3300046474 Bacteria 3085
170 Ga0495605_0034802 3300046474 Bacteria 2549
171 Ga0495605_0035524 3300046474 Bacteria 2518
172 Ga0495605_0049595 3300046474 Bacteria 2050
173 Ga0495605_0055926 3300046474 Bacteria 1904
174 Ga0495605_0073549 3300046474 Bacteria 1610
175 Ga0495605_0116842 3300046474 Bacteria 1212
176 Ga0495584_0000070 3300046491 Bacteria 73237
177 Ga0495584_0001443 3300046491 Bacteria 14324
178 Ga0495584_0002152 3300046491 Bacteria 11248
179 Ga0495584_0002274 3300046491 Bacteria 10946
180 Ga0495584_0004947 3300046491 Bacteria 7106
181 Ga0495584_0005819 3300046491 Bacteria 6497
182 Ga0495584_0007124 3300046491 Bacteria 5841
183 Ga0495584_0008754 3300046491 Bacteria 5234
184 Ga0495584_0047091 3300046491 Bacteria 2174
185 Ga0495584_0085650 3300046491 Bacteria 1588
186 Ga0495584_0132883 3300046491 Bacteria 1263
187 Ga0495584_0215118 3300046491 Bacteria 977
188 Ga0495584_0257360 3300046491 Bacteria 887
189 Ga0495585_0001061 3300046492 Bacteria 22624
190 Ga0495585_0001538 3300046492 Bacteria 17918
191 Ga0495585_0002202 3300046492 Bacteria 14147
192 Ga0495585_0012014 3300046492 Bacteria 5110
193 Ga0495585_0013402 3300046492 Bacteria 4799
194 Ga0495585_0017441 3300046492 Bacteria 4147
195 Ga0495585_0018038 3300046492 Bacteria 4072
196 Ga0495585_0026886 3300046492 Bacteria 3285
197 Ga0495585_0030779 3300046492 Bacteria 3051
198 Ga0495585_0038617 3300046492 Bacteria 2686
199 Ga0495585_0063208 3300046492 Bacteria 2032
200 Ga0495585_0067489 3300046492 Bacteria 1956
201 Ga0495585_0098073 3300046492 Bacteria 1570
202 Ga0495585_0101782 3300046492 Bacteria 1535
203 Ga0495594_0001482 3300046499 Bacteria 12162
204 Ga0495594_0049617 3300046499 Bacteria 2307
205 Ga0495594_0088922 3300046499 Bacteria 1729
206 Ga0495594_0102313 3300046499 Bacteria 1611
207 Ga0495596_0000847 3300046500 Bacteria 18503
208 Ga0495596_0002396 3300046500 Bacteria 10136
209 Ga0495596_0006133 3300046500 Bacteria 5581
210 Ga0495596_0006577 3300046500 Bacteria 5333
211 Ga0495596_0006838 3300046500 Bacteria 5202
212 Ga0495596_0014474 3300046500 Bacteria 3325
213 Ga0495596_0018899 3300046500 Bacteria 2836
214 Ga0495596_0025163 3300046500 Bacteria 2407
215 Ga0495596_0039566 3300046500 Bacteria 1862
216 Ga0495596_0042049 3300046500 Bacteria 1801
217 Ga0495596_0044512 3300046500 Bacteria 1747
218 Ga0495596_0052457 3300046500 Bacteria 1596
219 Ga0495607_0001784 3300046501 Bacteria 18388
220 Ga0495607_0002697 3300046501 Bacteria 14167
221 Ga0495607_0003269 3300046501 Bacteria 12466
222 Ga0495607_0005667 3300046501 Bacteria 8896
223 Ga0495607_0007843 3300046501 Bacteria 7347
224 Ga0495607_0008524 3300046501 Bacteria 7008
225 Ga0495607_0026141 3300046501 Bacteria 3624
226 Ga0495607_0041916 3300046501 Bacteria 2716
227 Ga0495607_0054680 3300046501 Bacteria 2299
228 Ga0495607_0143246 3300046501 Bacteria 1231
229 Ga0495607_0152686 3300046501 Bacteria 1180
230 Ga0495583_0000372 3300046506 Bacteria 69750
231 Ga0495583_0000382 3300046506 Bacteria 68388
232 Ga0495583_0002348 3300046506 Bacteria 16387
233 Ga0495583_0006212 3300046506 Bacteria 7863
234 Ga0495583_0010090 3300046506 Bacteria 5554
235 Ga0495583_0023412 3300046506 Bacteria 3125
236 Ga0495583_0066901 3300046506 Bacteria 1588
237 Ga0495583_0066989 3300046506 Bacteria 1587
238 Ga0495583_0079954 3300046506 Bacteria 1421
239 Ga0495583_0091644 3300046506 Bacteria 1307
240 Ga0495583_0105836 3300046506 Bacteria 1196
241 Ga0495606_0004650 3300046507 Bacteria 13575
242 Ga0495606_0008165 3300046507 Bacteria 9165
243 Ga0495606_0010040 3300046507 Bacteria 7913
244 Ga0495606_0011139 3300046507 Bacteria 7370
245 Ga0495606_0025071 3300046507 Bacteria 4280
246 Ga0495606_0042480 3300046507 Bacteria 3039
247 Ga0495606_0055745 3300046507 Bacteria 2555
248 Ga0495606_0067965 3300046507 Bacteria 2255
249 Ga0495606_0089923 3300046507 Bacteria 1890
250 Ga0495606_0136797 3300046507 Bacteria 1450
251 Ga0495606_0151180 3300046507 Bacteria 1362
252 Ga0495610_0000229 3300046512 Bacteria 59730
253 Ga0495610_0000993 3300046512 Bacteria 26157
254 Ga0495616_0000057 3300046513 Bacteria 100806
255 Ga0495616_0000207 3300046513 Bacteria 48768
256 Ga0495616_0005637 3300046513 Bacteria 7664
257 Ga0495616_0005696 3300046513 Bacteria 7632
258 Ga0495616_0012844 3300046513 Bacteria 4737
259 Ga0495616_0016710 3300046513 Bacteria 4055
260 Ga0495616_0022993 3300046513 Bacteria 3359
261 Ga0495616_0028046 3300046513 Bacteria 2983
262 Ga0495616_0042380 3300046513 Bacteria 2317
263 Ga0495616_0045814 3300046513 Bacteria 2211
264 Ga0495631_0000951 3300046518 Bacteria 18026
265 Ga0495631_0003544 3300046518 Bacteria 8532
266 Ga0495631_0004785 3300046518 Bacteria 7139
267 Ga0495631_0005309 3300046518 Bacteria 6765
268 Ga0495631_0005574 3300046518 Bacteria 6581
269 Ga0495631_0006955 3300046518 Bacteria 5792
270 Ga0495631_0008270 3300046518 Bacteria 5245
271 Ga0495631_0008465 3300046518 Bacteria 5185
272 Ga0495631_0010559 3300046518 Bacteria 4567
273 Ga0495631_0019657 3300046518 Bacteria 3166
274 Ga0495631_0021220 3300046518 Bacteria 3026
275 Ga0495631_0081943 3300046518 Bacteria 1391
276 Ga0495632_0000077 3300046519 Bacteria 100834
277 Ga0495632_0000129 3300046519 Bacteria 77134
278 Ga0495632_0000296 3300046519 Bacteria 48157
279 Ga0495632_0009761 3300046519 Bacteria 5753
280 Ga0495632_0015199 3300046519 Bacteria 4327
281 Ga0495632_0018451 3300046519 Bacteria 3829
282 Ga0495632_0048682 3300046519 Bacteria 2098
283 Ga0495637_0000019 3300046520 Bacteria 185953
284 Ga0495637_0064250 3300046520 Bacteria 1497
285 Ga0495637_0128507 3300046520 Bacteria 969
286 Ga0495643_0000415 3300046522 Bacteria 55824
287 Ga0495643_0000453 3300046522 Bacteria 52189
288 Ga0495643_0002628 3300046522 Bacteria 13941
289 Ga0495643_0003068 3300046522 Bacteria 12557
290 Ga0495643_0006948 3300046522 Bacteria 7362
291 Ga0495643_0015883 3300046522 Bacteria 4434
292 Ga0495643_0016103 3300046522 Bacteria 4399
293 Ga0495643_0034525 3300046522 Bacteria 2790
294 Ga0495644_0008033 3300046523 Bacteria 4057
295 Ga0495644_0015849 3300046523 Bacteria 2887
296 Ga0495644_0016942 3300046523 Bacteria 2788
297 Ga0495644_0017003 3300046523 Bacteria 2783
298 Ga0495644_0046916 3300046523 Bacteria 1623
299 Ga0495644_0047396 3300046523 Bacteria 1614
300 Ga0495648_0001105 3300046524 Bacteria 27423
301 Ga0495648_0003427 3300046524 Bacteria 13935
302 Ga0495648_0003935 3300046524 Bacteria 12861
303 Ga0495648_0006464 3300046524 Bacteria 9562
304 Ga0495648_0007707 3300046524 Bacteria 8580
305 Ga0495648_0010633 3300046524 Bacteria 6993
306 Ga0495648_0018789 3300046524 Bacteria 4878
307 Ga0495648_0053201 3300046524 Bacteria 2454
308 Ga0495648_0160630 3300046524 Bacteria 1162
309 Ga0495666_0016778 3300046526 Bacteria 3646
310 Ga0495666_0027931 3300046526 Bacteria 2777
311 Ga0495642_0000085 3300046528 Bacteria 54372
312 Ga0495642_0000285 3300046528 Bacteria 28471
313 Ga0495642_0000313 3300046528 Bacteria 26929
314 Ga0495642_0001578 3300046528 Bacteria 9981
315 Ga0495642_0004274 3300046528 Bacteria 5553
316 Ga0495642_0005178 3300046528 Bacteria 5016
317 Ga0495642_0005578 3300046528 Bacteria 4835
318 Ga0495642_0007414 3300046528 Bacteria 4205
319 Ga0495642_0026845 3300046528 Bacteria 2289
320 Ga0495642_0050542 3300046528 Bacteria 1709
321 Ga0495652_0049693 3300046529 Bacteria 3589
322 Ga0495652_0060562 3300046529 Bacteria 3198
323 Ga0495654_0005307 3300046530 Bacteria 7512
324 Ga0495654_0007211 3300046530 Bacteria 6236
325 Ga0495654_0019601 3300046530 Bacteria 3538
326 Ga0495654_0036080 3300046530 Bacteria 2486
327 Ga0495665_0007366 3300046531 Bacteria 5949
328 Ga0495665_0012671 3300046531 Bacteria 4564
329 Ga0495640_0051803 3300046533 Bacteria 2820
330 Ga0495587_0216592 3300046536 Bacteria 1080
331 Ga0495609_0000002 3300046538 Bacteria 739816
332 Ga0495609_0000886 3300046538 Bacteria 21874
333 Ga0495609_0001182 3300046538 Bacteria 18022
334 Ga0495609_0001343 3300046538 Bacteria 16616
335 Ga0495609_0020603 3300046538 Bacteria 3045
336 Ga0495609_0052236 3300046538 Bacteria 1818
337 Ga0495609_0119594 3300046538 Bacteria 1133
338 Ga0495597_0000226 3300046542 Bacteria 51108
339 Ga0495597_0000812 3300046542 Bacteria 24678
340 Ga0495597_0000995 3300046542 Bacteria 21765
341 Ga0495597_0003839 3300046542 Bacteria 8534
342 Ga0495597_0024406 3300046542 Bacteria 2792
343 Ga0495597_0027118 3300046542 Bacteria 2628
344 Ga0495597_0047010 3300046542 Bacteria 1911
345 Ga0495597_0076372 3300046542 Bacteria 1437
346 Ga0495597_0097789 3300046542 Bacteria 1240
347 Ga0495622_0006961 3300046557 Bacteria 5248
348 Ga0495633_0001851 3300046558 Bacteria 15535
349 Ga0495633_0003620 3300046558 Bacteria 10213
350 Ga0495633_0014055 3300046558 Bacteria 4197
351 Ga0495633_0014124 3300046558 Bacteria 4186
352 Ga0495633_0020568 3300046558 Bacteria 3316
353 Ga0495633_0026239 3300046558 Bacteria 2860
354 Ga0495633_0085699 3300046558 Bacteria 1465
355 Ga0495633_0117793 3300046558 Bacteria 1230
356 Ga0495656_0004993 3300046615 Bacteria 4569
357 Ga0495668_0000274 3300046616 Bacteria 72330
358 Ga0495668_0000941 3300046616 Bacteria 32463
359 Ga0495668_0002973 3300046616 Bacteria 13285
360 Ga0495668_0004993 3300046616 Bacteria 9168
361 Ga0495668_0010510 3300046616 Bacteria 5599
362 Ga0495668_0019933 3300046616 Bacteria 3858
363 Ga0495668_0023942 3300046616 Bacteria 3475
364 Ga0495668_0044399 3300046616 Bacteria 2470
365 Ga0495668_0059964 3300046616 Bacteria 2099
366 Ga0495668_0108996 3300046616 Bacteria 1514
367 Ga0495668_0151399 3300046616 Bacteria 1270
368 Ga0495611_0000195 3300046648 Bacteria 42925
369 Ga0495611_0000773 3300046648 Bacteria 17861
370 Ga0495611_0002922 3300046648 Bacteria 7619
371 Ga0495611_0003812 3300046648 Bacteria 6576
372 Ga0495611_0016698 3300046648 Bacteria 3137
373 Ga0495611_0019310 3300046648 Bacteria 2927
374 Ga0495611_0025406 3300046648 Bacteria 2581
375 Ga0495611_0050927 3300046648 Bacteria 1866
376 Ga0495625_0020521 3300046660 Bacteria 5099
377 Ga0495625_0021642 3300046660 Bacteria 4946
378 Ga0495625_0080808 3300046660 Bacteria 2263
379 Ga0495625_0179426 3300046660 Bacteria 1409
380 Ga0495635_0006164 3300046663 Bacteria 8359
381 Ga0495635_0075702 3300046663 Bacteria 2306
382 Ga0495661_0001749 3300046665 Bacteria 17475
383 Ga0495661_0001834 3300046665 Bacteria 17010
384 Ga0495661_0002660 3300046665 Bacteria 13678
385 Ga0495661_0003316 3300046665 Bacteria 11933
386 Ga0495661_0003878 3300046665 Bacteria 10932
387 Ga0495661_0004982 3300046665 Bacteria 9483
388 Ga0495661_0005057 3300046665 Bacteria 9413
389 Ga0495661_0005612 3300046665 Bacteria 8902
390 Ga0495661_0006339 3300046665 Bacteria 8320
391 Ga0495661_0030101 3300046665 Bacteria 3459
392 Ga0495661_0048480 3300046665 Bacteria 2580
393 Ga0495661_0056025 3300046665 Bacteria 2360
394 Ga0495661_0109956 3300046665 Unclassified 1537
395 Ga0495661_0112440 3300046665 Bacteria 1515
396 Ga0495588_0000177 3300046674 Bacteria 78598
397 Ga0495588_0007375 3300046674 Bacteria 4999
398 Ga0495588_0017811 3300046674 Bacteria 3456
399 Ga0495588_0019331 3300046674 Bacteria 3336
400 Ga0495588_0112608 3300046674 Bacteria 1433
401 Ga0495623_0007137 3300046679 Bacteria 7253
402 Ga0495623_0008273 3300046679 Bacteria 6766
403 Ga0495646_0086959 3300046680 Bacteria 1812
404 Ga0495669_0000092 3300046684 Bacteria 59765
405 Ga0495669_0001619 3300046684 Bacteria 9246
406 Ga0495669_0021104 3300046684 Bacteria 2824
407 Ga0495613_0039187 3300046689 Bacteria 3513
408 Ga0495613_0170481 3300046689 Bacteria 1545
409 Ga0495670_0000623 3300046691 Bacteria 16953
410 Ga0495670_0005797 3300046691 Bacteria 6051
411 Ga0495670_0018205 3300046691 Bacteria 3459
412 Ga0495670_0020078 3300046691 Bacteria 3293
413 Ga0495670_0023235 3300046691 Bacteria 3061
414 Ga0495670_0032779 3300046691 Bacteria 2583
415 Ga0495670_0095447 3300046691 Bacteria 1525
416 Ga0495671_0000965 3300046692 Bacteria 20129
417 Ga0495671_0001021 3300046692 Bacteria 19478
418 Ga0495671_0007168 3300046692 Bacteria 6380
419 Ga0495671_0010365 3300046692 Bacteria 5165
420 Ga0495671_0013348 3300046692 Bacteria 4453
421 Ga0495671_0030653 3300046692 Bacteria 2753
422 Ga0495671_0069333 3300046692 Bacteria 1733
423 Ga0495649_0001292 3300046694 Bacteria 19128
424 Ga0495649_0005918 3300046694 Bacteria 7668
425 Ga0495649_0069733 3300046694 Bacteria 1885
426 Ga0495649_0088452 3300046694 Bacteria 1652
427 Ga0495649_0096563 3300046694 Bacteria 1572
428 Ga0495649_0123907 3300046694 Bacteria 1365
429 Ga0495589_0000357 3300046794 Bacteria 35496
430 Ga0495589_0000535 3300046794 Bacteria 26576
431 Ga0495589_0000972 3300046794 Bacteria 17487
432 Ga0495589_0004770 3300046794 Bacteria 7205
433 Ga0495589_0016723 3300046794 Bacteria 3767
434 Ga0495589_0018340 3300046794 Bacteria 3589
435 Ga0495589_0051805 3300046794 Bacteria 2028
436 Ga0495589_0123034 3300046794 Bacteria 1248
437 Ga0495600_0141326 3300046809 Bacteria 1562
438 Ga0495660_0001272 3300046810 Bacteria 17548
439 Ga0495660_0002353 3300046810 Bacteria 12081
440 Ga0495660_0005882 3300046810 Bacteria 7308
441 Ga0495660_0010195 3300046810 Bacteria 5465
442 Ga0495660_0022141 3300046810 Bacteria 3632
443 Ga0495660_0043476 3300046810 Bacteria 2477
444 Ga0495581_0363291 3300047315 Bacteria 845
445 Ga0495604_0020341 3300047317 Bacteria 5303
446 Ga0495604_0056352 3300047317 Bacteria 3026
447 Ga0495604_0094836 3300047317 Bacteria 2205
448 Ga0495636_0001920 3300047318 Bacteria 7955
449 Ga0495672_0000041 3300047320 Bacteria 267545
450 Ga0495672_0000748 3300047320 Bacteria 35552
451 Ga0495672_0001917 3300047320 Bacteria 19721
452 Ga0495672_0004338 3300047320 Bacteria 11675
453 Ga0495672_0020015 3300047320 Bacteria 4396
454 Ga0495672_0026266 3300047320 Bacteria 3717
455 Ga0495672_0179454 3300047320 Bacteria 1073
456 Ga0495676_0000309 3300047321 Bacteria 39532
457 Ga0495676_0002463 3300047321 Bacteria 16453
458 Ga0495676_0004701 3300047321 Bacteria 12499
459 Ga0495680_0009206 3300047322 Bacteria 8903
460 Ga0495680_0327602 3300047322 Bacteria 1071
461 Ga0495683_0001473 3300047323 Bacteria 15395
462 Ga0495683_0006731 3300047323 Bacteria 6259
463 Ga0495683_0034596 3300047323 Bacteria 2569
464 Ga0495683_0041695 3300047323 Bacteria 2315
465 Ga0495687_000127 3300047443 Bacteria 117520
466 Ga0495687_001937 3300047443 Bacteria 17743
467 Ga0495687_001953 3300047443 Bacteria 17622
468 Ga0495687_002700 3300047443 Bacteria 13761
469 Ga0495687_030144 3300047443 Bacteria 2500
470 Ga0495687_073046 3300047443 Bacteria 1368
471 Ga0495675_0029408 3300047444 Bacteria 3504
472 Ga0495675_0159389 3300047444 Bacteria 1390
473 Ga0495677_0000041 3300047445 Bacteria 75366
474 Ga0495677_0001364 3300047445 Bacteria 9762
475 Ga0495677_0001520 3300047445 Bacteria 9339
476 Ga0495677_0001956 3300047445 Bacteria 8225
477 Ga0495677_0004851 3300047445 Bacteria 5130
478 Ga0495677_0007333 3300047445 Bacteria 4124
479 Ga0495677_0025340 3300047445 Bacteria 2151
480 Ga0495677_0036734 3300047445 Bacteria 1789
481 Ga0495679_003572 3300047446 Bacteria 7426
482 Ga0495679_027345 3300047446 Bacteria 1883
483 Ga0495679_055563 3300047446 Bacteria 1175
484 Ga0495679_067997 3300047446 Bacteria 1031
485 Ga0495685_007488 3300047447 Bacteria 3605
486 Ga0495685_034031 3300047447 Bacteria 1751
487 Ga0495685_046671 3300047447 Bacteria 1473
488 Ga0495685_103200 3300047447 Bacteria 941
489 Ga0495681_0000667 3300047470 Bacteria 26095
490 Ga0495681_0001424 3300047470 Bacteria 17975
491 Ga0495681_0001579 3300047470 Bacteria 16952
492 Ga0495681_0019584 3300047470 Bacteria 3690
493 Ga0495681_0020783 3300047470 Bacteria 3552
494 Ga0495681_0065925 3300047470 Bacteria 1654
495 Ga0495686_0000732 3300047472 Bacteria 43872
496 Ga0495686_0001773 3300047472 Bacteria 22009
497 Ga0495686_0059189 3300047472 Bacteria 2386
498 Ga0495686_0125657 3300047472 Bacteria 1525
499 Ga0495593_0008026 3300047673 Bacteria 6142
500 Ga0495593_0021037 3300047673 Bacteria 3647
501 Ga0495602_0005903 3300048088 Bacteria 12859
502 Ga0495614_0005786 3300048089 Bacteria 5568
503 Ga0495614_0013189 3300048089 Bacteria 3625
504 Ga0495626_0000003 3300048091 Bacteria 427774
505 Ga0495626_0000390 3300048091 Bacteria 45358
506 Ga0495626_0001008 3300048091 Bacteria 24189
507 Ga0495626_0002215 3300048091 Bacteria 13929
508 Ga0495626_0002565 3300048091 Bacteria 12444
509 Ga0495626_0003207 3300048091 Bacteria 10620
510 Ga0495626_0005095 3300048091 Bacteria 7830
511 Ga0495626_0005673 3300048091 Bacteria 7225
512 Ga0495626_0005914 3300048091 Bacteria 7043
513 Ga0495626_0017222 3300048091 Bacteria 3655
514 Ga0495626_0018482 3300048091 Bacteria 3500
515 Ga0495626_0032335 3300048091 Bacteria 2513
516 Ga0495626_0049619 3300048091 Bacteria 1943
517 Ga0495626_0095882 3300048091 Bacteria 1299
518 Ga0495626_0102351 3300048091 Bacteria 1247
519 Ga0496100_0016408 3300048903 Bacteria 4349
520 Ga0496100_0332953 3300048903 Bacteria 1143
521 Ga0496101_0017410 3300048904 Bacteria 4874
522 Ga0496101_0157735 3300048904 Bacteria 1739
523 Ga0496102_0002521 3300048905 Bacteria 15635
524 Ga0496102_0278231 3300048905 Bacteria 1577
525 Ga0496102_0485645 3300048905 Bacteria 1157
526 Ga0496104_0286457 3300048907 Bacteria 1560
527 Ga0496105_0263999 3300048908 Bacteria 1392
528 Ga0496106_0001933 3300048909 Bacteria 15541
529 Ga0496106_0115029 3300048909 Bacteria 2098
530 Ga0496109_0005892 3300048912 Bacteria 10280
531 Ga0496109_0091160 3300048912 Bacteria 2819
532 Ga0496110_0000068 3300048913 Bacteria 51803
533 Ga0496110_0069616 3300048913 Bacteria 3116
534 Ga0496111_0004485 3300048914 Bacteria 8834
535 Ga0496111_0067322 3300048914 Bacteria 2602
536 Ga0496112_0133212 3300048915 Bacteria 2456
537 Ga0496113_0010273 3300048916 Bacteria 6185
538 Ga0496113_0045202 3300048916 Bacteria 3265
539 Ga0496113_0099526 3300048916 Bacteria 2252
540 Ga0496115_0098378 3300048918 Bacteria 2396
541 Ga0496122_0000445 3300048925 Bacteria 86566
542 Ga0496122_0007581 3300048925 Bacteria 12004
543 Ga0496122_0151962 3300048925 Bacteria 1428
544 Ga0496123_0001531 3300048926 Bacteria 31933
545 Ga0496123_0004693 3300048926 Bacteria 14154
546 Ga0496124_0008983 3300048927 Bacteria 10343
547 Ga0496124_0070395 3300048927 Bacteria 2902
548 Ga0496124_0385484 3300048927 Bacteria 978
549 Ga0496125_0002437 3300048928 Bacteria 24169
550 Ga0496125_0039704 3300048928 Bacteria 4048
551 Ga0496125_0168342 3300048928 Bacteria 1477
552 Ga0495678_000233 3300049459 Bacteria 63499
553 Ga0495678_000316 3300049459 Bacteria 51625
554 Ga0495678_002167 3300049459 Bacteria 13851
555 Ga0495678_002394 3300049459 Bacteria 12819
556 Ga0495678_007376 3300049459 Bacteria 5707
557 Ga0495682_0000107 3300049460 Bacteria 73486
558 Ga0495682_0001302 3300049460 Bacteria 13874
559 Ga0495682_0084273 3300049460 Bacteria 1142
560 Ga0501035_0029108 3300049822 Bacteria 5037
561 Ga0501035_0083768 3300049822 Bacteria 2813
562 Ga0501044_0000485 3300049823 Bacteria 48260
563 Ga0466962_0025439 3300061719 Bacteria 2841
564 Ga0466962_0046618 3300061719 Bacteria 2071
565 Ga0466962_0068166 3300061719 Bacteria 1699
566 2513957515 2513237150 Bacteria 6553639
567 2514044942 2513237165 Bacteria 6771773
568 2601531500 2600255256 Bacteria 5597742
569 2601536872 2600255257 Bacteria 5597196
570 2601755218 2600255310 Bacteria 5600903
571 2601760585 2600255311 Bacteria 5598766
572 2603639373 2602042046 Bacteria 5483348
573 2643798068 2643221556 Bacteria 7251154
574 2644473246 2643221684 Bacteria 7145183
575 2671585903 2671180115 Bacteria 5353919
576 2809144547 2808606418 Bacteria 6724496
577 2813730405 2811995292 Bacteria 5303342
578 2814698014 2814123068 Bacteria 5687681
579 2834644402 2834641062 Bacteria 5559922
580 2928131158 2928130867 Bacteria 5467269
581 3000379140 3000376612 Bacteria 4705565
582 644747711 644736347 Bacteria 6476522
583 8003404215 8003400568 Bacteria 5535898
584 8047678073 8047673197 Bacteria 7395230
585 8054845797 8054844752 Bacteria 4450330
586 8055693986 8055693939 Bacteria 4772047
587 Ga0495584_0037678
588 JGI25151J46595_10032590
589 rootL2_10041077
590 rootL2_10087971
591 Ga0055525_1000009
592 Ga0055526_1003551
593 Ga0055526_1007633
594 Ga0055526_1011052
595 Ga0055526_1017616
596 Ga0055537_1000066
597 Ga0055524_1000798
598 Ga0055524_1006957
599 Ga0055536_1000074
600 Ga0055534_1000057
601 Ga0055534_1000616
602 Ga0055528_1000069
603 Ga0065165_1002874
604 Ga0065165_1060596
605 Ga0070658_10044598
606 Ga0070658_10095086
607 Ga0070680_100242719
608 Ga0070660_100043982
609 Ga0070660_100085399
610 Ga0070661_100008038
611 Ga0070659_100054667
612 Ga0070659_100082340
613 Ga0070663_100396922
614 Ga0070663_100514279
615 Ga0070662_100069084
616 Ga0070681_10253314
617 Ga0070681_10350429
618 Ga0070679_100694136
619 Ga0068855_100070433
620 Ga0070664_100007189
621 Ga0070664_100085162
622 Ga0068852_100209970
623 Ga0079104_1001008
624 Ga0105251_10000112
625 Ga0105250_10000108
626 Ga0105245_10052409
627 Ga0105243_10010198
628 Ga0105241_10013601
629 Ga0105242_10011672
630 Ga0105237_10102204
631 Ga0105246_10031635
632 Ga0157373_10187619
633 Ga0157370_10292244
634 Ga0209563_100015
635 Ga0209677_103314
636 Ga0209148_1000930
637 Ga0209565_1000006
638 Ga0209565_1000267
639 Ga0209673_1000004
640 Ga0209673_1008504
641 Ga0209675_1000006
642 Ga0209675_1000210
643 Ga0209675_1000644
644 Ga0209676_1000012
645 Ga0209025_1000306
646 Ga0209025_1003153
647 Ga0209564_1000102
648 Ga0209564_1000567
649 Ga0209564_1000859
650 Ga0209564_1001254
651 Ga0209256_1000037
652 Ga0209256_1000059
653 Ga0207696_1000214
654 Ga0207713_1000087
655 Ga0207705_10079300
656 Ga0207654_10025131
657 Ga0207707_10308503
658 Ga0207657_10013950
659 Ga0207657_10042023
660 Ga0207657_10052973
661 Ga0207652_10350929
662 Ga0207690_10316150
663 Ga0207706_10026624
664 Ga0207686_10004224
665 Ga0207679_10007524
666 Ga0207679_10112966
667 Ga0207667_10182371
668 Ga0207678_10223133
669 Ga0207702_10211438
670 Ga0207698_10069061
671 Ga0209281_1000050
672 Ga0268264_10054229
673 Ga0395899_0006007
674 Ga0395899_0018471
675 Ga0395899_0037951
676 Ga0395900_0001327
677 Ga0395900_0001337
678 Ga0395900_0002040
679 Ga0395900_0004302
680 Ga0395900_0006110
681 Ga0395900_0019473
682 Ga0395900_0085878
683 Ga0395900_0301168
684 Ga0395900_0696165
685 Ga0395898_0027743
686 Ga0395898_0084467
687 Ga0395905_0028509
688 Ga0395905_0054195
689 Ga0395905_0059568
690 Ga0395905_0083149
691 Ga0395905_0110677
692 Ga0395905_0173881
693 Ga0395905_0233839
694 Ga0395901_0000229
695 Ga0395901_0006677
696 Ga0395901_0020246
697 Ga0395901_0134360
698 Ga0395901_0291514
699 Ga0395901_0677224
700 Ga0439448_0000641
701 Ga0439452_000550
702 Ga0450904_000055
703 Ga0439458_0020283
704 Ga0466969_0029768
705 Ga0466969_0037847
706 Ga0466969_0045292
707 Ga0466969_0142480
708 Ga0466972_0003218
709 Ga0466965_0044176
710 Ga0466966_0001914
711 Ga0466966_0014154
712 Ga0466966_0014262
713 Ga0466966_0047078
714 Ga0466961_0060574
715 Ga0466961_0171721
716 Ga0466963_0139726
717 Ga0466963_0270883
718 Ga0466964_0003176
719 Ga0466964_0006190
720 Ga0466964_0051611
721 Ga0466968_0008925
722 Ga0466957_0006853
723 Ga0466957_0020946
724 Ga0466957_0030026
725 Ga0466957_0054810
726 Ga0466959_0037617
727 Ga0466958_0064745
728 Ga0466958_0283315
729 Ga0466967_0060963
730 Ga0466967_0127400
731 Ga0495617_000002
732 Ga0495627_000207
733 Ga0495603_0203013
734 Ga0495590_0000025
735 Ga0495590_0015638
736 Ga0495591_000246
737 Ga0495591_008441
738 Ga0495591_011855
739 Ga0495629_0058719
740 Ga0495629_0170482
741 Ga0495638_0016988
742 Ga0495638_0045095
743 Ga0495653_0008877
744 Ga0495653_0112002
745 Ga0495653_0142542
746 Ga0495650_0000015
747 Ga0495650_0000124
748 Ga0495650_0012621
749 Ga0495582_0002194
750 Ga0495582_0006775
751 Ga0495605_0000293
752 Ga0495605_0002221
753 Ga0495605_0003577
754 Ga0495605_0013652
755 Ga0495605_0025421
756 Ga0495605_0034802
757 Ga0495605_0035524
758 Ga0495605_0049595
759 Ga0495605_0055926
760 Ga0495605_0073549
761 Ga0495605_0116842
762 Ga0495584_0000070
763 Ga0495584_0001443
764 Ga0495584_0002152
765 Ga0495584_0002274
766 Ga0495584_0004947
767 Ga0495584_0005819
768 Ga0495584_0007124
769 Ga0495584_0008754
770 Ga0495584_0047091
771 Ga0495584_0085650
772 Ga0495584_0132883
773 Ga0495584_0215118
774 Ga0495584_0257360
775 Ga0495585_0001061
776 Ga0495585_0001538
777 Ga0495585_0002202
778 Ga0495585_0012014
779 Ga0495585_0013402
780 Ga0495585_0017441
781 Ga0495585_0018038
782 Ga0495585_0026886
783 Ga0495585_0030779
784 Ga0495585_0038617
785 Ga0495585_0063208
786 Ga0495585_0067489
787 Ga0495585_0098073
788 Ga0495585_0101782
789 Ga0495594_0001482
790 Ga0495594_0049617
791 Ga0495594_0088922
792 Ga0495594_0102313
793 Ga0495596_0000847
794 Ga0495596_0002396
795 Ga0495596_0006133
796 Ga0495596_0006577
797 Ga0495596_0006838
798 Ga0495596_0014474
799 Ga0495596_0018899
800 Ga0495596_0025163
801 Ga0495596_0039566
802 Ga0495596_0042049
803 Ga0495596_0044512
804 Ga0495596_0052457
805 Ga0495607_0001784
806 Ga0495607_0002697
807 Ga0495607_0003269
808 Ga0495607_0005667
809 Ga0495607_0007843
810 Ga0495607_0008524
811 Ga0495607_0026141
812 Ga0495607_0041916
813 Ga0495607_0054680
814 Ga0495607_0143246
815 Ga0495607_0152686
816 Ga0495583_0000372
817 Ga0495583_0000382
818 Ga0495583_0002348
819 Ga0495583_0006212
820 Ga0495583_0010090
821 Ga0495583_0023412
822 Ga0495583_0066901
823 Ga0495583_0066989
824 Ga0495583_0079954
825 Ga0495583_0091644
826 Ga0495583_0105836
827 Ga0495606_0004650
828 Ga0495606_0008165
829 Ga0495606_0010040
830 Ga0495606_0011139
831 Ga0495606_0025071
832 Ga0495606_0042480
833 Ga0495606_0055745
834 Ga0495606_0067965
835 Ga0495606_0089923
836 Ga0495606_0136797
837 Ga0495606_0151180
838 Ga0495610_0000229
839 Ga0495610_0000993
840 Ga0495616_0000057
841 Ga0495616_0000207
842 Ga0495616_0005637
843 Ga0495616_0005696
844 Ga0495616_0012844
845 Ga0495616_0016710
846 Ga0495616_0022993
847 Ga0495616_0028046
848 Ga0495616_0042380
849 Ga0495616_0045814
850 Ga0495631_0000951
851 Ga0495631_0003544
852 Ga0495631_0004785
853 Ga0495631_0005309
854 Ga0495631_0005574
855 Ga0495631_0006955
856 Ga0495631_0008270
857 Ga0495631_0008465
858 Ga0495631_0010559
859 Ga0495631_0019657
860 Ga0495631_0021220
861 Ga0495631_0081943
862 Ga0495632_0000077
863 Ga0495632_0000129
864 Ga0495632_0000296
865 Ga0495632_0009761
866 Ga0495632_0015199
867 Ga0495632_0018451
868 Ga0495632_0048682
869 Ga0495637_0000019
870 Ga0495637_0064250
871 Ga0495637_0128507
872 Ga0495643_0000415
873 Ga0495643_0000453
874 Ga0495643_0002628
875 Ga0495643_0003068
876 Ga0495643_0006948
877 Ga0495643_0015883
878 Ga0495643_0016103
879 Ga0495643_0034525
880 Ga0495644_0008033
881 Ga0495644_0015849
882 Ga0495644_0016942
883 Ga0495644_0017003
884 Ga0495644_0046916
885 Ga0495644_0047396
886 Ga0495648_0001105
887 Ga0495648_0003427
888 Ga0495648_0003935
889 Ga0495648_0006464
890 Ga0495648_0007707
891 Ga0495648_0010633
892 Ga0495648_0018789
893 Ga0495648_0053201
894 Ga0495648_0160630
895 Ga0495666_0016778
896 Ga0495666_0027931
897 Ga0495642_0000085
898 Ga0495642_0000285
899 Ga0495642_0000313
900 Ga0495642_0001578
901 Ga0495642_0004274
902 Ga0495642_0005178
903 Ga0495642_0005578
904 Ga0495642_0007414
905 Ga0495642_0026845
906 Ga0495642_0050542
907 Ga0495652_0049693
908 Ga0495652_0060562
909 Ga0495654_0005307
910 Ga0495654_0007211
911 Ga0495654_0019601
912 Ga0495654_0036080
913 Ga0495665_0007366
914 Ga0495665_0012671
915 Ga0495640_0051803
916 Ga0495587_0216592
917 Ga0495609_0000002
918 Ga0495609_0000886
919 Ga0495609_0001182
920 Ga0495609_0001343
921 Ga0495609_0020603
922 Ga0495609_0052236
923 Ga0495609_0119594
924 Ga0495597_0000226
925 Ga0495597_0000812
926 Ga0495597_0000995
927 Ga0495597_0003839
928 Ga0495597_0024406
929 Ga0495597_0027118
930 Ga0495597_0047010
931 Ga0495597_0076372
932 Ga0495597_0097789
933 Ga0495622_0006961
934 Ga0495633_0001851
935 Ga0495633_0003620
936 Ga0495633_0014055
937 Ga0495633_0014124
938 Ga0495633_0020568
939 Ga0495633_0026239
940 Ga0495633_0085699
941 Ga0495633_0117793
942 Ga0495656_0004993
943 Ga0495668_0000274
944 Ga0495668_0000941
945 Ga0495668_0002973
946 Ga0495668_0004993
947 Ga0495668_0010510
948 Ga0495668_0019933
949 Ga0495668_0023942
950 Ga0495668_0044399
951 Ga0495668_0059964
952 Ga0495668_0108996
953 Ga0495668_0151399
954 Ga0495611_0000195
955 Ga0495611_0000773
956 Ga0495611_0002922
957 Ga0495611_0003812
958 Ga0495611_0016698
959 Ga0495611_0019310
960 Ga0495611_0025406
961 Ga0495611_0050927
962 Ga0495625_0020521
963 Ga0495625_0021642
964 Ga0495625_0080808
965 Ga0495625_0179426
966 Ga0495635_0006164
967 Ga0495635_0075702
968 Ga0495661_0001749
969 Ga0495661_0001834
970 Ga0495661_0002660
971 Ga0495661_0003316
972 Ga0495661_0003878
973 Ga0495661_0004982
974 Ga0495661_0005057
975 Ga0495661_0005612
976 Ga0495661_0006339
977 Ga0495661_0030101
978 Ga0495661_0048480
979 Ga0495661_0056025
980 Ga0495661_0109956
981 Ga0495661_0112440
982 Ga0495588_0000177
983 Ga0495588_0007375
984 Ga0495588_0017811
985 Ga0495588_0019331
986 Ga0495588_0112608
987 Ga0495623_0007137
988 Ga0495623_0008273
989 Ga0495646_0086959
990 Ga0495669_0000092
991 Ga0495669_0001619
992 Ga0495669_0021104
993 Ga0495613_0039187
994 Ga0495613_0170481
995 Ga0495670_0000623
996 Ga0495670_0005797
997 Ga0495670_0018205
998 Ga0495670_0020078
999 Ga0495670_0023235
1000 Ga0495670_0032779
1001 Ga0495670_0095447
1002 Ga0495671_0000965
1003 Ga0495671_0001021
1004 Ga0495671_0007168
1005 Ga0495671_0010365
1006 Ga0495671_0013348
1007 Ga0495671_0030653
1008 Ga0495671_0069333
1009 Ga0495649_0001292
1010 Ga0495649_0005918
1011 Ga0495649_0069733
1012 Ga0495649_0088452
1013 Ga0495649_0096563
1014 Ga0495649_0123907
1015 Ga0495589_0000357
1016 Ga0495589_0000535
1017 Ga0495589_0000972
1018 Ga0495589_0004770
1019 Ga0495589_0016723
1020 Ga0495589_0018340
1021 Ga0495589_0051805
1022 Ga0495589_0123034
1023 Ga0495600_0141326
1024 Ga0495660_0001272
1025 Ga0495660_0002353
1026 Ga0495660_0005882
1027 Ga0495660_0010195
1028 Ga0495660_0022141
1029 Ga0495660_0043476
1030 Ga0495581_0363291
1031 Ga0495604_0020341
1032 Ga0495604_0056352
1033 Ga0495604_0094836
1034 Ga0495636_0001920
1035 Ga0495672_0000041
1036 Ga0495672_0000748
1037 Ga0495672_0001917
1038 Ga0495672_0004338
1039 Ga0495672_0020015
1040 Ga0495672_0026266
1041 Ga0495672_0179454
1042 Ga0495676_0000309
1043 Ga0495676_0002463
1044 Ga0495676_0004701
1045 Ga0495680_0009206
1046 Ga0495680_0327602
1047 Ga0495683_0001473
1048 Ga0495683_0006731
1049 Ga0495683_0034596
1050 Ga0495683_0041695
1051 Ga0495687_000127
1052 Ga0495687_001937
1053 Ga0495687_001953
1054 Ga0495687_002700
1055 Ga0495687_030144
1056 Ga0495687_073046
1057 Ga0495675_0029408
1058 Ga0495675_0159389
1059 Ga0495677_0000041
1060 Ga0495677_0001364
1061 Ga0495677_0001520
1062 Ga0495677_0001956
1063 Ga0495677_0004851
1064 Ga0495677_0007333
1065 Ga0495677_0025340
1066 Ga0495677_0036734
1067 Ga0495679_003572
1068 Ga0495679_027345
1069 Ga0495679_055563
1070 Ga0495679_067997
1071 Ga0495685_007488
1072 Ga0495685_034031
1073 Ga0495685_046671
1074 Ga0495685_103200
1075 Ga0495681_0000667
1076 Ga0495681_0001424
1077 Ga0495681_0001579
1078 Ga0495681_0019584
1079 Ga0495681_0020783
1080 Ga0495681_0065925
1081 Ga0495686_0000732
1082 Ga0495686_0001773
1083 Ga0495686_0059189
1084 Ga0495686_0125657
1085 Ga0495593_0008026
1086 Ga0495593_0021037
1087 Ga0495602_0005903
1088 Ga0495614_0005786
1089 Ga0495614_0013189
1090 Ga0495626_0000003
1091 Ga0495626_0000390
1092 Ga0495626_0001008
1093 Ga0495626_0002215
1094 Ga0495626_0002565
1095 Ga0495626_0003207
1096 Ga0495626_0005095
1097 Ga0495626_0005673
1098 Ga0495626_0005914
1099 Ga0495626_0017222
1100 Ga0495626_0018482
1101 Ga0495626_0032335
1102 Ga0495626_0049619
1103 Ga0495626_0095882
1104 Ga0495626_0102351
1105 Ga0496100_0016408
1106 Ga0496100_0332953
1107 Ga0496101_0017410
1108 Ga0496101_0157735
1109 Ga0496102_0002521
1110 Ga0496102_0278231
1111 Ga0496102_0485645
1112 Ga0496104_0286457
1113 Ga0496105_0263999
1114 Ga0496106_0001933
1115 Ga0496106_0115029
1116 Ga0496109_0005892
1117 Ga0496109_0091160
1118 Ga0496110_0000068
1119 Ga0496110_0069616
1120 Ga0496111_0004485
1121 Ga0496111_0067322
1122 Ga0496112_0133212
1123 Ga0496113_0010273
1124 Ga0496113_0045202
1125 Ga0496113_0099526
1126 Ga0496115_0098378
1127 Ga0496122_0000445
1128 Ga0496122_0007581
1129 Ga0496122_0151962
1130 Ga0496123_0001531
1131 Ga0496123_0004693
1132 Ga0496124_0008983
1133 Ga0496124_0070395
1134 Ga0496124_0385484
1135 Ga0496125_0002437
1136 Ga0496125_0039704
1137 Ga0496125_0168342
1138 Ga0495678_000233
1139 Ga0495678_000316
1140 Ga0495678_002167
1141 Ga0495678_002394
1142 Ga0495678_007376
1143 Ga0495682_0000107
1144 Ga0495682_0001302
1145 Ga0495682_0084273
1146 Ga0501035_0029108
1147 Ga0501035_0083768
1148 Ga0501044_0000485
1149 Ga0466962_0025439
1150 Ga0466962_0046618
1151 Ga0466962_0068166
1152 2513957515
1153 2514044942
1154 2601531500
1155 2601536872
1156 2601755218
1157 2601760585
1158 2603639373
1159 2643798068
1160 2644473246
1161 2671585903
1162 2809144547
1163 2813730405
1164 2814698014
1165 2834644402
1166 2928131158
1167 3000379140
1168 644747711
1169 8003404215
1170 8047678073
1171 8054845797
1172 8055693986

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

28

185

0.96

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

29

79

0.95

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

190

310

0.92

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

13

147

0.89

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

28

99

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pdu-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ 0.9422 2 266
3pef-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with nadp+ 0.9381 2 266
3doj-assembly1.cif.gz_A structure of glyoxylate reductase 1 from arabidopsis (atglyr1) 0.937 2 267
4gbj-assembly2.cif.gz_C crystal structure of nad-binding 6-phosphogluconate dehydrogenase from dyadobacter fermentans 0.9339 1 273
4gbj-assembly2.cif.gz_C crystal structure of nad-binding 6-phosphogluconate dehydrogenase from dyadobacter fermentans 0.9306 1 273
ID Description Score Start End Superfamily
af_Q5RKN4_340_462_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9478 149 266 1.10.1040.10
af_Q8T079_480_601_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9464 150 267 1.10.1040.10
3pduA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9371 150 266 1.10.1040.10
af_P77161_159_292_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9369 150 271 1.10.1040.10
3pefB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9359 150 266 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A382FMT9-F1-model_v4 6-phosphogluconate dehydrogenase NADP-binding domain-containing protein 0.9875 2 102 GO:0050661
AF-A0A538CN49-F1-model_v4 6-phosphogluconate dehydrogenase NADP-binding domain-containing protein 0.9857 2 117 GO:0050661
AF-A0A379D7R2-F1-model_v4 deleted 0.9777 123 273
AF-T1BP90-F1-model_v4 6-phosphogluconate dehydrogenase, NAD-binding protein 0.9776 123 270 GO:0051287
AF-A0A4Q5V643-F1-model_v4 deleted 0.9762 1 102

Map