F466635

General Info

Members Datasets Scaffolds Average Seq Length
587 347 1174 159

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100116477|Ga0070671_1001164772
Length 180
Sequence MAPRLIVYLHHSFRFGDFFMPRFLILASAVIAMLATSVAGTSAQSSMTRVQVGILECRGGASVGFIVGSVTNLGCVLRAEGMPEDRYIATIRKVGLDLGITAESALAWGVYAPVARLGPGDLAGDYAGAQGSATLGVGVGGNVLVGGSANSIALQPLSVQGQVGVSVAAGLESLELRPGR

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
159 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
174 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
192 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
232 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
249 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
272 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
278 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
279 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
280 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
292 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
297 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
298 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
299 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
300 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
301 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
302 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
303 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
304 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
305 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
306 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
307 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
308 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
309 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
310 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
311 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
312 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
313 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
314 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
315 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
316 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
317 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
318 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
319 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
320 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
321 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
322 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
323 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
324 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
325 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
326 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
327 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
328 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
329 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
330 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
331 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
334 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
335 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
336 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
337 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
338 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
339 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
340 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
341 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
342 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
343 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
344 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
345 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
346 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
347 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.76
Metatranscriptomes 0.68
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.44
Nodule 1.7
Rhizoplane 7.84
Rhizosphere 69.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100116477 3300005355 Bacteria 2247
2 LJQas_1008496 3300000549 Bacteria 1248
3 JGI25404J52841_10018792 3300003659 Bacteria 1498
4 Ga0065165_1023758 3300005262 Bacteria 2072
5 Ga0065715_10833558 3300005293 Bacteria 598
6 Ga0070683_101029509 3300005329 Bacteria 791
7 Ga0070690_100362053 3300005330 Bacteria 1056
8 Ga0070666_10113509 3300005335 Bacteria 1875
9 Ga0070680_100013024 3300005336 Bacteria 6472
10 Ga0070680_100101388 3300005336 Bacteria 2390
11 Ga0070680_100151637 3300005336 Bacteria 1946
12 Ga0070680_100253650 3300005336 Bacteria 1488
13 Ga0070680_100610041 3300005336 Bacteria 937
14 Ga0070680_101429010 3300005336 Bacteria 599
15 Ga0070680_101699734 3300005336 Bacteria 547
16 Ga0070682_100031969 3300005337 Bacteria 3187
17 Ga0070682_100577607 3300005337 Bacteria 884
18 Ga0068868_100101930 3300005338 Bacteria 2323
19 Ga0070660_100006991 3300005339 Bacteria 7831
20 Ga0070689_100825001 3300005340 Bacteria 817
21 Ga0070691_10049020 3300005341 Bacteria 2011
22 Ga0070691_10560839 3300005341 Bacteria 669
23 Ga0070661_100039476 3300005344 Bacteria 3439
24 Ga0070661_100107153 3300005344 Bacteria 2084
25 Ga0070692_10829176 3300005345 Bacteria 634
26 Ga0070668_100093836 3300005347 Bacteria 2369
27 Ga0070668_100765446 3300005347 Bacteria 856
28 Ga0070669_100077905 3300005353 Bacteria 2463
29 Ga0070671_100281825 3300005355 Bacteria 1414
30 Ga0070674_100297958 3300005356 Bacteria 1284
31 Ga0070674_101133613 3300005356 Bacteria 692
32 Ga0070673_100195432 3300005364 Bacteria 1740
33 Ga0070673_101220536 3300005364 Bacteria 705
34 Ga0070688_100379400 3300005365 Bacteria 1042
35 Ga0070659_100129339 3300005366 Bacteria 2050
36 Ga0070659_100216618 3300005366 Bacteria 1579
37 Ga0070667_100083186 3300005367 Bacteria 2741
38 Ga0070667_100237719 3300005367 Bacteria 1626
39 Ga0070709_10002338 3300005434 Bacteria 10273
40 Ga0070709_10629021 3300005434 Bacteria 829
41 Ga0070709_11163347 3300005434 Bacteria 619
42 Ga0070714_100066550 3300005435 Bacteria 3105
43 Ga0070713_100397034 3300005436 Bacteria 1287
44 Ga0070710_10005939 3300005437 Bacteria 5829
45 Ga0070710_10109550 3300005437 Bacteria 1657
46 Ga0070711_100002208 3300005439 Bacteria 11048
47 Ga0070711_100051142 3300005439 Bacteria 2836
48 Ga0070705_100525593 3300005440 Bacteria 903
49 Ga0070694_100867171 3300005444 Bacteria 744
50 Ga0070708_100514024 3300005445 Bacteria 1130
51 Ga0070663_100251085 3300005455 Bacteria 1400
52 Ga0070663_100303529 3300005455 Bacteria 1279
53 Ga0070663_100779159 3300005455 Bacteria 819
54 Ga0070678_100238015 3300005456 Bacteria 1521
55 Ga0070678_100334684 3300005456 Bacteria 1297
56 Ga0070678_100573215 3300005456 Bacteria 1005
57 Ga0070681_10057197 3300005458 Bacteria 3880
58 Ga0070685_10278521 3300005466 Bacteria 1119
59 Ga0070698_100492898 3300005471 Bacteria 1163
60 Ga0070699_101135331 3300005518 Bacteria 717
61 Ga0070679_100083419 3300005530 Bacteria 3184
62 Ga0070679_100099081 3300005530 Bacteria 2902
63 Ga0070679_100148109 3300005530 Bacteria 2325
64 Ga0070679_100184985 3300005530 Bacteria 2055
65 Ga0070679_100210094 3300005530 Bacteria 1910
66 Ga0068853_100002207 3300005539 Bacteria 14542
67 Ga0068853_100006767 3300005539 Bacteria 9133
68 Ga0068853_100091422 3300005539 Bacteria 2676
69 Ga0068853_100272578 3300005539 Bacteria 1559
70 Ga0068853_100978694 3300005539 Bacteria 814
71 Ga0070686_100147014 3300005544 Bacteria 1646
72 Ga0070695_100487240 3300005545 Bacteria 951
73 Ga0070695_101488598 3300005545 Bacteria 563
74 Ga0070696_101245527 3300005546 Bacteria 630
75 Ga0070696_101319510 3300005546 Bacteria 613
76 Ga0070696_101408141 3300005546 Bacteria 595
77 Ga0070693_100068028 3300005547 Bacteria 2090
78 Ga0070665_100151870 3300005548 Bacteria 2319
79 Ga0070665_100255745 3300005548 Bacteria 1752
80 Ga0070665_100356008 3300005548 Bacteria 1469
81 Ga0068855_100110807 3300005563 Bacteria 3150
82 Ga0068855_100112947 3300005563 Bacteria 3117
83 Ga0068855_100187469 3300005563 Bacteria 2336
84 Ga0068855_100386088 3300005563 Bacteria 1537
85 Ga0068855_101139469 3300005563 Bacteria 814
86 Ga0070664_100098130 3300005564 Bacteria 2545
87 Ga0068857_100044284 3300005577 Bacteria 3947
88 Ga0068854_100008629 3300005578 Bacteria 6559
89 Ga0068854_100451514 3300005578 Bacteria 1074
90 Ga0068856_100054109 3300005614 Bacteria 3958
91 Ga0068856_100116648 3300005614 Bacteria 2670
92 Ga0068856_100182397 3300005614 Bacteria 2113
93 Ga0070702_100060854 3300005615 Bacteria 2197
94 Ga0070702_100983130 3300005615 Bacteria 667
95 Ga0068852_100011735 3300005616 Bacteria 6614
96 Ga0068852_100152915 3300005616 Bacteria 2147
97 Ga0068852_100212069 3300005616 Bacteria 1838
98 Ga0068852_100225372 3300005616 Bacteria 1784
99 Ga0068852_100655435 3300005616 Bacteria 1058
100 Ga0068859_100057352 3300005617 Bacteria 3923
101 Ga0068866_10503710 3300005718 Bacteria 802
102 Ga0068861_100020959 3300005719 Bacteria 4691
103 Ga0068861_100051542 3300005719 Bacteria 3124
104 Ga0068861_101110147 3300005719 Bacteria 760
105 Ga0068851_10017739 3300005834 Bacteria 3423
106 Ga0068863_100042307 3300005841 Bacteria 4329
107 Ga0068858_100072672 3300005842 Bacteria 3191
108 Ga0068860_100333005 3300005843 Bacteria 1491
109 Ga0068860_100821145 3300005843 Bacteria 943
110 Ga0081540_1053672 3300005983 Bacteria 1975
111 Ga0070717_10022827 3300006028 Bacteria 4950
112 Ga0070717_10223200 3300006028 Bacteria 1657
113 Ga0075365_10020835 3300006038 Bacteria 4074
114 Ga0075365_10327183 3300006038 Bacteria 1079
115 Ga0075365_10795019 3300006038 Bacteria 668
116 Ga0075368_10325398 3300006042 Bacteria 666
117 Ga0075363_100162596 3300006048 Bacteria 1265
118 Ga0075364_10069634 3300006051 Bacteria 2315
119 Ga0075364_10075732 3300006051 Bacteria 2220
120 Ga0075364_10860063 3300006051 Bacteria 617
121 Ga0070715_10000762 3300006163 Bacteria 8717
122 Ga0070716_100038130 3300006173 Bacteria 2659
123 Ga0070716_100169405 3300006173 Bacteria 1424
124 Ga0070716_100190831 3300006173 Bacteria 1354
125 Ga0070716_100595356 3300006173 Bacteria 831
126 Ga0070712_100033040 3300006175 Bacteria 3497
127 Ga0070712_100306226 3300006175 Bacteria 1287
128 Ga0070712_100681618 3300006175 Bacteria 875
129 Ga0075367_10081962 3300006178 Bacteria 1953
130 Ga0075367_10847157 3300006178 Bacteria 583
131 Ga0075369_10006028 3300006186 Bacteria 4565
132 Ga0075369_10097985 3300006186 Bacteria 1313
133 Ga0075366_10038074 3300006195 Bacteria 2840
134 Ga0097621_100130302 3300006237 Bacteria 2140
135 Ga0075370_10196716 3300006353 Bacteria 1189
136 Ga0075370_10264025 3300006353 Bacteria 1021
137 Ga0068871_100261466 3300006358 Bacteria 1510
138 Ga0075434_100845158 3300006871 Bacteria 931
139 Ga0068865_101184368 3300006881 Bacteria 676
140 Ga0097620_100057352 3300006931 Bacteria 3923
141 Ga0099794_10039886 3300007265 Bacteria 2231
142 Ga0105240_10012128 3300009093 Bacteria 11932
143 Ga0105240_10044810 3300009093 Bacteria 5616
144 Ga0105245_10058082 3300009098 Bacteria 3482
145 Ga0105247_10006919 3300009101 Bacteria 6984
146 Ga0105243_10074303 3300009148 Bacteria 2757
147 Ga0105243_11067632 3300009148 Bacteria 814
148 Ga0105241_10054562 3300009174 Bacteria 3059
149 Ga0105241_10242460 3300009174 Bacteria 1524
150 Ga0105242_10252974 3300009176 Bacteria 1588
151 Ga0105237_10078243 3300009545 Bacteria 3296
152 Ga0105237_10179551 3300009545 Bacteria 2117
153 Ga0105237_10577958 3300009545 Bacteria 1130
154 Ga0105238_10040525 3300009551 Bacteria 4719
155 Ga0105238_11233256 3300009551 Bacteria 773
156 Ga0105238_11659595 3300009551 Bacteria 670
157 Ga0105249_10022931 3300009553 Bacteria 5596
158 Ga0105249_10595320 3300009553 Bacteria 1160
159 Ga0105239_10056734 3300010375 Bacteria 4296
160 Ga0105239_10064895 3300010375 Bacteria 4008
161 Ga0105246_10030323 3300011119 Bacteria 3570
162 Ga0105246_11185711 3300011119 Bacteria 702
163 Ga0157370_10109082 3300013104 Bacteria 2588
164 Ga0157369_10006388 3300013105 Bacteria 13666
165 Ga0157369_10044612 3300013105 Bacteria 4824
166 Ga0157369_10158875 3300013105 Bacteria 2386
167 Ga0157369_10802110 3300013105 Bacteria 967
168 Ga0157378_10328789 3300013297 Bacteria 1487
169 Ga0157372_10149159 3300013307 Bacteria 2698
170 Ga0157375_10045330 3300013308 Bacteria 4279
171 Ga0157380_10101682 3300014326 Bacteria 2395
172 Ga0157380_11474009 3300014326 Bacteria 733
173 Ga0157376_10858234 3300014969 Bacteria 924
174 Ga0163161_10200638 3300017792 Bacteria 1537
175 Ga0163161_10316643 3300017792 Bacteria 1232
176 Ga0206354_11284064 3300020081 Bacteria 1027
177 Ga0224712_10087246 3300022467 Bacteria 1300
178 Ga0209233_1036920 3300025261 Bacteria 1091
179 Ga0209564_1000397 3300025295 Bacteria 77778
180 Ga0209564_1008259 3300025295 Bacteria 5177
181 Ga0207656_10004387 3300025321 Bacteria 4924
182 Ga0207692_10019957 3300025898 Bacteria 3039
183 Ga0207692_10083953 3300025898 Bacteria 1710
184 Ga0207642_10146538 3300025899 Bacteria 1251
185 Ga0207642_10260852 3300025899 Bacteria 988
186 Ga0207710_10070725 3300025900 Bacteria 1600
187 Ga0207688_10560341 3300025901 Bacteria 718
188 Ga0207680_10081903 3300025903 Bacteria 2030
189 Ga0207647_10055549 3300025904 Bacteria 2433
190 Ga0207699_10003036 3300025906 Bacteria 7971
191 Ga0207699_10046371 3300025906 Bacteria 2542
192 Ga0207699_10153939 3300025906 Bacteria 1524
193 Ga0207699_10678623 3300025906 Bacteria 753
194 Ga0207699_10800436 3300025906 Bacteria 693
195 Ga0207645_10122652 3300025907 Bacteria 1688
196 Ga0207654_10001136 3300025911 Bacteria 14369
197 Ga0207654_10075482 3300025911 Bacteria 2015
198 Ga0207654_10164125 3300025911 Bacteria 1437
199 Ga0207707_10002224 3300025912 Bacteria 17529
200 Ga0207707_10084314 3300025912 Bacteria 2775
201 Ga0207695_10004577 3300025913 Bacteria 18798
202 Ga0207695_10137453 3300025913 Bacteria 2396
203 Ga0207695_10879181 3300025913 Bacteria 776
204 Ga0207671_10250349 3300025914 Bacteria 1393
205 Ga0207671_10586616 3300025914 Bacteria 888
206 Ga0207693_10060842 3300025915 Bacteria 2958
207 Ga0207693_10110049 3300025915 Bacteria 2160
208 Ga0207693_10114738 3300025915 Bacteria 2114
209 Ga0207693_10132194 3300025915 Bacteria 1962
210 Ga0207663_10000239 3300025916 Bacteria 24165
211 Ga0207663_10193366 3300025916 Bacteria 1462
212 Ga0207660_10022785 3300025917 Bacteria 4222
213 Ga0207660_10179444 3300025917 Bacteria 1644
214 Ga0207660_10211996 3300025917 Bacteria 1517
215 Ga0207660_10676250 3300025917 Bacteria 842
216 Ga0207657_10005246 3300025919 Bacteria 13576
217 Ga0207649_10196687 3300025920 Bacteria 1421
218 Ga0207652_10004348 3300025921 Bacteria 11546
219 Ga0207652_10052869 3300025921 Bacteria 3488
220 Ga0207652_10120190 3300025921 Bacteria 2337
221 Ga0207652_10129972 3300025921 Bacteria 2246
222 Ga0207652_10758183 3300025921 Bacteria 863
223 Ga0207681_10195828 3300025923 Bacteria 1549
224 Ga0207694_10000263 3300025924 Bacteria 50099
225 Ga0207694_11232027 3300025924 Bacteria 633
226 Ga0207687_10042859 3300025927 Bacteria 3116
227 Ga0207700_10005825 3300025928 Bacteria 7404
228 Ga0207700_10231565 3300025928 Bacteria 1571
229 Ga0207664_10010462 3300025929 Bacteria 6554
230 Ga0207664_10560936 3300025929 Bacteria 1025
231 Ga0207644_10073099 3300025931 Bacteria 2513
232 Ga0207644_10532583 3300025931 Bacteria 971
233 Ga0207644_10642325 3300025931 Bacteria 883
234 Ga0207690_10076892 3300025932 Bacteria 2319
235 Ga0207706_10154767 3300025933 Bacteria 2016
236 Ga0207706_10581869 3300025933 Bacteria 962
237 Ga0207709_10537243 3300025935 Bacteria 918
238 Ga0207709_10710385 3300025935 Bacteria 805
239 Ga0207669_10221830 3300025937 Bacteria 1388
240 Ga0207704_10605344 3300025938 Bacteria 898
241 Ga0207665_10016227 3300025939 Bacteria 4890
242 Ga0207665_10191928 3300025939 Bacteria 1484
243 Ga0207665_10648429 3300025939 Bacteria 827
244 Ga0207665_10808577 3300025939 Bacteria 741
245 Ga0207691_10041060 3300025940 Bacteria 4274
246 Ga0207689_10046118 3300025942 Bacteria 3603
247 Ga0207661_10054826 3300025944 Bacteria 3195
248 Ga0207679_10168553 3300025945 Bacteria 1800
249 Ga0207667_10042856 3300025949 Bacteria 4807
250 Ga0207667_10173858 3300025949 Bacteria 2213
251 Ga0207667_10203698 3300025949 Bacteria 2029
252 Ga0207712_10210246 3300025961 Bacteria 1549
253 Ga0207668_10241608 3300025972 Bacteria 1461
254 Ga0207668_10245353 3300025972 Bacteria 1451
255 Ga0207668_10632743 3300025972 Bacteria 935
256 Ga0207668_11194760 3300025972 Bacteria 683
257 Ga0207668_11687935 3300025972 Bacteria 572
258 Ga0207640_10175528 3300025981 Bacteria 1601
259 Ga0207640_10420267 3300025981 Bacteria 1094
260 Ga0207658_10084693 3300025986 Bacteria 2440
261 Ga0207658_10345018 3300025986 Bacteria 1295
262 Ga0207677_10102129 3300026023 Bacteria 2113
263 Ga0207677_11171544 3300026023 Bacteria 703
264 Ga0207703_10035937 3300026035 Bacteria 3940
265 Ga0207703_10256676 3300026035 Bacteria 1578
266 Ga0207703_10413620 3300026035 Bacteria 1253
267 Ga0207639_10033069 3300026041 Bacteria 3812
268 Ga0207639_10080572 3300026041 Bacteria 2576
269 Ga0207639_10091060 3300026041 Bacteria 2441
270 Ga0207639_10173933 3300026041 Bacteria 1826
271 Ga0207678_10028150 3300026067 Bacteria 4908
272 Ga0207678_10040957 3300026067 Bacteria 4016
273 Ga0207678_10054613 3300026067 Bacteria 3440
274 Ga0207678_10091992 3300026067 Bacteria 2592
275 Ga0207702_10000003 3300026078 Bacteria 434196
276 Ga0207702_10051208 3300026078 Bacteria 3488
277 Ga0207641_10082654 3300026088 Bacteria 2791
278 Ga0207641_11511426 3300026088 Bacteria 673
279 Ga0207648_10064662 3300026089 Bacteria 3188
280 Ga0207676_10143282 3300026095 Bacteria 2048
281 Ga0207674_10042085 3300026116 Bacteria 4721
282 Ga0207674_10207845 3300026116 Bacteria 1907
283 Ga0207675_100099894 3300026118 Bacteria 2733
284 Ga0207675_100123214 3300026118 Bacteria 2454
285 Ga0207683_10021485 3300026121 Bacteria 5526
286 Ga0207683_10338347 3300026121 Bacteria 1380
287 Ga0207683_10449844 3300026121 Bacteria 1187
288 Ga0207698_10003760 3300026142 Bacteria 9172
289 Ga0207698_10020150 3300026142 Bacteria 4585
290 Ga0207698_10235550 3300026142 Bacteria 1665
291 Ga0207698_10429937 3300026142 Bacteria 1269
292 Ga0207698_10519180 3300026142 Bacteria 1162
293 Ga0209588_1005209 3300027671 Bacteria 3711
294 Ga0268266_10059443 3300028379 Bacteria 3293
295 Ga0268266_10194248 3300028379 Bacteria 1854
296 Ga0268265_10050565 3300028380 Bacteria 3132
297 Ga0268265_10219823 3300028380 Bacteria 1661
298 Ga0268264_10910392 3300028381 Bacteria 883
299 Ga0265334_10054880 3300028573 Bacteria 1518
300 Ga0265323_10000847 3300028653 Bacteria 16290
301 Ga0265336_10000460 3300028666 Bacteria 24606
302 Ga0307515_10076032 3300028794 Bacteria 4463
303 Ga0265338_10007843 3300028800 Bacteria 13114
304 Ga0307512_10395848 3300030522 Bacteria 583
305 Ga0265332_10059337 3300031238 Bacteria 1637
306 Ga0265340_10072641 3300031247 Bacteria 1629
307 Ga0265339_10005327 3300031249 Bacteria 8573
308 Ga0265339_10128751 3300031249 Bacteria 1296
309 Ga0265331_10244465 3300031250 Bacteria 805
310 Ga0265331_10246596 3300031250 Bacteria 801
311 Ga0265316_10318944 3300031344 Bacteria 1129
312 Ga0307513_10219859 3300031456 Bacteria 1722
313 Ga0307408_100581111 3300031548 Bacteria 993
314 Ga0307516_10014441 3300031730 Bacteria 8353
315 Ga0307516_10574527 3300031730 Bacteria 781
316 Ga0307405_10055884 3300031731 Bacteria 2473
317 Ga0307412_10119924 3300031911 Bacteria 1892
318 Ga0307412_10404727 3300031911 Bacteria 1112
319 Ga0373938_0006155 3300034957 Bacteria 2064
320 Ga0373940_0121661 3300035088 Bacteria 810
321 Ga0373940_0256389 3300035088 Bacteria 591
322 Ga0373923_0014550 3300035111 Bacteria 2957
323 Ga0373932_0210730 3300035112 Bacteria 694
324 Ga0373936_0013008 3300035113 Bacteria 3173
325 Ga0373945_0014721 3300035116 Bacteria 2625
326 Ga0373954_0055775 3300035118 Bacteria 1859
327 Ga0373957_0007752 3300035120 Bacteria 3448
328 Ga0373960_0124614 3300035121 Bacteria 858
329 Ga0373943_0040038 3300035170 Bacteria 2261
330 Ga0373943_0046688 3300035170 Bacteria 2114
331 Ga0373946_0042460 3300035171 Bacteria 1869
332 Ga0373955_0078419 3300035172 Bacteria 1861
333 Ga0373955_0309490 3300035172 Bacteria 953
334 Ga0373962_0194317 3300035242 Bacteria 684
335 Ga0373931_0002919 3300035691 Bacteria 7629
336 Ga0373935_0051350 3300035692 Bacteria 2618
337 Ga0373935_0278633 3300035692 Bacteria 1177
338 Ga0373927_0002293 3300035695 Bacteria 14012
339 Ga0373927_0046721 3300035695 Bacteria 2800
340 Ga0373927_0271406 3300035695 Bacteria 1115
341 Ga0373927_0679097 3300035695 Bacteria 680
342 Ga0373947_0006111 3300035725 Bacteria 7012
343 Ga0373947_0106522 3300035725 Bacteria 1767
344 Ga0373937_0105606 3300036401 Bacteria 2617
345 Ga0372808_001604 3300036459 Bacteria 2400
346 Ga0310109_027382 3300036534 Bacteria 761
347 Ga0373925_0020497 3300037068 Bacteria 4813
348 Ga0373925_0048125 3300037068 Bacteria 3176
349 Ga0373925_0272686 3300037068 Bacteria 1361
350 Ga0373925_0646131 3300037068 Bacteria 872
351 Ga0373925_1139995 3300037068 Bacteria 641
352 Ga0395905_0127901 3300037471 Bacteria 2389
353 Ga0436365_1452029 3300039437 Bacteria 656
354 Ga0436360_0554802 3300039438 Bacteria 1357
355 Ga0436363_0923830 3300039450 Bacteria 4649
356 Ga0436363_1496608 3300039450 Bacteria 2134
357 Ga0451847_0777966 3300041503 Bacteria 1300
358 Ga0451853_2446561 3300041512 Bacteria 817
359 Ga0466963_0113153 3300044694 Bacteria 1864
360 Ga0466967_0046134 3300045976 Bacteria 3792
361 Ga0466967_0556264 3300045976 Bacteria 1129
362 Ga0495592_0136373 3300046454 Bacteria 1711
363 Ga0495603_0003213 3300046455 Bacteria 9727
364 Ga0495603_0805827 3300046455 Bacteria 535
365 Ga0495590_0376425 3300046457 Bacteria 542
366 Ga0495629_0560374 3300046459 Bacteria 766
367 Ga0495638_0062940 3300046460 Bacteria 2288
368 Ga0495641_0222896 3300046461 Bacteria 846
369 Ga0495580_0026362 3300046472 Bacteria 4238
370 Ga0495580_0034224 3300046472 Bacteria 3658
371 Ga0495582_0036609 3300046473 Bacteria 2699
372 Ga0495605_0075166 3300046474 Bacteria 1589
373 Ga0495639_0066929 3300046475 Bacteria 1654
374 Ga0495662_0056597 3300046476 Bacteria 1894
375 Ga0495662_0288997 3300046476 Bacteria 807
376 Ga0495664_0029722 3300046477 Bacteria 3197
377 Ga0495664_0132249 3300046477 Bacteria 1511
378 Ga0495584_0119964 3300046491 Bacteria 1332
379 Ga0495594_0077975 3300046499 Bacteria 1849
380 Ga0495607_0054602 3300046501 Bacteria 2301
381 Ga0495583_0029797 3300046506 Bacteria 2666
382 Ga0495606_0035317 3300046507 Bacteria 3418
383 Ga0495608_0467821 3300046511 Bacteria 766
384 Ga0495610_0202277 3300046512 Bacteria 812
385 Ga0495618_0020926 3300046514 Bacteria 4028
386 Ga0495620_0018688 3300046515 Bacteria 3428
387 Ga0495628_0886223 3300046516 Bacteria 620
388 Ga0495630_0039230 3300046517 Bacteria 3542
389 Ga0495643_0056808 3300046522 Bacteria 2087
390 Ga0495644_0166884 3300046523 Bacteria 845
391 Ga0495648_0187908 3300046524 Bacteria 1044
392 Ga0495666_0106963 3300046526 Bacteria 1315
393 Ga0495654_0023580 3300046530 Bacteria 3186
394 Ga0495665_0026730 3300046531 Bacteria 3099
395 Ga0495609_0026919 3300046538 Bacteria 2630
396 Ga0495609_0152324 3300046538 Bacteria 983
397 Ga0495597_0031306 3300046542 Bacteria 2422
398 Ga0495645_0046942 3300046543 Bacteria 3148
399 Ga0495645_0109425 3300046543 Bacteria 1956
400 Ga0495622_0128150 3300046557 Bacteria 1156
401 Ga0495622_0242485 3300046557 Bacteria 794
402 Ga0495667_0038450 3300046559 Bacteria 3186
403 Ga0495656_0099871 3300046615 Bacteria 1341
404 Ga0495656_0259273 3300046615 Bacteria 880
405 Ga0495668_0295274 3300046616 Bacteria 888
406 Ga0495634_0036766 3300046642 Bacteria 3347
407 Ga0495611_0211119 3300046648 Bacteria 904
408 Ga0495625_0111295 3300046660 Bacteria 1871
409 Ga0495588_0034937 3300046674 Bacteria 2545
410 Ga0495588_0145361 3300046674 Bacteria 1253
411 Ga0495599_0180496 3300046678 Bacteria 1301
412 Ga0495658_0021799 3300046683 Bacteria 3381
413 Ga0495658_0199371 3300046683 Bacteria 1247
414 Ga0495669_0005476 3300046684 Bacteria 5299
415 Ga0495669_0454636 3300046684 Bacteria 622
416 Ga0495613_0396526 3300046689 Bacteria 942
417 Ga0495613_0697923 3300046689 Bacteria 668
418 Ga0495624_0079643 3300046690 Bacteria 2031
419 Ga0495670_0031823 3300046691 Bacteria 2622
420 Ga0495670_0330455 3300046691 Bacteria 819
421 Ga0495671_0030072 3300046692 Bacteria 2784
422 Ga0495581_0047059 3300047315 Bacteria 2493
423 Ga0495604_0106527 3300047317 Bacteria 2050
424 Ga0495674_0014414 3300047319 Bacteria 7399
425 Ga0495677_0234835 3300047445 Bacteria 716
426 Ga0495684_0002699 3300047471 Bacteria 14047
427 Ga0495593_0011625 3300047673 Bacteria 5051
428 Ga0496100_0174641 3300048903 Bacteria 1550
429 Ga0496100_0844703 3300048903 Bacteria 718
430 Ga0496101_0090423 3300048904 Bacteria 2277
431 Ga0496101_0692758 3300048904 Bacteria 805
432 Ga0496102_0067840 3300048905 Bacteria 3272
433 Ga0496102_0183360 3300048905 Bacteria 1972
434 Ga0496102_1053369 3300048905 Bacteria 733
435 Ga0496103_0064217 3300048906 Bacteria 2288
436 Ga0496103_0748045 3300048906 Bacteria 618
437 Ga0496104_0020638 3300048907 Bacteria 6041
438 Ga0496104_0258816 3300048907 Bacteria 1653
439 Ga0496104_0650923 3300048907 Bacteria 963
440 Ga0496105_0027529 3300048908 Bacteria 4645
441 Ga0496106_0000274 3300048909 Bacteria 36362
442 Ga0496106_0046679 3300048909 Bacteria 3257
443 Ga0496106_0639790 3300048909 Bacteria 850
444 Ga0496106_1189453 3300048909 Bacteria 595
445 Ga0496107_0022390 3300048910 Bacteria 4465
446 Ga0496107_0029095 3300048910 Bacteria 3928
447 Ga0496107_0195274 3300048910 Bacteria 1504
448 Ga0496108_0082670 3300048911 Bacteria 2723
449 Ga0496108_0117890 3300048911 Bacteria 2275
450 Ga0496108_0136620 3300048911 Bacteria 2110
451 Ga0496109_0001723 3300048912 Bacteria 18237
452 Ga0496109_0275164 3300048912 Bacteria 1586
453 Ga0496109_0534623 3300048912 Bacteria 1106
454 Ga0496110_0432748 3300048913 Bacteria 1199
455 Ga0496110_0574511 3300048913 Bacteria 1024
456 Ga0496111_0078867 3300048914 Bacteria 2402
457 Ga0496111_0092497 3300048914 Bacteria 2217
458 Ga0496111_0799896 3300048914 Bacteria 682
459 Ga0496112_0001789 3300048915 Bacteria 16907
460 Ga0496112_0024667 3300048915 Bacteria 5764
461 Ga0496112_0028860 3300048915 Bacteria 5360
462 Ga0496112_0127489 3300048915 Bacteria 2515
463 Ga0496112_0353181 3300048915 Bacteria 1412
464 Ga0496113_0005868 3300048916 Bacteria 7708
465 Ga0496113_0251620 3300048916 Bacteria 1411
466 Ga0496113_0671692 3300048916 Bacteria 828
467 Ga0496113_0722137 3300048916 Bacteria 794
468 Ga0496114_0091581 3300048917 Bacteria 2582
469 Ga0496115_0123983 3300048918 Bacteria 2127
470 Ga0496115_0396721 3300048918 Bacteria 1120
471 Ga0496115_0428720 3300048918 Bacteria 1071
472 Ga0496115_0629897 3300048918 Bacteria 850
473 Ga0496116_0001009 3300048919 Bacteria 34303
474 Ga0496116_0127293 3300048919 Bacteria 1460
475 Ga0496117_0091841 3300048920 Bacteria 1951
476 Ga0496117_0110318 3300048920 Bacteria 1715
477 Ga0496117_0387053 3300048920 Bacteria 710
478 Ga0496118_0069653 3300048921 Bacteria 2546
479 Ga0496118_0090141 3300048921 Bacteria 2114
480 Ga0496119_0099687 3300048922 Bacteria 1633
481 Ga0496120_0046524 3300048923 Bacteria 2507
482 Ga0496121_0102338 3300048924 Bacteria 2207
483 Ga0496121_0194387 3300048924 Bacteria 1452
484 Ga0496121_0292661 3300048924 Bacteria 1108
485 Ga0496121_0539509 3300048924 Bacteria 732
486 Ga0496122_0048488 3300048925 Bacteria 3264
487 Ga0496122_0077299 3300048925 Bacteria 2338
488 Ga0496122_0098738 3300048925 Bacteria 1960
489 Ga0496122_0103679 3300048925 Bacteria 1892
490 Ga0496123_0141060 3300048926 Bacteria 1317
491 Ga0496124_0198097 3300048927 Bacteria 1530
492 Ga0496125_0000158 3300048928 Bacteria 151273
493 Ga0496125_0001221 3300048928 Bacteria 38541
494 Ga0496125_0010378 3300048928 Bacteria 9421
495 Ga0496125_0018363 3300048928 Bacteria 6645
496 Ga0496125_0175415 3300048928 Bacteria 1435
497 Ga0496126_0007041 3300048929 Bacteria 12402
498 Ga0496126_0008848 3300048929 Bacteria 10790
499 Ga0496126_0040463 3300048929 Bacteria 4320
500 Ga0496126_0233609 3300048929 Bacteria 1539
501 Ga0496126_0377784 3300048929 Bacteria 1154
502 Ga0496126_0473306 3300048929 Bacteria 1005
503 Ga0496126_0565909 3300048929 Bacteria 900
504 Ga0496126_0631730 3300048929 Bacteria 840
505 Ga0496126_0870643 3300048929 Bacteria 685
506 Ga0496126_1174004 3300048929 Bacteria 566
507 Ga0501042_0850839 3300049578 Bacteria 664
508 Ga0501076_0422936 3300049592 Bacteria 1096
509 Ga0501080_0483392 3300049742 Bacteria 1108
510 Ga0501045_0231447 3300049824 Bacteria 1376
511 nmdc:mga03n38_424572_c1 3300050490 Bacteria 736
512 nmdc:mga03n38_844047_c1 3300050490 Bacteria 535
513 nmdc:mga00v17_128642_c1 3300050491 Bacteria 1617
514 nmdc:mga00v17_164221_c1 3300050491 Bacteria 1431
515 nmdc:mga0yw44_235804_c1 3300050492 Bacteria 1215
516 nmdc:mga0yw44_654961_c1 3300050492 Bacteria 714
517 nmdc:mga0k408_160835_c1 3300050493 Bacteria 1338
518 nmdc:mga06z11_323140_c1 3300050494 Bacteria 921
519 nmdc:mga06z11_601556_c1 3300050494 Bacteria 669
520 nmdc:mga06z11_622363_c1 3300050494 Bacteria 657
521 nmdc:mga04h51_140893_c1 3300050495 Bacteria 914
522 nmdc:mga07m45_210725_c1 3300050496 Bacteria 1130
523 nmdc:mga07m45_319398_c1 3300050496 Bacteria 903
524 nmdc:mga0n895_837372_c1 3300050512 Bacteria 908
525 nmdc:mga0sz30_189158_c1 3300050516 Bacteria 914
526 nmdc:mga0sz30_3737_c1 3300050516 Bacteria 5486
527 Ga0495601_0047533 3300053077 Bacteria 2702
528 Ga0495601_0427557 3300053077 Bacteria 857
529 Ga0495612_0043952 3300053078 Bacteria 1827
530 Ga0495612_0167296 3300053078 Bacteria 962
531 Ga0495655_0247704 3300053083 Bacteria 598
532 Ga0495595_0077423 3300053084 Bacteria 1580
533 Ga0500578_0047504 3300053086 Bacteria 2754
534 Ga0500644_0106713 3300053088 Bacteria 1072
535 Ga0500581_019636 3300053089 Bacteria 3411
536 Ga0500646_0092618 3300053090 Bacteria 938
537 Ga0500651_0037934 3300053093 Bacteria 3036
538 Ga0500566_0002015 3300053094 Bacteria 11989
539 Ga0500566_0023225 3300053094 Bacteria 3640
540 Ga0500566_0184062 3300053094 Bacteria 1069
541 Ga0500641_0023710 3300053096 Bacteria 2362
542 Ga0500650_0059980 3300053098 Bacteria 1775
543 Ga0500554_078792 3300053102 Bacteria 1082
544 Ga0500555_025706 3300053103 Bacteria 1685
545 Ga0500556_0000029 3300053104 Bacteria 165326
546 Ga0500592_001711 3300053116 Bacteria 3556
547 Ga0500594_0004224 3300053118 Bacteria 3168
548 Ga0500595_000842 3300053119 Bacteria 17493
549 Ga0500608_017399 3300053122 Bacteria 3264
550 Ga0500614_125702 3300053123 Bacteria 758
551 Ga0500618_004224 3300053125 Bacteria 4663
552 Ga0500618_007533 3300053125 Bacteria 3098
553 Ga0500642_0000020 3300053130 Bacteria 159498
554 Ga0500652_003899 3300053131 Bacteria 4559
555 Ga0500559_0000288 3300053136 Bacteria 38883
556 Ga0500577_0029354 3300053142 Bacteria 1903
557 Ga0500577_0107404 3300053142 Bacteria 1148
558 Ga0500586_013405 3300053145 Bacteria 2412
559 Ga0500588_0055539 3300053146 Bacteria 1251
560 Ga0500590_021761 3300053148 Bacteria 3327
561 Ga0500616_0000112 3300053153 Bacteria 151210
562 Ga0500627_0055489 3300053158 Bacteria 1734
563 Ga0500633_0014300 3300053160 Bacteria 2249
564 Ga0500638_010417 3300053162 Bacteria 4071
565 Ga0500636_0010810 3300053177 Bacteria 5334
566 Ga0500636_0113825 3300053177 Bacteria 1525
567 Ga0500637_0000251 3300053178 Bacteria 19903
568 Ga0500637_0174779 3300053178 Bacteria 1233
569 Ga0500567_076978 3300053723 Bacteria 1450
570 Ga0500645_069909 3300053730 Bacteria 1008
571 Ga0500661_004969 3300055283 Bacteria 2492
572 Ga0501082_0353746 3300060353 Bacteria 1281
573 2509146620 2508501128 Bacteria 8613869
574 2513697947 2513237101 Bacteria 7952346
575 2513887734 2513237141 Bacteria 8496279
576 2524467522 2524023210 Bacteria 9029266
577 2603857304 2602042107 Bacteria 6226103
578 2723842806 2721755755 Bacteria 8322773
579 2728752430 2728368998 Bacteria 8720350
580 2857526680 2857524615 Bacteria 6615449
581 2874606524 2874604998 Bacteria 7834745
582 2889033868 2889033259 Bacteria 9099371
583 2893069845 2893066018 Bacteria 6158120
584 2919077812 2919073203 Bacteria 6531949
585 2922367291 2922361189 Bacteria 7436256
586 8006998101 8006994254 Bacteria 8309700
587 8056675124 8056673599 Bacteria 7871253
588 Ga0070671_100116477
589 LJQas_1008496
590 JGI25404J52841_10018792
591 Ga0065165_1023758
592 Ga0065715_10833558
593 Ga0070683_101029509
594 Ga0070690_100362053
595 Ga0070666_10113509
596 Ga0070680_100013024
597 Ga0070680_100101388
598 Ga0070680_100151637
599 Ga0070680_100253650
600 Ga0070680_100610041
601 Ga0070680_101429010
602 Ga0070680_101699734
603 Ga0070682_100031969
604 Ga0070682_100577607
605 Ga0068868_100101930
606 Ga0070660_100006991
607 Ga0070689_100825001
608 Ga0070691_10049020
609 Ga0070691_10560839
610 Ga0070661_100039476
611 Ga0070661_100107153
612 Ga0070692_10829176
613 Ga0070668_100093836
614 Ga0070668_100765446
615 Ga0070669_100077905
616 Ga0070671_100281825
617 Ga0070674_100297958
618 Ga0070674_101133613
619 Ga0070673_100195432
620 Ga0070673_101220536
621 Ga0070688_100379400
622 Ga0070659_100129339
623 Ga0070659_100216618
624 Ga0070667_100083186
625 Ga0070667_100237719
626 Ga0070709_10002338
627 Ga0070709_10629021
628 Ga0070709_11163347
629 Ga0070714_100066550
630 Ga0070713_100397034
631 Ga0070710_10005939
632 Ga0070710_10109550
633 Ga0070711_100002208
634 Ga0070711_100051142
635 Ga0070705_100525593
636 Ga0070694_100867171
637 Ga0070708_100514024
638 Ga0070663_100251085
639 Ga0070663_100303529
640 Ga0070663_100779159
641 Ga0070678_100238015
642 Ga0070678_100334684
643 Ga0070678_100573215
644 Ga0070681_10057197
645 Ga0070685_10278521
646 Ga0070698_100492898
647 Ga0070699_101135331
648 Ga0070679_100083419
649 Ga0070679_100099081
650 Ga0070679_100148109
651 Ga0070679_100184985
652 Ga0070679_100210094
653 Ga0068853_100002207
654 Ga0068853_100006767
655 Ga0068853_100091422
656 Ga0068853_100272578
657 Ga0068853_100978694
658 Ga0070686_100147014
659 Ga0070695_100487240
660 Ga0070695_101488598
661 Ga0070696_101245527
662 Ga0070696_101319510
663 Ga0070696_101408141
664 Ga0070693_100068028
665 Ga0070665_100151870
666 Ga0070665_100255745
667 Ga0070665_100356008
668 Ga0068855_100110807
669 Ga0068855_100112947
670 Ga0068855_100187469
671 Ga0068855_100386088
672 Ga0068855_101139469
673 Ga0070664_100098130
674 Ga0068857_100044284
675 Ga0068854_100008629
676 Ga0068854_100451514
677 Ga0068856_100054109
678 Ga0068856_100116648
679 Ga0068856_100182397
680 Ga0070702_100060854
681 Ga0070702_100983130
682 Ga0068852_100011735
683 Ga0068852_100152915
684 Ga0068852_100212069
685 Ga0068852_100225372
686 Ga0068852_100655435
687 Ga0068859_100057352
688 Ga0068866_10503710
689 Ga0068861_100020959
690 Ga0068861_100051542
691 Ga0068861_101110147
692 Ga0068851_10017739
693 Ga0068863_100042307
694 Ga0068858_100072672
695 Ga0068860_100333005
696 Ga0068860_100821145
697 Ga0081540_1053672
698 Ga0070717_10022827
699 Ga0070717_10223200
700 Ga0075365_10020835
701 Ga0075365_10327183
702 Ga0075365_10795019
703 Ga0075368_10325398
704 Ga0075363_100162596
705 Ga0075364_10069634
706 Ga0075364_10075732
707 Ga0075364_10860063
708 Ga0070715_10000762
709 Ga0070716_100038130
710 Ga0070716_100169405
711 Ga0070716_100190831
712 Ga0070716_100595356
713 Ga0070712_100033040
714 Ga0070712_100306226
715 Ga0070712_100681618
716 Ga0075367_10081962
717 Ga0075367_10847157
718 Ga0075369_10006028
719 Ga0075369_10097985
720 Ga0075366_10038074
721 Ga0097621_100130302
722 Ga0075370_10196716
723 Ga0075370_10264025
724 Ga0068871_100261466
725 Ga0075434_100845158
726 Ga0068865_101184368
727 Ga0097620_100057352
728 Ga0099794_10039886
729 Ga0105240_10012128
730 Ga0105240_10044810
731 Ga0105245_10058082
732 Ga0105247_10006919
733 Ga0105243_10074303
734 Ga0105243_11067632
735 Ga0105241_10054562
736 Ga0105241_10242460
737 Ga0105242_10252974
738 Ga0105237_10078243
739 Ga0105237_10179551
740 Ga0105237_10577958
741 Ga0105238_10040525
742 Ga0105238_11233256
743 Ga0105238_11659595
744 Ga0105249_10022931
745 Ga0105249_10595320
746 Ga0105239_10056734
747 Ga0105239_10064895
748 Ga0105246_10030323
749 Ga0105246_11185711
750 Ga0157370_10109082
751 Ga0157369_10006388
752 Ga0157369_10044612
753 Ga0157369_10158875
754 Ga0157369_10802110
755 Ga0157378_10328789
756 Ga0157372_10149159
757 Ga0157375_10045330
758 Ga0157380_10101682
759 Ga0157380_11474009
760 Ga0157376_10858234
761 Ga0163161_10200638
762 Ga0163161_10316643
763 Ga0206354_11284064
764 Ga0224712_10087246
765 Ga0209233_1036920
766 Ga0209564_1000397
767 Ga0209564_1008259
768 Ga0207656_10004387
769 Ga0207692_10019957
770 Ga0207692_10083953
771 Ga0207642_10146538
772 Ga0207642_10260852
773 Ga0207710_10070725
774 Ga0207688_10560341
775 Ga0207680_10081903
776 Ga0207647_10055549
777 Ga0207699_10003036
778 Ga0207699_10046371
779 Ga0207699_10153939
780 Ga0207699_10678623
781 Ga0207699_10800436
782 Ga0207645_10122652
783 Ga0207654_10001136
784 Ga0207654_10075482
785 Ga0207654_10164125
786 Ga0207707_10002224
787 Ga0207707_10084314
788 Ga0207695_10004577
789 Ga0207695_10137453
790 Ga0207695_10879181
791 Ga0207671_10250349
792 Ga0207671_10586616
793 Ga0207693_10060842
794 Ga0207693_10110049
795 Ga0207693_10114738
796 Ga0207693_10132194
797 Ga0207663_10000239
798 Ga0207663_10193366
799 Ga0207660_10022785
800 Ga0207660_10179444
801 Ga0207660_10211996
802 Ga0207660_10676250
803 Ga0207657_10005246
804 Ga0207649_10196687
805 Ga0207652_10004348
806 Ga0207652_10052869
807 Ga0207652_10120190
808 Ga0207652_10129972
809 Ga0207652_10758183
810 Ga0207681_10195828
811 Ga0207694_10000263
812 Ga0207694_11232027
813 Ga0207687_10042859
814 Ga0207700_10005825
815 Ga0207700_10231565
816 Ga0207664_10010462
817 Ga0207664_10560936
818 Ga0207644_10073099
819 Ga0207644_10532583
820 Ga0207644_10642325
821 Ga0207690_10076892
822 Ga0207706_10154767
823 Ga0207706_10581869
824 Ga0207709_10537243
825 Ga0207709_10710385
826 Ga0207669_10221830
827 Ga0207704_10605344
828 Ga0207665_10016227
829 Ga0207665_10191928
830 Ga0207665_10648429
831 Ga0207665_10808577
832 Ga0207691_10041060
833 Ga0207689_10046118
834 Ga0207661_10054826
835 Ga0207679_10168553
836 Ga0207667_10042856
837 Ga0207667_10173858
838 Ga0207667_10203698
839 Ga0207712_10210246
840 Ga0207668_10241608
841 Ga0207668_10245353
842 Ga0207668_10632743
843 Ga0207668_11194760
844 Ga0207668_11687935
845 Ga0207640_10175528
846 Ga0207640_10420267
847 Ga0207658_10084693
848 Ga0207658_10345018
849 Ga0207677_10102129
850 Ga0207677_11171544
851 Ga0207703_10035937
852 Ga0207703_10256676
853 Ga0207703_10413620
854 Ga0207639_10033069
855 Ga0207639_10080572
856 Ga0207639_10091060
857 Ga0207639_10173933
858 Ga0207678_10028150
859 Ga0207678_10040957
860 Ga0207678_10054613
861 Ga0207678_10091992
862 Ga0207702_10000003
863 Ga0207702_10051208
864 Ga0207641_10082654
865 Ga0207641_11511426
866 Ga0207648_10064662
867 Ga0207676_10143282
868 Ga0207674_10042085
869 Ga0207674_10207845
870 Ga0207675_100099894
871 Ga0207675_100123214
872 Ga0207683_10021485
873 Ga0207683_10338347
874 Ga0207683_10449844
875 Ga0207698_10003760
876 Ga0207698_10020150
877 Ga0207698_10235550
878 Ga0207698_10429937
879 Ga0207698_10519180
880 Ga0209588_1005209
881 Ga0268266_10059443
882 Ga0268266_10194248
883 Ga0268265_10050565
884 Ga0268265_10219823
885 Ga0268264_10910392
886 Ga0265334_10054880
887 Ga0265323_10000847
888 Ga0265336_10000460
889 Ga0307515_10076032
890 Ga0265338_10007843
891 Ga0307512_10395848
892 Ga0265332_10059337
893 Ga0265340_10072641
894 Ga0265339_10005327
895 Ga0265339_10128751
896 Ga0265331_10244465
897 Ga0265331_10246596
898 Ga0265316_10318944
899 Ga0307513_10219859
900 Ga0307408_100581111
901 Ga0307516_10014441
902 Ga0307516_10574527
903 Ga0307405_10055884
904 Ga0307412_10119924
905 Ga0307412_10404727
906 Ga0373938_0006155
907 Ga0373940_0121661
908 Ga0373940_0256389
909 Ga0373923_0014550
910 Ga0373932_0210730
911 Ga0373936_0013008
912 Ga0373945_0014721
913 Ga0373954_0055775
914 Ga0373957_0007752
915 Ga0373960_0124614
916 Ga0373943_0040038
917 Ga0373943_0046688
918 Ga0373946_0042460
919 Ga0373955_0078419
920 Ga0373955_0309490
921 Ga0373962_0194317
922 Ga0373931_0002919
923 Ga0373935_0051350
924 Ga0373935_0278633
925 Ga0373927_0002293
926 Ga0373927_0046721
927 Ga0373927_0271406
928 Ga0373927_0679097
929 Ga0373947_0006111
930 Ga0373947_0106522
931 Ga0373937_0105606
932 Ga0372808_001604
933 Ga0310109_027382
934 Ga0373925_0020497
935 Ga0373925_0048125
936 Ga0373925_0272686
937 Ga0373925_0646131
938 Ga0373925_1139995
939 Ga0395905_0127901
940 Ga0436365_1452029
941 Ga0436360_0554802
942 Ga0436363_0923830
943 Ga0436363_1496608
944 Ga0451847_0777966
945 Ga0451853_2446561
946 Ga0466963_0113153
947 Ga0466967_0046134
948 Ga0466967_0556264
949 Ga0495592_0136373
950 Ga0495603_0003213
951 Ga0495603_0805827
952 Ga0495590_0376425
953 Ga0495629_0560374
954 Ga0495638_0062940
955 Ga0495641_0222896
956 Ga0495580_0026362
957 Ga0495580_0034224
958 Ga0495582_0036609
959 Ga0495605_0075166
960 Ga0495639_0066929
961 Ga0495662_0056597
962 Ga0495662_0288997
963 Ga0495664_0029722
964 Ga0495664_0132249
965 Ga0495584_0119964
966 Ga0495594_0077975
967 Ga0495607_0054602
968 Ga0495583_0029797
969 Ga0495606_0035317
970 Ga0495608_0467821
971 Ga0495610_0202277
972 Ga0495618_0020926
973 Ga0495620_0018688
974 Ga0495628_0886223
975 Ga0495630_0039230
976 Ga0495643_0056808
977 Ga0495644_0166884
978 Ga0495648_0187908
979 Ga0495666_0106963
980 Ga0495654_0023580
981 Ga0495665_0026730
982 Ga0495609_0026919
983 Ga0495609_0152324
984 Ga0495597_0031306
985 Ga0495645_0046942
986 Ga0495645_0109425
987 Ga0495622_0128150
988 Ga0495622_0242485
989 Ga0495667_0038450
990 Ga0495656_0099871
991 Ga0495656_0259273
992 Ga0495668_0295274
993 Ga0495634_0036766
994 Ga0495611_0211119
995 Ga0495625_0111295
996 Ga0495588_0034937
997 Ga0495588_0145361
998 Ga0495599_0180496
999 Ga0495658_0021799
1000 Ga0495658_0199371
1001 Ga0495669_0005476
1002 Ga0495669_0454636
1003 Ga0495613_0396526
1004 Ga0495613_0697923
1005 Ga0495624_0079643
1006 Ga0495670_0031823
1007 Ga0495670_0330455
1008 Ga0495671_0030072
1009 Ga0495581_0047059
1010 Ga0495604_0106527
1011 Ga0495674_0014414
1012 Ga0495677_0234835
1013 Ga0495684_0002699
1014 Ga0495593_0011625
1015 Ga0496100_0174641
1016 Ga0496100_0844703
1017 Ga0496101_0090423
1018 Ga0496101_0692758
1019 Ga0496102_0067840
1020 Ga0496102_0183360
1021 Ga0496102_1053369
1022 Ga0496103_0064217
1023 Ga0496103_0748045
1024 Ga0496104_0020638
1025 Ga0496104_0258816
1026 Ga0496104_0650923
1027 Ga0496105_0027529
1028 Ga0496106_0000274
1029 Ga0496106_0046679
1030 Ga0496106_0639790
1031 Ga0496106_1189453
1032 Ga0496107_0022390
1033 Ga0496107_0029095
1034 Ga0496107_0195274
1035 Ga0496108_0082670
1036 Ga0496108_0117890
1037 Ga0496108_0136620
1038 Ga0496109_0001723
1039 Ga0496109_0275164
1040 Ga0496109_0534623
1041 Ga0496110_0432748
1042 Ga0496110_0574511
1043 Ga0496111_0078867
1044 Ga0496111_0092497
1045 Ga0496111_0799896
1046 Ga0496112_0001789
1047 Ga0496112_0024667
1048 Ga0496112_0028860
1049 Ga0496112_0127489
1050 Ga0496112_0353181
1051 Ga0496113_0005868
1052 Ga0496113_0251620
1053 Ga0496113_0671692
1054 Ga0496113_0722137
1055 Ga0496114_0091581
1056 Ga0496115_0123983
1057 Ga0496115_0396721
1058 Ga0496115_0428720
1059 Ga0496115_0629897
1060 Ga0496116_0001009
1061 Ga0496116_0127293
1062 Ga0496117_0091841
1063 Ga0496117_0110318
1064 Ga0496117_0387053
1065 Ga0496118_0069653
1066 Ga0496118_0090141
1067 Ga0496119_0099687
1068 Ga0496120_0046524
1069 Ga0496121_0102338
1070 Ga0496121_0194387
1071 Ga0496121_0292661
1072 Ga0496121_0539509
1073 Ga0496122_0048488
1074 Ga0496122_0077299
1075 Ga0496122_0098738
1076 Ga0496122_0103679
1077 Ga0496123_0141060
1078 Ga0496124_0198097
1079 Ga0496125_0000158
1080 Ga0496125_0001221
1081 Ga0496125_0010378
1082 Ga0496125_0018363
1083 Ga0496125_0175415
1084 Ga0496126_0007041
1085 Ga0496126_0008848
1086 Ga0496126_0040463
1087 Ga0496126_0233609
1088 Ga0496126_0377784
1089 Ga0496126_0473306
1090 Ga0496126_0565909
1091 Ga0496126_0631730
1092 Ga0496126_0870643
1093 Ga0496126_1174004
1094 Ga0501042_0850839
1095 Ga0501076_0422936
1096 Ga0501080_0483392
1097 Ga0501045_0231447
1098 nmdc:mga03n38_424572_c1
1099 nmdc:mga03n38_844047_c1
1100 nmdc:mga00v17_128642_c1
1101 nmdc:mga00v17_164221_c1
1102 nmdc:mga0yw44_235804_c1
1103 nmdc:mga0yw44_654961_c1
1104 nmdc:mga0k408_160835_c1
1105 nmdc:mga06z11_323140_c1
1106 nmdc:mga06z11_601556_c1
1107 nmdc:mga06z11_622363_c1
1108 nmdc:mga04h51_140893_c1
1109 nmdc:mga07m45_210725_c1
1110 nmdc:mga07m45_319398_c1
1111 nmdc:mga0n895_837372_c1
1112 nmdc:mga0sz30_189158_c1
1113 nmdc:mga0sz30_3737_c1
1114 Ga0495601_0047533
1115 Ga0495601_0427557
1116 Ga0495612_0043952
1117 Ga0495612_0167296
1118 Ga0495655_0247704
1119 Ga0495595_0077423
1120 Ga0500578_0047504
1121 Ga0500644_0106713
1122 Ga0500581_019636
1123 Ga0500646_0092618
1124 Ga0500651_0037934
1125 Ga0500566_0002015
1126 Ga0500566_0023225
1127 Ga0500566_0184062
1128 Ga0500641_0023710
1129 Ga0500650_0059980
1130 Ga0500554_078792
1131 Ga0500555_025706
1132 Ga0500556_0000029
1133 Ga0500592_001711
1134 Ga0500594_0004224
1135 Ga0500595_000842
1136 Ga0500608_017399
1137 Ga0500614_125702
1138 Ga0500618_004224
1139 Ga0500618_007533
1140 Ga0500642_0000020
1141 Ga0500652_003899
1142 Ga0500559_0000288
1143 Ga0500577_0029354
1144 Ga0500577_0107404
1145 Ga0500586_013405
1146 Ga0500588_0055539
1147 Ga0500590_021761
1148 Ga0500616_0000112
1149 Ga0500627_0055489
1150 Ga0500633_0014300
1151 Ga0500638_010417
1152 Ga0500636_0010810
1153 Ga0500636_0113825
1154 Ga0500637_0000251
1155 Ga0500637_0174779
1156 Ga0500567_076978
1157 Ga0500645_069909
1158 Ga0500661_004969
1159 Ga0501082_0353746
1160 2509146620
1161 2513697947
1162 2513887734
1163 2524467522
1164 2603857304
1165 2723842806
1166 2728752430
1167 2857526680
1168 2874606524
1169 2889033868
1170 2893069845
1171 2919077812
1172 2922367291
1173 8006998101
1174 8056675124

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06186

DUF992

Protein of unknown function (DUF992)

35

177

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ta7-assembly1.cif.gz_E-2 crystal structure of human g3bp1-ntf2 in complex with human caprin1-derived solomon motif 0.7414 36 77
4fcm-assembly1.cif.gz_B crystal structure of the ntf2-like domain of human g3bp1 in complex with a peptide 0.741 36 75
8th1-assembly1.cif.gz_A crystal structure of the g3bp1 ntf2-like domain bound to the idr1 of sars-cov-2 nucleocapsid protein d3l mutant 0.737 36 75
6ta7-assembly3.cif.gz_C crystal structure of human g3bp1-ntf2 in complex with human caprin1-derived solomon motif 0.7368 36 75
6ta7-assembly3.cif.gz_D crystal structure of human g3bp1-ntf2 in complex with human caprin1-derived solomon motif 0.7355 36 77
ID Description Score Start End Superfamily
5ig0A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8074 35 75 3.10.450.50
af_Q9VRD6_2_130_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.754 35 77 3.10.450.50
5fw5A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7497 38 75 3.10.450.50
1of5B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7349 35 75 3.10.450.50
af_A0A5S9MQL1_1_179_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7271 36 78 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A6F8ND94-F1-model_v4 deleted 0.9056 31 161
AF-A0A6F8ND94-F1-model_v4 deleted 0.8991 31 161
AF-A0A0S6UFL0-F1-model_v4 DUF992 domain-containing protein 0.8647 22 161
AF-A0A0D7F5S6-F1-model_v4 DUF992 domain-containing protein 0.8644 22 161
AF-A0A1V4I1A6-F1-model_v4 DUF992 domain-containing protein 0.8481 20 161

Map