F466646
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 587 | 228 | 1174 | 98 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_101549502|Ga0070706_1015495022 |
| Length | 116 |
| Sequence | MAIETKSNVPAAAKSEDTRHQHQILTGRVTSAKMEKTIVVEVLRLVQHPKYRRVVRISKKFYAHDEKRQAKPGDTVRIVASRPISKLKRWRLKEVLARNASVDIKAEIKRDRGAEQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 47 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 48 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 51 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 52 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 72 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 73 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 107 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 109 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 116 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 117 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 118 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 121 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 122 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 124 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 125 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 126 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 127 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 128 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 129 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 130 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 131 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 132 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 133 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 134 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 136 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 137 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 138 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 139 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 140 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 141 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 142 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 146 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 147 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 148 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 149 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 150 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 151 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 152 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 153 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 154 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 202 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 203 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 204 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 205 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 206 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 207 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 208 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 209 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 210 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 218 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.47 |
| Metatranscriptomes | 1.53 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.07 |
| Rhizosphere | 95.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070706_101549502 | 3300005467 | Unclassified | 605 |
| 2 | rootH1_10356686 | 3300003323 | Bacteria | 1516 |
| 3 | Ga0058859_11545456 | 3300004798 | Bacteria | 551 |
| 4 | Ga0065715_10853452 | 3300005293 | Unclassified | 590 |
| 5 | Ga0065707_10265685 | 3300005295 | Bacteria | 1085 |
| 6 | Ga0070690_100185006 | 3300005330 | Bacteria | 1441 |
| 7 | Ga0070690_100460824 | 3300005330 | Bacteria | 944 |
| 8 | Ga0070682_101143006 | 3300005337 | Unclassified | 654 |
| 9 | Ga0068868_101278141 | 3300005338 | Bacteria | 681 |
| 10 | Ga0070673_101800873 | 3300005364 | Bacteria | 580 |
| 11 | Ga0070667_100352190 | 3300005367 | Bacteria | 1333 |
| 12 | Ga0070709_10019666 | 3300005434 | Bacteria | 3908 |
| 13 | Ga0070709_10075841 | 3300005434 | Bacteria | 2182 |
| 14 | Ga0070709_10136432 | 3300005434 | Bacteria | 1681 |
| 15 | Ga0070709_10444071 | 3300005434 | Bacteria | 976 |
| 16 | Ga0070709_10467283 | 3300005434 | Bacteria | 953 |
| 17 | Ga0070709_10521100 | 3300005434 | Bacteria | 906 |
| 18 | Ga0070709_10675473 | 3300005434 | Bacteria | 802 |
| 19 | Ga0070709_10970618 | 3300005434 | Unclassified | 675 |
| 20 | Ga0070714_100428065 | 3300005435 | Bacteria | 1254 |
| 21 | Ga0070713_100009214 | 3300005436 | Bacteria | 7047 |
| 22 | Ga0070713_100980687 | 3300005436 | Bacteria | 815 |
| 23 | Ga0070710_10052346 | 3300005437 | Bacteria | 2296 |
| 24 | Ga0070710_10482214 | 3300005437 | Bacteria | 846 |
| 25 | Ga0070710_10775714 | 3300005437 | Unclassified | 683 |
| 26 | Ga0070711_100011381 | 3300005439 | Bacteria | 5522 |
| 27 | Ga0070711_100019344 | 3300005439 | Unclassified | 4368 |
| 28 | Ga0070711_100039048 | 3300005439 | Bacteria | 3195 |
| 29 | Ga0070711_100364914 | 3300005439 | Bacteria | 1164 |
| 30 | Ga0070711_100495328 | 3300005439 | Bacteria | 1007 |
| 31 | Ga0070711_101751898 | 3300005439 | Unclassified | 545 |
| 32 | Ga0070711_101777710 | 3300005439 | Bacteria | 541 |
| 33 | Ga0070705_100011509 | 3300005440 | Bacteria | 4465 |
| 34 | Ga0070705_100435364 | 3300005440 | Unclassified | 980 |
| 35 | Ga0070694_100222590 | 3300005444 | Bacteria | 1416 |
| 36 | Ga0070694_100830495 | 3300005444 | Unclassified | 759 |
| 37 | Ga0070694_101912695 | 3300005444 | Unclassified | 506 |
| 38 | Ga0070708_100003600 | 3300005445 | Bacteria | 12154 |
| 39 | Ga0070708_100005636 | 3300005445 | Bacteria | 9922 |
| 40 | Ga0070708_100189820 | 3300005445 | Bacteria | 1922 |
| 41 | Ga0070708_100215135 | 3300005445 | Bacteria | 1801 |
| 42 | Ga0070708_100601546 | 3300005445 | Bacteria | 1037 |
| 43 | Ga0070708_100836426 | 3300005445 | Bacteria | 865 |
| 44 | Ga0070708_101172587 | 3300005445 | Bacteria | 719 |
| 45 | Ga0070708_101193440 | 3300005445 | Unclassified | 712 |
| 46 | Ga0070708_101594720 | 3300005445 | Bacteria | 607 |
| 47 | Ga0070708_101832887 | 3300005445 | Unclassified | 563 |
| 48 | Ga0070681_10002001 | 3300005458 | Bacteria | 18451 |
| 49 | Ga0070685_10179110 | 3300005466 | Bacteria | 1363 |
| 50 | Ga0070706_100361637 | 3300005467 | Bacteria | 1352 |
| 51 | Ga0070706_100805929 | 3300005467 | Unclassified | 869 |
| 52 | Ga0070706_100858836 | 3300005467 | Archaea | 839 |
| 53 | Ga0070706_101072450 | 3300005467 | Bacteria | 742 |
| 54 | Ga0070706_101494008 | 3300005467 | Bacteria | 617 |
| 55 | Ga0070706_101699312 | 3300005467 | Unclassified | 575 |
| 56 | Ga0070707_100024988 | 3300005468 | Bacteria | 5665 |
| 57 | Ga0070707_100028747 | 3300005468 | Bacteria | 5291 |
| 58 | Ga0070707_100271464 | 3300005468 | Bacteria | 1649 |
| 59 | Ga0070707_100541010 | 3300005468 | Bacteria | 1127 |
| 60 | Ga0070707_100803003 | 3300005468 | Bacteria | 905 |
| 61 | Ga0070707_101354262 | 3300005468 | Unclassified | 678 |
| 62 | Ga0070698_100016168 | 3300005471 | Bacteria | 7880 |
| 63 | Ga0070698_100023916 | 3300005471 | Bacteria | 6378 |
| 64 | Ga0070698_100031161 | 3300005471 | Bacteria | 5528 |
| 65 | Ga0070698_100031762 | 3300005471 | Bacteria | 5473 |
| 66 | Ga0070698_100199357 | 3300005471 | Bacteria | 1938 |
| 67 | Ga0070699_100004496 | 3300005518 | Bacteria | 12337 |
| 68 | Ga0070699_100012380 | 3300005518 | Bacteria | 7361 |
| 69 | Ga0070699_100025050 | 3300005518 | Bacteria | 5144 |
| 70 | Ga0070699_100154909 | 3300005518 | Bacteria | 2027 |
| 71 | Ga0070699_100324245 | 3300005518 | Bacteria | 1385 |
| 72 | Ga0070679_100019420 | 3300005530 | Bacteria | 6608 |
| 73 | Ga0070679_100019976 | 3300005530 | Bacteria | 6526 |
| 74 | Ga0070679_100280411 | 3300005530 | Bacteria | 1619 |
| 75 | Ga0070697_100006091 | 3300005536 | Bacteria | 9330 |
| 76 | Ga0070697_100160543 | 3300005536 | Bacteria | 1899 |
| 77 | Ga0070697_100558624 | 3300005536 | Bacteria | 1004 |
| 78 | Ga0070697_101040929 | 3300005536 | Unclassified | 728 |
| 79 | Ga0070697_101099295 | 3300005536 | Unclassified | 708 |
| 80 | Ga0070697_101178142 | 3300005536 | Unclassified | 683 |
| 81 | Ga0070697_101453230 | 3300005536 | Bacteria | 612 |
| 82 | Ga0070695_100005390 | 3300005545 | Bacteria | 7529 |
| 83 | Ga0070695_100123311 | 3300005545 | Bacteria | 1776 |
| 84 | Ga0070695_100924707 | 3300005545 | Bacteria | 705 |
| 85 | Ga0070695_101032628 | 3300005545 | Unclassified | 670 |
| 86 | Ga0070696_100004505 | 3300005546 | Bacteria | 9299 |
| 87 | Ga0070696_100082999 | 3300005546 | Bacteria | 2272 |
| 88 | Ga0070693_100000494 | 3300005547 | Bacteria | 17601 |
| 89 | Ga0070665_100000700 | 3300005548 | Bacteria | 44692 |
| 90 | Ga0070704_100007365 | 3300005549 | Bacteria | 6551 |
| 91 | Ga0070704_100089917 | 3300005549 | Bacteria | 2285 |
| 92 | Ga0070664_101107108 | 3300005564 | Bacteria | 746 |
| 93 | Ga0068859_100266489 | 3300005617 | Bacteria | 1805 |
| 94 | Ga0068864_100606435 | 3300005618 | Bacteria | 1063 |
| 95 | Ga0068866_10140691 | 3300005718 | Bacteria | 1385 |
| 96 | Ga0068863_100012596 | 3300005841 | Bacteria | 8156 |
| 97 | Ga0068858_100043469 | 3300005842 | Bacteria | 4165 |
| 98 | Ga0068860_100019907 | 3300005843 | Bacteria | 6508 |
| 99 | Ga0081455_10227434 | 3300005937 | Unclassified | 1379 |
| 100 | Ga0081540_1341198 | 3300005983 | Unclassified | 513 |
| 101 | Ga0070717_10253897 | 3300006028 | Bacteria | 1554 |
| 102 | Ga0070717_10257550 | 3300006028 | Bacteria | 1543 |
| 103 | Ga0070717_10353208 | 3300006028 | Bacteria | 1315 |
| 104 | Ga0070717_10566592 | 3300006028 | Bacteria | 1029 |
| 105 | Ga0070715_10102241 | 3300006163 | Bacteria | 1339 |
| 106 | Ga0070715_10770814 | 3300006163 | Unclassified | 581 |
| 107 | Ga0070716_100000120 | 3300006173 | Bacteria | 31101 |
| 108 | Ga0070716_100014973 | 3300006173 | Bacteria | 3978 |
| 109 | Ga0070716_100044889 | 3300006173 | Bacteria | 2478 |
| 110 | Ga0070716_100049537 | 3300006173 | Bacteria | 2380 |
| 111 | Ga0070716_100083773 | 3300006173 | Bacteria | 1910 |
| 112 | Ga0070716_100636716 | 3300006173 | Bacteria | 807 |
| 113 | Ga0070716_100906451 | 3300006173 | Bacteria | 691 |
| 114 | Ga0070712_100050740 | 3300006175 | Bacteria | 2888 |
| 115 | Ga0070712_100136660 | 3300006175 | Bacteria | 1865 |
| 116 | Ga0070712_100200024 | 3300006175 | Bacteria | 1569 |
| 117 | Ga0070712_100394027 | 3300006175 | Bacteria | 1142 |
| 118 | Ga0070712_100495087 | 3300006175 | Bacteria | 1024 |
| 119 | Ga0097621_100115276 | 3300006237 | Bacteria | 2274 |
| 120 | Ga0097621_100202921 | 3300006237 | Bacteria | 1722 |
| 121 | Ga0097621_101306716 | 3300006237 | Unclassified | 685 |
| 122 | Ga0068871_100067329 | 3300006358 | Bacteria | 2938 |
| 123 | Ga0068871_100515956 | 3300006358 | Bacteria | 1079 |
| 124 | Ga0068871_100765884 | 3300006358 | Bacteria | 888 |
| 125 | Ga0068871_101138618 | 3300006358 | Unclassified | 730 |
| 126 | Ga0075433_10625302 | 3300006852 | Unclassified | 944 |
| 127 | Ga0075434_100134498 | 3300006871 | Bacteria | 2492 |
| 128 | Ga0075434_100195863 | 3300006871 | Bacteria | 2040 |
| 129 | Ga0075434_100367924 | 3300006871 | Bacteria | 1459 |
| 130 | Ga0075434_100970191 | 3300006871 | Unclassified | 864 |
| 131 | Ga0075436_100002590 | 3300006914 | Bacteria | 12435 |
| 132 | Ga0075436_100011008 | 3300006914 | Bacteria | 6209 |
| 133 | Ga0075436_100303320 | 3300006914 | Bacteria | 1145 |
| 134 | Ga0075436_100728326 | 3300006914 | Bacteria | 736 |
| 135 | Ga0075436_100867410 | 3300006914 | Unclassified | 674 |
| 136 | Ga0075436_101567983 | 3300006914 | Unclassified | 501 |
| 137 | Ga0097620_100266507 | 3300006931 | Bacteria | 1805 |
| 138 | Ga0075435_100072164 | 3300007076 | Bacteria | 2820 |
| 139 | Ga0075435_100151764 | 3300007076 | Bacteria | 1948 |
| 140 | Ga0075435_100354095 | 3300007076 | Unclassified | 1258 |
| 141 | Ga0099794_10018883 | 3300007265 | Bacteria | 3098 |
| 142 | Ga0099794_10047797 | 3300007265 | Bacteria | 2052 |
| 143 | Ga0099794_10049726 | 3300007265 | Bacteria | 2016 |
| 144 | Ga0099794_10069502 | 3300007265 | Bacteria | 1723 |
| 145 | Ga0099794_10092648 | 3300007265 | Bacteria | 1501 |
| 146 | Ga0099794_10095259 | 3300007265 | Bacteria | 1481 |
| 147 | Ga0099794_10181487 | 3300007265 | Bacteria | 1074 |
| 148 | Ga0099794_10197181 | 3300007265 | Bacteria | 1031 |
| 149 | Ga0099794_10203512 | 3300007265 | Bacteria | 1014 |
| 150 | Ga0099794_10474534 | 3300007265 | Bacteria | 657 |
| 151 | Ga0099794_10485058 | 3300007265 | Unclassified | 650 |
| 152 | Ga0099794_10518611 | 3300007265 | Unclassified | 628 |
| 153 | Ga0099794_10521836 | 3300007265 | Bacteria | 626 |
| 154 | Ga0099794_10579802 | 3300007265 | Unclassified | 593 |
| 155 | Ga0099795_10080008 | 3300007788 | Bacteria | 1249 |
| 156 | Ga0099795_10119934 | 3300007788 | Bacteria | 1051 |
| 157 | Ga0105240_10217617 | 3300009093 | Bacteria | 2227 |
| 158 | Ga0105245_10529498 | 3300009098 | Bacteria | 1198 |
| 159 | Ga0105245_10932638 | 3300009098 | Unclassified | 911 |
| 160 | Ga0105245_11202680 | 3300009098 | Unclassified | 806 |
| 161 | Ga0105247_10730922 | 3300009101 | Unclassified | 748 |
| 162 | Ga0105247_10799521 | 3300009101 | Bacteria | 719 |
| 163 | Ga0105241_11443686 | 3300009174 | Bacteria | 660 |
| 164 | Ga0105242_10055149 | 3300009176 | Bacteria | 3252 |
| 165 | Ga0105242_10209586 | 3300009176 | Bacteria | 1736 |
| 166 | Ga0105248_10159229 | 3300009177 | Bacteria | 2547 |
| 167 | Ga0105248_11114788 | 3300009177 | Bacteria | 892 |
| 168 | Ga0105237_10367910 | 3300009545 | Bacteria | 1442 |
| 169 | Ga0105238_10000248 | 3300009551 | Bacteria | 60289 |
| 170 | Ga0105238_12206241 | 3300009551 | Unclassified | 585 |
| 171 | Ga0105249_10424016 | 3300009553 | Bacteria | 1365 |
| 172 | Ga0099796_10001546 | 3300010159 | Bacteria | 4692 |
| 173 | Ga0099796_10035759 | 3300010159 | Bacteria | 1650 |
| 174 | Ga0099796_10267636 | 3300010159 | Unclassified | 715 |
| 175 | Ga0105239_10196854 | 3300010375 | Bacteria | 2257 |
| 176 | Ga0105246_12265575 | 3300011119 | Unclassified | 530 |
| 177 | Ga0157374_10053425 | 3300013296 | Bacteria | 3767 |
| 178 | Ga0157378_10002909 | 3300013297 | Bacteria | 15237 |
| 179 | Ga0157378_10012390 | 3300013297 | Bacteria | 7466 |
| 180 | Ga0157378_10038768 | 3300013297 | Bacteria | 4224 |
| 181 | Ga0157378_10436566 | 3300013297 | Unclassified | 1297 |
| 182 | Ga0163162_10327798 | 3300013306 | Bacteria | 1664 |
| 183 | Ga0157375_10250430 | 3300013308 | Bacteria | 1932 |
| 184 | Ga0157379_10032655 | 3300014968 | Bacteria | 4641 |
| 185 | Ga0157379_10546914 | 3300014968 | Bacteria | 1077 |
| 186 | Ga0157379_10825724 | 3300014968 | Unclassified | 876 |
| 187 | Ga0157376_10000077 | 3300014969 | Bacteria | 74189 |
| 188 | Ga0157376_10001519 | 3300014969 | Bacteria | 15329 |
| 189 | Ga0157376_10166834 | 3300014969 | Bacteria | 2001 |
| 190 | Ga0213876_10100350 | 3300021384 | Bacteria | 1534 |
| 191 | Ga0224572_1061606 | 3300024225 | Bacteria | 694 |
| 192 | Ga0224572_1085096 | 3300024225 | Unclassified | 583 |
| 193 | Ga0207653_10128253 | 3300025885 | Unclassified | 919 |
| 194 | Ga0207692_10397569 | 3300025898 | Unclassified | 858 |
| 195 | Ga0207692_10795675 | 3300025898 | Bacteria | 618 |
| 196 | Ga0207685_10053104 | 3300025905 | Bacteria | 1573 |
| 197 | Ga0207685_10690459 | 3300025905 | Unclassified | 555 |
| 198 | Ga0207699_10027213 | 3300025906 | Bacteria | 3163 |
| 199 | Ga0207699_10096815 | 3300025906 | Bacteria | 1864 |
| 200 | Ga0207699_10204970 | 3300025906 | Bacteria | 1338 |
| 201 | Ga0207699_10205798 | 3300025906 | Bacteria | 1336 |
| 202 | Ga0207699_10472030 | 3300025906 | Unclassified | 902 |
| 203 | Ga0207699_10570503 | 3300025906 | Bacteria | 822 |
| 204 | Ga0207699_10684104 | 3300025906 | Bacteria | 750 |
| 205 | Ga0207699_10995319 | 3300025906 | Unclassified | 620 |
| 206 | Ga0207699_11001035 | 3300025906 | Unclassified | 618 |
| 207 | Ga0207699_11236793 | 3300025906 | Bacteria | 553 |
| 208 | Ga0207699_11415060 | 3300025906 | Unclassified | 514 |
| 209 | Ga0207684_10011604 | 3300025910 | Bacteria | 7699 |
| 210 | Ga0207684_10084380 | 3300025910 | Bacteria | 2705 |
| 211 | Ga0207684_10134177 | 3300025910 | Bacteria | 2125 |
| 212 | Ga0207684_10544790 | 3300025910 | Unclassified | 993 |
| 213 | Ga0207684_10807263 | 3300025910 | Unclassified | 793 |
| 214 | Ga0207707_10002008 | 3300025912 | Bacteria | 18471 |
| 215 | Ga0207695_10406610 | 3300025913 | Bacteria | 1245 |
| 216 | Ga0207671_11069920 | 3300025914 | Bacteria | 634 |
| 217 | Ga0207693_10079374 | 3300025915 | Bacteria | 2568 |
| 218 | Ga0207693_10081292 | 3300025915 | Bacteria | 2537 |
| 219 | Ga0207693_10090246 | 3300025915 | Bacteria | 2402 |
| 220 | Ga0207693_10217926 | 3300025915 | Bacteria | 1500 |
| 221 | Ga0207693_10299968 | 3300025915 | Bacteria | 1259 |
| 222 | Ga0207663_10030267 | 3300025916 | Unclassified | 3191 |
| 223 | Ga0207663_10083419 | 3300025916 | Bacteria | 2099 |
| 224 | Ga0207663_10173978 | 3300025916 | Bacteria | 1532 |
| 225 | Ga0207663_10188570 | 3300025916 | Bacteria | 1479 |
| 226 | Ga0207663_10197291 | 3300025916 | Bacteria | 1449 |
| 227 | Ga0207663_10569310 | 3300025916 | Bacteria | 887 |
| 228 | Ga0207663_10988975 | 3300025916 | Unclassified | 675 |
| 229 | Ga0207663_11372422 | 3300025916 | Bacteria | 569 |
| 230 | Ga0207652_10042109 | 3300025921 | Bacteria | 3885 |
| 231 | Ga0207652_10116856 | 3300025921 | Unclassified | 2370 |
| 232 | Ga0207652_10791513 | 3300025921 | Unclassified | 842 |
| 233 | Ga0207646_10000037 | 3300025922 | Bacteria | 196362 |
| 234 | Ga0207646_10000343 | 3300025922 | Bacteria | 62896 |
| 235 | Ga0207646_10008245 | 3300025922 | Bacteria | 10460 |
| 236 | Ga0207646_10333027 | 3300025922 | Bacteria | 1371 |
| 237 | Ga0207646_10519850 | 3300025922 | Bacteria | 1071 |
| 238 | Ga0207646_10598439 | 3300025922 | Bacteria | 990 |
| 239 | Ga0207646_10672563 | 3300025922 | Bacteria | 927 |
| 240 | Ga0207694_10029616 | 3300025924 | Unclassified | 4178 |
| 241 | Ga0207687_10436843 | 3300025927 | Bacteria | 1083 |
| 242 | Ga0207687_10527471 | 3300025927 | Unclassified | 988 |
| 243 | Ga0207687_10944688 | 3300025927 | Bacteria | 738 |
| 244 | Ga0207700_10109903 | 3300025928 | Bacteria | 2216 |
| 245 | Ga0207700_10348600 | 3300025928 | Bacteria | 1289 |
| 246 | Ga0207700_10545953 | 3300025928 | Bacteria | 1028 |
| 247 | Ga0207700_10903433 | 3300025928 | Unclassified | 790 |
| 248 | Ga0207664_10309659 | 3300025929 | Bacteria | 1391 |
| 249 | Ga0207664_10591936 | 3300025929 | Bacteria | 996 |
| 250 | Ga0207686_10154797 | 3300025934 | Bacteria | 1600 |
| 251 | Ga0207686_10217571 | 3300025934 | Bacteria | 1377 |
| 252 | Ga0207704_10157630 | 3300025938 | Bacteria | 1611 |
| 253 | Ga0207665_10000959 | 3300025939 | Bacteria | 19542 |
| 254 | Ga0207665_10006155 | 3300025939 | Bacteria | 7969 |
| 255 | Ga0207665_10006268 | 3300025939 | Bacteria | 7894 |
| 256 | Ga0207665_10009968 | 3300025939 | Bacteria | 6235 |
| 257 | Ga0207665_10023876 | 3300025939 | Bacteria | 4028 |
| 258 | Ga0207665_10251534 | 3300025939 | Unclassified | 1306 |
| 259 | Ga0207665_10482584 | 3300025939 | Bacteria | 955 |
| 260 | Ga0207665_10630333 | 3300025939 | Bacteria | 839 |
| 261 | Ga0207665_10722681 | 3300025939 | Bacteria | 784 |
| 262 | Ga0207665_11040786 | 3300025939 | Unclassified | 652 |
| 263 | Ga0207711_10197035 | 3300025941 | Bacteria | 1837 |
| 264 | Ga0207679_10677856 | 3300025945 | Bacteria | 934 |
| 265 | Ga0207712_10494675 | 3300025961 | Bacteria | 1044 |
| 266 | Ga0207658_10427375 | 3300025986 | Bacteria | 1169 |
| 267 | Ga0207703_10565108 | 3300026035 | Bacteria | 1073 |
| 268 | Ga0207678_11172773 | 3300026067 | Unclassified | 680 |
| 269 | Ga0207641_10048111 | 3300026088 | Bacteria | 3598 |
| 270 | Ga0207648_10035580 | 3300026089 | Bacteria | 4388 |
| 271 | Ga0207676_10214264 | 3300026095 | Bacteria | 1711 |
| 272 | Ga0209179_1022488 | 3300027512 | Bacteria | 1238 |
| 273 | Ga0209179_1027708 | 3300027512 | Bacteria | 1144 |
| 274 | Ga0209588_1025351 | 3300027671 | Bacteria | 1876 |
| 275 | Ga0209588_1028139 | 3300027671 | Bacteria | 1789 |
| 276 | Ga0209588_1028728 | 3300027671 | Bacteria | 1771 |
| 277 | Ga0209588_1029828 | 3300027671 | Bacteria | 1741 |
| 278 | Ga0209588_1032623 | 3300027671 | Bacteria | 1669 |
| 279 | Ga0209588_1035312 | 3300027671 | Bacteria | 1607 |
| 280 | Ga0209588_1070755 | 3300027671 | Bacteria | 1127 |
| 281 | Ga0209588_1152587 | 3300027671 | Bacteria | 732 |
| 282 | Ga0209588_1173072 | 3300027671 | Bacteria | 679 |
| 283 | Ga0265354_1000180 | 3300028016 | Bacteria | 11598 |
| 284 | Ga0265354_1003855 | 3300028016 | Bacteria | 1627 |
| 285 | Ga0268266_10000259 | 3300028379 | Bacteria | 88660 |
| 286 | Ga0268264_10049767 | 3300028381 | Bacteria | 3488 |
| 287 | Ga0268264_10259334 | 3300028381 | Bacteria | 1618 |
| 288 | Ga0265318_10165804 | 3300028577 | Unclassified | 810 |
| 289 | Ga0265338_10052804 | 3300028800 | Bacteria | 3643 |
| 290 | Ga0265338_10066401 | 3300028800 | Bacteria | 3122 |
| 291 | Ga0265338_10066766 | 3300028800 | Bacteria | 3111 |
| 292 | Ga0265338_10429472 | 3300028800 | Bacteria | 938 |
| 293 | Ga0265338_10673862 | 3300028800 | Bacteria | 715 |
| 294 | Ga0307511_10231185 | 3300030521 | Unclassified | 915 |
| 295 | Ga0265775_105330 | 3300030762 | Unclassified | 739 |
| 296 | Ga0265770_1001514 | 3300030878 | Bacteria | 3188 |
| 297 | Ga0265765_1011507 | 3300030879 | Bacteria | 994 |
| 298 | Ga0265760_10017991 | 3300031090 | Bacteria | 2031 |
| 299 | Ga0265760_10024145 | 3300031090 | Bacteria | 1769 |
| 300 | Ga0265760_10043180 | 3300031090 | Bacteria | 1347 |
| 301 | Ga0265332_10256013 | 3300031238 | Unclassified | 724 |
| 302 | Ga0265328_10018083 | 3300031239 | Bacteria | 2723 |
| 303 | Ga0265320_10200962 | 3300031240 | Unclassified | 890 |
| 304 | Ga0265325_10036197 | 3300031241 | Bacteria | 2617 |
| 305 | Ga0265325_10147419 | 3300031241 | Bacteria | 1115 |
| 306 | Ga0265325_10261058 | 3300031241 | Bacteria | 782 |
| 307 | Ga0265340_10121564 | 3300031247 | Bacteria | 1201 |
| 308 | Ga0265339_10176114 | 3300031249 | Bacteria | 1068 |
| 309 | Ga0265339_10225673 | 3300031249 | Bacteria | 914 |
| 310 | Ga0265331_10006433 | 3300031250 | Bacteria | 6938 |
| 311 | Ga0265327_10019282 | 3300031251 | Unclassified | 4198 |
| 312 | Ga0265316_10040138 | 3300031344 | Bacteria | 3754 |
| 313 | Ga0265316_10388436 | 3300031344 | Bacteria | 1006 |
| 314 | Ga0265314_10022141 | 3300031711 | Bacteria | 4872 |
| 315 | Ga0316212_1020706 | 3300033547 | Bacteria | 923 |
| 316 | Ga0373926_0000955 | 3300035083 | Bacteria | 8386 |
| 317 | Ga0373934_0001004 | 3300035086 | Bacteria | 10198 |
| 318 | Ga0373923_0001256 | 3300035111 | Bacteria | 7130 |
| 319 | Ga0373923_0058085 | 3300035111 | Bacteria | 1637 |
| 320 | Ga0373936_0181498 | 3300035113 | Bacteria | 923 |
| 321 | Ga0373953_0063134 | 3300035117 | Bacteria | 1517 |
| 322 | Ga0373954_0000149 | 3300035118 | Bacteria | 24771 |
| 323 | Ga0373954_0009785 | 3300035118 | Bacteria | 4220 |
| 324 | Ga0373954_0060048 | 3300035118 | Bacteria | 1793 |
| 325 | Ga0373954_0270948 | 3300035118 | Unclassified | 837 |
| 326 | Ga0373954_0520286 | 3300035118 | Unclassified | 590 |
| 327 | Ga0373956_0055279 | 3300035119 | Bacteria | 1790 |
| 328 | Ga0373957_0055016 | 3300035120 | Bacteria | 1529 |
| 329 | Ga0373943_0112053 | 3300035170 | Bacteria | 1440 |
| 330 | Ga0373946_0040990 | 3300035171 | Bacteria | 1897 |
| 331 | Ga0373946_0147791 | 3300035171 | Bacteria | 1094 |
| 332 | Ga0373946_0219603 | 3300035171 | Bacteria | 917 |
| 333 | Ga0373955_0000153 | 3300035172 | Bacteria | 27589 |
| 334 | Ga0373955_0060867 | 3300035172 | Bacteria | 2084 |
| 335 | Ga0373955_0061523 | 3300035172 | Bacteria | 2074 |
| 336 | Ga0373962_0015629 | 3300035242 | Bacteria | 1948 |
| 337 | Ga0373924_0092580 | 3300035410 | Bacteria | 1294 |
| 338 | Ga0373931_0260324 | 3300035691 | Unclassified | 1058 |
| 339 | Ga0373931_0303750 | 3300035691 | Bacteria | 986 |
| 340 | Ga0373935_0008782 | 3300035692 | Bacteria | 6052 |
| 341 | Ga0373935_0183743 | 3300035692 | Bacteria | 1437 |
| 342 | Ga0373935_0311936 | 3300035692 | Bacteria | 1114 |
| 343 | Ga0373927_0000934 | 3300035695 | Bacteria | 22198 |
| 344 | Ga0373927_0004438 | 3300035695 | Bacteria | 9831 |
| 345 | Ga0373927_0754415 | 3300035695 | Unclassified | 643 |
| 346 | Ga0373927_1076329 | 3300035695 | Unclassified | 530 |
| 347 | Ga0373933_0000551 | 3300035724 | Bacteria | 23376 |
| 348 | Ga0373933_0212715 | 3300035724 | Unclassified | 1239 |
| 349 | Ga0373933_0373450 | 3300035724 | Bacteria | 928 |
| 350 | Ga0373947_0000905 | 3300035725 | Bacteria | 17957 |
| 351 | Ga0373947_0013676 | 3300035725 | Bacteria | 4650 |
| 352 | Ga0373947_0731877 | 3300035725 | Bacteria | 675 |
| 353 | Ga0373947_1219935 | 3300035725 | Unclassified | 512 |
| 354 | Ga0373937_0005026 | 3300036401 | Bacteria | 11254 |
| 355 | Ga0373937_0014533 | 3300036401 | Bacteria | 6953 |
| 356 | Ga0373937_0016547 | 3300036401 | Bacteria | 6549 |
| 357 | Ga0373937_0088918 | 3300036401 | Bacteria | 2860 |
| 358 | Ga0373937_0092719 | 3300036401 | Bacteria | 2800 |
| 359 | Ga0373937_0171110 | 3300036401 | Bacteria | 2038 |
| 360 | Ga0373937_0366847 | 3300036401 | Bacteria | 1365 |
| 361 | Ga0373937_0912986 | 3300036401 | Bacteria | 827 |
| 362 | Ga0265778_005406 | 3300036457 | Bacteria | 1351 |
| 363 | Ga0373925_0001788 | 3300037068 | Bacteria | 17923 |
| 364 | Ga0373925_0262346 | 3300037068 | Bacteria | 1388 |
| 365 | Ga0373925_0554776 | 3300037068 | Unclassified | 945 |
| 366 | Ga0395898_0812786 | 3300037466 | Unclassified | 875 |
| 367 | Ga0395901_1776247 | 3300038443 | Bacteria | 566 |
| 368 | Ga0436365_0021831 | 3300039437 | Bacteria | 2277 |
| 369 | Ga0436365_0062589 | 3300039437 | Bacteria | 689 |
| 370 | Ga0436361_0368120 | 3300039447 | Unclassified | 614 |
| 371 | Ga0436363_0434067 | 3300039450 | Bacteria | 1568 |
| 372 | Ga0436363_1570897 | 3300039450 | Bacteria | 603 |
| 373 | Ga0451577_0041420 | 3300042876 | Bacteria | 4134 |
| 374 | Ga0451577_0226955 | 3300042876 | Bacteria | 1688 |
| 375 | Ga0451577_1415465 | 3300042876 | Unclassified | 616 |
| 376 | Ga0451577_1704862 | 3300042876 | Bacteria | 554 |
| 377 | Ga0453683_0006843 | 3300044673 | Bacteria | 7785 |
| 378 | Ga0453683_0008784 | 3300044673 | Bacteria | 6768 |
| 379 | Ga0453683_0012952 | 3300044673 | Bacteria | 5452 |
| 380 | Ga0453684_0008349 | 3300044712 | Bacteria | 18610 |
| 381 | Ga0453684_2062892 | 3300044712 | Unclassified | 573 |
| 382 | Ga0451576_0093519 | 3300045051 | Bacteria | 3126 |
| 383 | Ga0451576_0213585 | 3300045051 | Bacteria | 2015 |
| 384 | Ga0495592_0002866 | 3300046454 | Bacteria | 12261 |
| 385 | Ga0495592_0071618 | 3300046454 | Bacteria | 2523 |
| 386 | Ga0495592_0161903 | 3300046454 | Bacteria | 1539 |
| 387 | Ga0495592_0169546 | 3300046454 | Bacteria | 1496 |
| 388 | Ga0495592_0299554 | 3300046454 | Bacteria | 1046 |
| 389 | Ga0495592_0476194 | 3300046454 | Unclassified | 778 |
| 390 | Ga0495592_0498954 | 3300046454 | Unclassified | 755 |
| 391 | Ga0495603_0016598 | 3300046455 | Bacteria | 4455 |
| 392 | Ga0495603_0584023 | 3300046455 | Bacteria | 640 |
| 393 | Ga0495629_0007707 | 3300046459 | Bacteria | 7921 |
| 394 | Ga0495641_0041758 | 3300046461 | Bacteria | 2129 |
| 395 | Ga0495641_0047852 | 3300046461 | Bacteria | 1962 |
| 396 | Ga0495651_0000269 | 3300046462 | Bacteria | 40351 |
| 397 | Ga0495651_0002930 | 3300046462 | Bacteria | 13203 |
| 398 | Ga0495651_0003059 | 3300046462 | Bacteria | 12909 |
| 399 | Ga0495651_0020297 | 3300046462 | Bacteria | 5158 |
| 400 | Ga0495651_0042906 | 3300046462 | Bacteria | 3510 |
| 401 | Ga0495651_0497006 | 3300046462 | Unclassified | 781 |
| 402 | Ga0495653_0005252 | 3300046463 | Bacteria | 10534 |
| 403 | Ga0495653_0008279 | 3300046463 | Bacteria | 8527 |
| 404 | Ga0495653_0055021 | 3300046463 | Bacteria | 3038 |
| 405 | Ga0495653_0385435 | 3300046463 | Unclassified | 894 |
| 406 | Ga0495653_0421112 | 3300046463 | Bacteria | 845 |
| 407 | Ga0495580_0002827 | 3300046472 | Bacteria | 14922 |
| 408 | Ga0495580_0012791 | 3300046472 | Bacteria | 6432 |
| 409 | Ga0495580_0032790 | 3300046472 | Bacteria | 3744 |
| 410 | Ga0495580_0050436 | 3300046472 | Bacteria | 2943 |
| 411 | Ga0495580_0095127 | 3300046472 | Bacteria | 2072 |
| 412 | Ga0495580_0106198 | 3300046472 | Bacteria | 1951 |
| 413 | Ga0495580_0137376 | 3300046472 | Bacteria | 1695 |
| 414 | Ga0495580_0387803 | 3300046472 | Bacteria | 943 |
| 415 | Ga0495582_0000113 | 3300046473 | Bacteria | 42436 |
| 416 | Ga0495582_0079298 | 3300046473 | Bacteria | 1822 |
| 417 | Ga0495582_0311139 | 3300046473 | Bacteria | 906 |
| 418 | Ga0495639_0020227 | 3300046475 | Bacteria | 2908 |
| 419 | Ga0495662_0064226 | 3300046476 | Bacteria | 1774 |
| 420 | Ga0495664_0055549 | 3300046477 | Bacteria | 2356 |
| 421 | Ga0495664_0095937 | 3300046477 | Bacteria | 1785 |
| 422 | Ga0495584_0699380 | 3300046491 | Unclassified | 517 |
| 423 | Ga0495594_0021611 | 3300046499 | Bacteria | 3435 |
| 424 | Ga0495594_0535719 | 3300046499 | Bacteria | 665 |
| 425 | Ga0495608_0004716 | 3300046511 | Bacteria | 9758 |
| 426 | Ga0495608_0090859 | 3300046511 | Bacteria | 1975 |
| 427 | Ga0495608_0117667 | 3300046511 | Bacteria | 1705 |
| 428 | Ga0495608_0781711 | 3300046511 | Unclassified | 564 |
| 429 | Ga0495618_0008519 | 3300046514 | Bacteria | 6201 |
| 430 | Ga0495618_0223762 | 3300046514 | Unclassified | 1186 |
| 431 | Ga0495628_0007627 | 3300046516 | Bacteria | 9350 |
| 432 | Ga0495628_0011006 | 3300046516 | Bacteria | 7660 |
| 433 | Ga0495628_0017722 | 3300046516 | Bacteria | 5917 |
| 434 | Ga0495628_0268257 | 3300046516 | Bacteria | 1270 |
| 435 | Ga0495628_0278653 | 3300046516 | Bacteria | 1242 |
| 436 | Ga0495630_0003394 | 3300046517 | Bacteria | 11094 |
| 437 | Ga0495630_0017723 | 3300046517 | Bacteria | 5221 |
| 438 | Ga0495630_0019992 | 3300046517 | Bacteria | 4930 |
| 439 | Ga0495630_0118248 | 3300046517 | Bacteria | 2010 |
| 440 | Ga0495630_0298740 | 3300046517 | Bacteria | 1230 |
| 441 | Ga0495666_0012329 | 3300046526 | Bacteria | 4262 |
| 442 | Ga0495652_0006579 | 3300046529 | Bacteria | 10798 |
| 443 | Ga0495652_0022566 | 3300046529 | Bacteria | 5584 |
| 444 | Ga0495652_0384663 | 3300046529 | Bacteria | 997 |
| 445 | Ga0495652_0906920 | 3300046529 | Archaea | 581 |
| 446 | Ga0495665_0002133 | 3300046531 | Bacteria | 10700 |
| 447 | Ga0495665_0113253 | 3300046531 | Bacteria | 1422 |
| 448 | Ga0495665_0461741 | 3300046531 | Unclassified | 641 |
| 449 | Ga0495640_0012136 | 3300046533 | Bacteria | 6596 |
| 450 | Ga0495640_0029374 | 3300046533 | Bacteria | 3948 |
| 451 | Ga0495640_0084228 | 3300046533 | Bacteria | 2109 |
| 452 | Ga0495640_0805252 | 3300046533 | Unclassified | 560 |
| 453 | Ga0495586_0001676 | 3300046535 | Bacteria | 12153 |
| 454 | Ga0495586_0031189 | 3300046535 | Bacteria | 2853 |
| 455 | Ga0495587_0001208 | 3300046536 | Bacteria | 17086 |
| 456 | Ga0495587_0001711 | 3300046536 | Bacteria | 14658 |
| 457 | Ga0495587_0002355 | 3300046536 | Bacteria | 12626 |
| 458 | Ga0495587_0119016 | 3300046536 | Bacteria | 1513 |
| 459 | Ga0495645_0034004 | 3300046543 | Bacteria | 3719 |
| 460 | Ga0495645_0065578 | 3300046543 | Bacteria | 2627 |
| 461 | Ga0495645_0230392 | 3300046543 | Bacteria | 1241 |
| 462 | Ga0495667_0005671 | 3300046559 | Bacteria | 8448 |
| 463 | Ga0495667_0006456 | 3300046559 | Bacteria | 7961 |
| 464 | Ga0495667_0056467 | 3300046559 | Bacteria | 2582 |
| 465 | Ga0495667_0271874 | 3300046559 | Bacteria | 1076 |
| 466 | Ga0495667_0332191 | 3300046559 | Bacteria | 961 |
| 467 | Ga0495667_0706359 | 3300046559 | Bacteria | 625 |
| 468 | Ga0495634_0023116 | 3300046642 | Bacteria | 4373 |
| 469 | Ga0495657_0010259 | 3300046675 | Bacteria | 7051 |
| 470 | Ga0495657_0028345 | 3300046675 | Bacteria | 3941 |
| 471 | Ga0495657_0110134 | 3300046675 | Bacteria | 1745 |
| 472 | Ga0495657_0237966 | 3300046675 | Bacteria | 1099 |
| 473 | Ga0495657_0282452 | 3300046675 | Unclassified | 993 |
| 474 | Ga0495657_0363491 | 3300046675 | Bacteria | 855 |
| 475 | Ga0495599_0004201 | 3300046678 | Bacteria | 8505 |
| 476 | Ga0495599_0055759 | 3300046678 | Bacteria | 2474 |
| 477 | Ga0495623_0001135 | 3300046679 | Bacteria | 18014 |
| 478 | Ga0495623_0019785 | 3300046679 | Bacteria | 4352 |
| 479 | Ga0495623_0218785 | 3300046679 | Bacteria | 1086 |
| 480 | Ga0495646_0001681 | 3300046680 | Bacteria | 13238 |
| 481 | Ga0495646_0142877 | 3300046680 | Bacteria | 1337 |
| 482 | Ga0495646_0510970 | 3300046680 | Bacteria | 616 |
| 483 | Ga0495647_0004304 | 3300046681 | Bacteria | 4612 |
| 484 | Ga0495658_0056441 | 3300046683 | Bacteria | 2240 |
| 485 | Ga0495658_0189652 | 3300046683 | Bacteria | 1277 |
| 486 | Ga0495658_1121321 | 3300046683 | Bacteria | 501 |
| 487 | Ga0495613_0010929 | 3300046689 | Bacteria | 6738 |
| 488 | Ga0495613_0035909 | 3300046689 | Bacteria | 3676 |
| 489 | Ga0495613_0042407 | 3300046689 | Bacteria | 3367 |
| 490 | Ga0495613_0221114 | 3300046689 | Bacteria | 1329 |
| 491 | Ga0495613_0497832 | 3300046689 | Bacteria | 821 |
| 492 | Ga0495624_0023361 | 3300046690 | Bacteria | 4078 |
| 493 | Ga0495600_0006881 | 3300046809 | Bacteria | 6935 |
| 494 | Ga0495600_0058659 | 3300046809 | Bacteria | 2514 |
| 495 | Ga0495581_0138688 | 3300047315 | Bacteria | 1418 |
| 496 | Ga0495581_0459883 | 3300047315 | Bacteria | 741 |
| 497 | Ga0495604_0000736 | 3300047317 | Bacteria | 27505 |
| 498 | Ga0495604_0000785 | 3300047317 | Bacteria | 26749 |
| 499 | Ga0495604_0021714 | 3300047317 | Bacteria | 5124 |
| 500 | Ga0495604_0039896 | 3300047317 | Bacteria | 3689 |
| 501 | Ga0495604_0125336 | 3300047317 | Bacteria | 1853 |
| 502 | Ga0495604_0127195 | 3300047317 | Bacteria | 1836 |
| 503 | Ga0495674_0006002 | 3300047319 | Bacteria | 11662 |
| 504 | Ga0495674_0036483 | 3300047319 | Bacteria | 4424 |
| 505 | Ga0495674_0097866 | 3300047319 | Bacteria | 2499 |
| 506 | Ga0495674_0297662 | 3300047319 | Bacteria | 1318 |
| 507 | Ga0495674_0776670 | 3300047319 | Bacteria | 747 |
| 508 | Ga0495674_1024607 | 3300047319 | Unclassified | 631 |
| 509 | Ga0495674_1030970 | 3300047319 | Bacteria | 629 |
| 510 | Ga0495676_0030282 | 3300047321 | Bacteria | 4597 |
| 511 | Ga0495676_0089697 | 3300047321 | Bacteria | 2303 |
| 512 | Ga0495680_0000041 | 3300047322 | Bacteria | 99386 |
| 513 | Ga0495680_0015439 | 3300047322 | Bacteria | 6589 |
| 514 | Ga0495680_0030107 | 3300047322 | Bacteria | 4436 |
| 515 | Ga0495680_0336473 | 3300047322 | Bacteria | 1054 |
| 516 | Ga0495675_0000349 | 3300047444 | Bacteria | 32511 |
| 517 | Ga0495675_0002324 | 3300047444 | Bacteria | 11363 |
| 518 | Ga0495675_0022839 | 3300047444 | Bacteria | 3988 |
| 519 | Ga0495675_0036213 | 3300047444 | Bacteria | 3148 |
| 520 | Ga0495675_0135124 | 3300047444 | Bacteria | 1531 |
| 521 | Ga0495675_0193731 | 3300047444 | Bacteria | 1239 |
| 522 | Ga0495684_0005536 | 3300047471 | Bacteria | 9841 |
| 523 | Ga0495684_0006019 | 3300047471 | Bacteria | 9428 |
| 524 | Ga0495684_0010523 | 3300047471 | Bacteria | 7154 |
| 525 | Ga0495684_0026659 | 3300047471 | Bacteria | 4441 |
| 526 | Ga0495684_0163657 | 3300047471 | Bacteria | 1658 |
| 527 | Ga0495684_0382522 | 3300047471 | Unclassified | 992 |
| 528 | Ga0495593_0000774 | 3300047673 | Bacteria | 18607 |
| 529 | Ga0495593_0078777 | 3300047673 | Bacteria | 1706 |
| 530 | Ga0495602_0008800 | 3300048088 | Bacteria | 10531 |
| 531 | Ga0495602_0019524 | 3300048088 | Bacteria | 6723 |
| 532 | Ga0495602_0021215 | 3300048088 | Bacteria | 6401 |
| 533 | Ga0495602_0227086 | 3300048088 | Bacteria | 1405 |
| 534 | Ga0495602_0500450 | 3300048088 | Bacteria | 850 |
| 535 | Ga0495614_0002304 | 3300048089 | Bacteria | 8483 |
| 536 | Ga0495614_0010953 | 3300048089 | Bacteria | 3991 |
| 537 | Ga0495614_0128581 | 3300048089 | Bacteria | 1120 |
| 538 | Ga0496100_0368889 | 3300048903 | Bacteria | 1088 |
| 539 | Ga0496100_0418564 | 3300048903 | Bacteria | 1023 |
| 540 | Ga0496100_0771821 | 3300048903 | Unclassified | 752 |
| 541 | Ga0496101_0179518 | 3300048904 | Bacteria | 1630 |
| 542 | Ga0496102_0000916 | 3300048905 | Bacteria | 27806 |
| 543 | Ga0496102_0916517 | 3300048905 | Bacteria | 798 |
| 544 | Ga0496103_0287858 | 3300048906 | Bacteria | 1057 |
| 545 | Ga0496104_0449549 | 3300048907 | Bacteria | 1200 |
| 546 | Ga0496104_1034479 | 3300048907 | Unclassified | 725 |
| 547 | Ga0496105_0176269 | 3300048908 | Bacteria | 1751 |
| 548 | Ga0496105_0580390 | 3300048908 | Bacteria | 872 |
| 549 | Ga0496106_0031829 | 3300048909 | Bacteria | 3931 |
| 550 | Ga0496110_0685401 | 3300048913 | Unclassified | 926 |
| 551 | Ga0496112_0552409 | 3300048915 | Bacteria | 1085 |
| 552 | Ga0496114_0001141 | 3300048917 | Bacteria | 20073 |
| 553 | Ga0496115_0006616 | 3300048918 | Bacteria | 8497 |
| 554 | Ga0496115_0170607 | 3300048918 | Bacteria | 1799 |
| 555 | Ga0496115_0512762 | 3300048918 | Bacteria | 962 |
| 556 | Ga0501034_0031177 | 3300049571 | Bacteria | 5418 |
| 557 | Ga0501034_0224411 | 3300049571 | Bacteria | 1830 |
| 558 | Ga0501037_0036974 | 3300049573 | Bacteria | 3598 |
| 559 | Ga0501038_0088044 | 3300049574 | Bacteria | 2607 |
| 560 | Ga0501070_0006350 | 3300049586 | Bacteria | 10061 |
| 561 | Ga0501073_0014501 | 3300049589 | Bacteria | 5727 |
| 562 | Ga0501074_0000217 | 3300049590 | Bacteria | 31629 |
| 563 | Ga0501074_0180630 | 3300049590 | Bacteria | 1505 |
| 564 | Ga0501075_1443834 | 3300049591 | Unclassified | 521 |
| 565 | Ga0501198_049788 | 3300049649 | Bacteria | 744 |
| 566 | Ga0501080_0063331 | 3300049742 | Bacteria | 3442 |
| 567 | Ga0501080_0352344 | 3300049742 | Bacteria | 1329 |
| 568 | Ga0501044_0488642 | 3300049823 | Bacteria | 1133 |
| 569 | nmdc:mga0n895_116858_c1 | 3300050512 | Bacteria | 2686 |
| 570 | nmdc:mga0n895_157994_c1 | 3300050512 | Bacteria | 2298 |
| 571 | nmdc:mga0n895_16211_c1 | 3300050512 | Bacteria | 6831 |
| 572 | nmdc:mga0rr50_70361_c1 | 3300050513 | Bacteria | 2666 |
| 573 | nmdc:mga08x19_1057340_c1 | 3300050514 | Unclassified | 576 |
| 574 | nmdc:mga08x19_12242_c1 | 3300050514 | Bacteria | 5164 |
| 575 | nmdc:mga08x19_173238_c1 | 3300050514 | Bacteria | 1470 |
| 576 | nmdc:mga08x19_263061_c1 | 3300050514 | Bacteria | 1193 |
| 577 | nmdc:mga08x19_365_c1 | 3300050514 | Bacteria | 32003 |
| 578 | nmdc:mga08x19_474808_c1 | 3300050514 | Unclassified | 881 |
| 579 | nmdc:mga08x19_522370_c1 | 3300050514 | Bacteria | 839 |
| 580 | nmdc:mga0a205_1241041_c1 | 3300050515 | Bacteria | 593 |
| 581 | Ga0495601_0056414 | 3300053077 | Bacteria | 2487 |
| 582 | Ga0495601_0295224 | 3300053077 | Bacteria | 1056 |
| 583 | Ga0495612_0000772 | 3300053078 | Bacteria | 13040 |
| 584 | Ga0495612_0568965 | 3300053078 | Unclassified | 523 |
| 585 | Ga0495595_0156965 | 3300053084 | Unclassified | 1121 |
| 586 | Ga0495619_0027932 | 3300053085 | Bacteria | 3639 |
| 587 | Ga0587066_144759 | 3300059490 | Bacteria | 584 |
| 588 | Ga0070706_101549502 | |||
| 589 | rootH1_10356686 | |||
| 590 | Ga0058859_11545456 | |||
| 591 | Ga0065715_10853452 | |||
| 592 | Ga0065707_10265685 | |||
| 593 | Ga0070690_100185006 | |||
| 594 | Ga0070690_100460824 | |||
| 595 | Ga0070682_101143006 | |||
| 596 | Ga0068868_101278141 | |||
| 597 | Ga0070673_101800873 | |||
| 598 | Ga0070667_100352190 | |||
| 599 | Ga0070709_10019666 | |||
| 600 | Ga0070709_10075841 | |||
| 601 | Ga0070709_10136432 | |||
| 602 | Ga0070709_10444071 | |||
| 603 | Ga0070709_10467283 | |||
| 604 | Ga0070709_10521100 | |||
| 605 | Ga0070709_10675473 | |||
| 606 | Ga0070709_10970618 | |||
| 607 | Ga0070714_100428065 | |||
| 608 | Ga0070713_100009214 | |||
| 609 | Ga0070713_100980687 | |||
| 610 | Ga0070710_10052346 | |||
| 611 | Ga0070710_10482214 | |||
| 612 | Ga0070710_10775714 | |||
| 613 | Ga0070711_100011381 | |||
| 614 | Ga0070711_100019344 | |||
| 615 | Ga0070711_100039048 | |||
| 616 | Ga0070711_100364914 | |||
| 617 | Ga0070711_100495328 | |||
| 618 | Ga0070711_101751898 | |||
| 619 | Ga0070711_101777710 | |||
| 620 | Ga0070705_100011509 | |||
| 621 | Ga0070705_100435364 | |||
| 622 | Ga0070694_100222590 | |||
| 623 | Ga0070694_100830495 | |||
| 624 | Ga0070694_101912695 | |||
| 625 | Ga0070708_100003600 | |||
| 626 | Ga0070708_100005636 | |||
| 627 | Ga0070708_100189820 | |||
| 628 | Ga0070708_100215135 | |||
| 629 | Ga0070708_100601546 | |||
| 630 | Ga0070708_100836426 | |||
| 631 | Ga0070708_101172587 | |||
| 632 | Ga0070708_101193440 | |||
| 633 | Ga0070708_101594720 | |||
| 634 | Ga0070708_101832887 | |||
| 635 | Ga0070681_10002001 | |||
| 636 | Ga0070685_10179110 | |||
| 637 | Ga0070706_100361637 | |||
| 638 | Ga0070706_100805929 | |||
| 639 | Ga0070706_100858836 | |||
| 640 | Ga0070706_101072450 | |||
| 641 | Ga0070706_101494008 | |||
| 642 | Ga0070706_101699312 | |||
| 643 | Ga0070707_100024988 | |||
| 644 | Ga0070707_100028747 | |||
| 645 | Ga0070707_100271464 | |||
| 646 | Ga0070707_100541010 | |||
| 647 | Ga0070707_100803003 | |||
| 648 | Ga0070707_101354262 | |||
| 649 | Ga0070698_100016168 | |||
| 650 | Ga0070698_100023916 | |||
| 651 | Ga0070698_100031161 | |||
| 652 | Ga0070698_100031762 | |||
| 653 | Ga0070698_100199357 | |||
| 654 | Ga0070699_100004496 | |||
| 655 | Ga0070699_100012380 | |||
| 656 | Ga0070699_100025050 | |||
| 657 | Ga0070699_100154909 | |||
| 658 | Ga0070699_100324245 | |||
| 659 | Ga0070679_100019420 | |||
| 660 | Ga0070679_100019976 | |||
| 661 | Ga0070679_100280411 | |||
| 662 | Ga0070697_100006091 | |||
| 663 | Ga0070697_100160543 | |||
| 664 | Ga0070697_100558624 | |||
| 665 | Ga0070697_101040929 | |||
| 666 | Ga0070697_101099295 | |||
| 667 | Ga0070697_101178142 | |||
| 668 | Ga0070697_101453230 | |||
| 669 | Ga0070695_100005390 | |||
| 670 | Ga0070695_100123311 | |||
| 671 | Ga0070695_100924707 | |||
| 672 | Ga0070695_101032628 | |||
| 673 | Ga0070696_100004505 | |||
| 674 | Ga0070696_100082999 | |||
| 675 | Ga0070693_100000494 | |||
| 676 | Ga0070665_100000700 | |||
| 677 | Ga0070704_100007365 | |||
| 678 | Ga0070704_100089917 | |||
| 679 | Ga0070664_101107108 | |||
| 680 | Ga0068859_100266489 | |||
| 681 | Ga0068864_100606435 | |||
| 682 | Ga0068866_10140691 | |||
| 683 | Ga0068863_100012596 | |||
| 684 | Ga0068858_100043469 | |||
| 685 | Ga0068860_100019907 | |||
| 686 | Ga0081455_10227434 | |||
| 687 | Ga0081540_1341198 | |||
| 688 | Ga0070717_10253897 | |||
| 689 | Ga0070717_10257550 | |||
| 690 | Ga0070717_10353208 | |||
| 691 | Ga0070717_10566592 | |||
| 692 | Ga0070715_10102241 | |||
| 693 | Ga0070715_10770814 | |||
| 694 | Ga0070716_100000120 | |||
| 695 | Ga0070716_100014973 | |||
| 696 | Ga0070716_100044889 | |||
| 697 | Ga0070716_100049537 | |||
| 698 | Ga0070716_100083773 | |||
| 699 | Ga0070716_100636716 | |||
| 700 | Ga0070716_100906451 | |||
| 701 | Ga0070712_100050740 | |||
| 702 | Ga0070712_100136660 | |||
| 703 | Ga0070712_100200024 | |||
| 704 | Ga0070712_100394027 | |||
| 705 | Ga0070712_100495087 | |||
| 706 | Ga0097621_100115276 | |||
| 707 | Ga0097621_100202921 | |||
| 708 | Ga0097621_101306716 | |||
| 709 | Ga0068871_100067329 | |||
| 710 | Ga0068871_100515956 | |||
| 711 | Ga0068871_100765884 | |||
| 712 | Ga0068871_101138618 | |||
| 713 | Ga0075433_10625302 | |||
| 714 | Ga0075434_100134498 | |||
| 715 | Ga0075434_100195863 | |||
| 716 | Ga0075434_100367924 | |||
| 717 | Ga0075434_100970191 | |||
| 718 | Ga0075436_100002590 | |||
| 719 | Ga0075436_100011008 | |||
| 720 | Ga0075436_100303320 | |||
| 721 | Ga0075436_100728326 | |||
| 722 | Ga0075436_100867410 | |||
| 723 | Ga0075436_101567983 | |||
| 724 | Ga0097620_100266507 | |||
| 725 | Ga0075435_100072164 | |||
| 726 | Ga0075435_100151764 | |||
| 727 | Ga0075435_100354095 | |||
| 728 | Ga0099794_10018883 | |||
| 729 | Ga0099794_10047797 | |||
| 730 | Ga0099794_10049726 | |||
| 731 | Ga0099794_10069502 | |||
| 732 | Ga0099794_10092648 | |||
| 733 | Ga0099794_10095259 | |||
| 734 | Ga0099794_10181487 | |||
| 735 | Ga0099794_10197181 | |||
| 736 | Ga0099794_10203512 | |||
| 737 | Ga0099794_10474534 | |||
| 738 | Ga0099794_10485058 | |||
| 739 | Ga0099794_10518611 | |||
| 740 | Ga0099794_10521836 | |||
| 741 | Ga0099794_10579802 | |||
| 742 | Ga0099795_10080008 | |||
| 743 | Ga0099795_10119934 | |||
| 744 | Ga0105240_10217617 | |||
| 745 | Ga0105245_10529498 | |||
| 746 | Ga0105245_10932638 | |||
| 747 | Ga0105245_11202680 | |||
| 748 | Ga0105247_10730922 | |||
| 749 | Ga0105247_10799521 | |||
| 750 | Ga0105241_11443686 | |||
| 751 | Ga0105242_10055149 | |||
| 752 | Ga0105242_10209586 | |||
| 753 | Ga0105248_10159229 | |||
| 754 | Ga0105248_11114788 | |||
| 755 | Ga0105237_10367910 | |||
| 756 | Ga0105238_10000248 | |||
| 757 | Ga0105238_12206241 | |||
| 758 | Ga0105249_10424016 | |||
| 759 | Ga0099796_10001546 | |||
| 760 | Ga0099796_10035759 | |||
| 761 | Ga0099796_10267636 | |||
| 762 | Ga0105239_10196854 | |||
| 763 | Ga0105246_12265575 | |||
| 764 | Ga0157374_10053425 | |||
| 765 | Ga0157378_10002909 | |||
| 766 | Ga0157378_10012390 | |||
| 767 | Ga0157378_10038768 | |||
| 768 | Ga0157378_10436566 | |||
| 769 | Ga0163162_10327798 | |||
| 770 | Ga0157375_10250430 | |||
| 771 | Ga0157379_10032655 | |||
| 772 | Ga0157379_10546914 | |||
| 773 | Ga0157379_10825724 | |||
| 774 | Ga0157376_10000077 | |||
| 775 | Ga0157376_10001519 | |||
| 776 | Ga0157376_10166834 | |||
| 777 | Ga0213876_10100350 | |||
| 778 | Ga0224572_1061606 | |||
| 779 | Ga0224572_1085096 | |||
| 780 | Ga0207653_10128253 | |||
| 781 | Ga0207692_10397569 | |||
| 782 | Ga0207692_10795675 | |||
| 783 | Ga0207685_10053104 | |||
| 784 | Ga0207685_10690459 | |||
| 785 | Ga0207699_10027213 | |||
| 786 | Ga0207699_10096815 | |||
| 787 | Ga0207699_10204970 | |||
| 788 | Ga0207699_10205798 | |||
| 789 | Ga0207699_10472030 | |||
| 790 | Ga0207699_10570503 | |||
| 791 | Ga0207699_10684104 | |||
| 792 | Ga0207699_10995319 | |||
| 793 | Ga0207699_11001035 | |||
| 794 | Ga0207699_11236793 | |||
| 795 | Ga0207699_11415060 | |||
| 796 | Ga0207684_10011604 | |||
| 797 | Ga0207684_10084380 | |||
| 798 | Ga0207684_10134177 | |||
| 799 | Ga0207684_10544790 | |||
| 800 | Ga0207684_10807263 | |||
| 801 | Ga0207707_10002008 | |||
| 802 | Ga0207695_10406610 | |||
| 803 | Ga0207671_11069920 | |||
| 804 | Ga0207693_10079374 | |||
| 805 | Ga0207693_10081292 | |||
| 806 | Ga0207693_10090246 | |||
| 807 | Ga0207693_10217926 | |||
| 808 | Ga0207693_10299968 | |||
| 809 | Ga0207663_10030267 | |||
| 810 | Ga0207663_10083419 | |||
| 811 | Ga0207663_10173978 | |||
| 812 | Ga0207663_10188570 | |||
| 813 | Ga0207663_10197291 | |||
| 814 | Ga0207663_10569310 | |||
| 815 | Ga0207663_10988975 | |||
| 816 | Ga0207663_11372422 | |||
| 817 | Ga0207652_10042109 | |||
| 818 | Ga0207652_10116856 | |||
| 819 | Ga0207652_10791513 | |||
| 820 | Ga0207646_10000037 | |||
| 821 | Ga0207646_10000343 | |||
| 822 | Ga0207646_10008245 | |||
| 823 | Ga0207646_10333027 | |||
| 824 | Ga0207646_10519850 | |||
| 825 | Ga0207646_10598439 | |||
| 826 | Ga0207646_10672563 | |||
| 827 | Ga0207694_10029616 | |||
| 828 | Ga0207687_10436843 | |||
| 829 | Ga0207687_10527471 | |||
| 830 | Ga0207687_10944688 | |||
| 831 | Ga0207700_10109903 | |||
| 832 | Ga0207700_10348600 | |||
| 833 | Ga0207700_10545953 | |||
| 834 | Ga0207700_10903433 | |||
| 835 | Ga0207664_10309659 | |||
| 836 | Ga0207664_10591936 | |||
| 837 | Ga0207686_10154797 | |||
| 838 | Ga0207686_10217571 | |||
| 839 | Ga0207704_10157630 | |||
| 840 | Ga0207665_10000959 | |||
| 841 | Ga0207665_10006155 | |||
| 842 | Ga0207665_10006268 | |||
| 843 | Ga0207665_10009968 | |||
| 844 | Ga0207665_10023876 | |||
| 845 | Ga0207665_10251534 | |||
| 846 | Ga0207665_10482584 | |||
| 847 | Ga0207665_10630333 | |||
| 848 | Ga0207665_10722681 | |||
| 849 | Ga0207665_11040786 | |||
| 850 | Ga0207711_10197035 | |||
| 851 | Ga0207679_10677856 | |||
| 852 | Ga0207712_10494675 | |||
| 853 | Ga0207658_10427375 | |||
| 854 | Ga0207703_10565108 | |||
| 855 | Ga0207678_11172773 | |||
| 856 | Ga0207641_10048111 | |||
| 857 | Ga0207648_10035580 | |||
| 858 | Ga0207676_10214264 | |||
| 859 | Ga0209179_1022488 | |||
| 860 | Ga0209179_1027708 | |||
| 861 | Ga0209588_1025351 | |||
| 862 | Ga0209588_1028139 | |||
| 863 | Ga0209588_1028728 | |||
| 864 | Ga0209588_1029828 | |||
| 865 | Ga0209588_1032623 | |||
| 866 | Ga0209588_1035312 | |||
| 867 | Ga0209588_1070755 | |||
| 868 | Ga0209588_1152587 | |||
| 869 | Ga0209588_1173072 | |||
| 870 | Ga0265354_1000180 | |||
| 871 | Ga0265354_1003855 | |||
| 872 | Ga0268266_10000259 | |||
| 873 | Ga0268264_10049767 | |||
| 874 | Ga0268264_10259334 | |||
| 875 | Ga0265318_10165804 | |||
| 876 | Ga0265338_10052804 | |||
| 877 | Ga0265338_10066401 | |||
| 878 | Ga0265338_10066766 | |||
| 879 | Ga0265338_10429472 | |||
| 880 | Ga0265338_10673862 | |||
| 881 | Ga0307511_10231185 | |||
| 882 | Ga0265775_105330 | |||
| 883 | Ga0265770_1001514 | |||
| 884 | Ga0265765_1011507 | |||
| 885 | Ga0265760_10017991 | |||
| 886 | Ga0265760_10024145 | |||
| 887 | Ga0265760_10043180 | |||
| 888 | Ga0265332_10256013 | |||
| 889 | Ga0265328_10018083 | |||
| 890 | Ga0265320_10200962 | |||
| 891 | Ga0265325_10036197 | |||
| 892 | Ga0265325_10147419 | |||
| 893 | Ga0265325_10261058 | |||
| 894 | Ga0265340_10121564 | |||
| 895 | Ga0265339_10176114 | |||
| 896 | Ga0265339_10225673 | |||
| 897 | Ga0265331_10006433 | |||
| 898 | Ga0265327_10019282 | |||
| 899 | Ga0265316_10040138 | |||
| 900 | Ga0265316_10388436 | |||
| 901 | Ga0265314_10022141 | |||
| 902 | Ga0316212_1020706 | |||
| 903 | Ga0373926_0000955 | |||
| 904 | Ga0373934_0001004 | |||
| 905 | Ga0373923_0001256 | |||
| 906 | Ga0373923_0058085 | |||
| 907 | Ga0373936_0181498 | |||
| 908 | Ga0373953_0063134 | |||
| 909 | Ga0373954_0000149 | |||
| 910 | Ga0373954_0009785 | |||
| 911 | Ga0373954_0060048 | |||
| 912 | Ga0373954_0270948 | |||
| 913 | Ga0373954_0520286 | |||
| 914 | Ga0373956_0055279 | |||
| 915 | Ga0373957_0055016 | |||
| 916 | Ga0373943_0112053 | |||
| 917 | Ga0373946_0040990 | |||
| 918 | Ga0373946_0147791 | |||
| 919 | Ga0373946_0219603 | |||
| 920 | Ga0373955_0000153 | |||
| 921 | Ga0373955_0060867 | |||
| 922 | Ga0373955_0061523 | |||
| 923 | Ga0373962_0015629 | |||
| 924 | Ga0373924_0092580 | |||
| 925 | Ga0373931_0260324 | |||
| 926 | Ga0373931_0303750 | |||
| 927 | Ga0373935_0008782 | |||
| 928 | Ga0373935_0183743 | |||
| 929 | Ga0373935_0311936 | |||
| 930 | Ga0373927_0000934 | |||
| 931 | Ga0373927_0004438 | |||
| 932 | Ga0373927_0754415 | |||
| 933 | Ga0373927_1076329 | |||
| 934 | Ga0373933_0000551 | |||
| 935 | Ga0373933_0212715 | |||
| 936 | Ga0373933_0373450 | |||
| 937 | Ga0373947_0000905 | |||
| 938 | Ga0373947_0013676 | |||
| 939 | Ga0373947_0731877 | |||
| 940 | Ga0373947_1219935 | |||
| 941 | Ga0373937_0005026 | |||
| 942 | Ga0373937_0014533 | |||
| 943 | Ga0373937_0016547 | |||
| 944 | Ga0373937_0088918 | |||
| 945 | Ga0373937_0092719 | |||
| 946 | Ga0373937_0171110 | |||
| 947 | Ga0373937_0366847 | |||
| 948 | Ga0373937_0912986 | |||
| 949 | Ga0265778_005406 | |||
| 950 | Ga0373925_0001788 | |||
| 951 | Ga0373925_0262346 | |||
| 952 | Ga0373925_0554776 | |||
| 953 | Ga0395898_0812786 | |||
| 954 | Ga0395901_1776247 | |||
| 955 | Ga0436365_0021831 | |||
| 956 | Ga0436365_0062589 | |||
| 957 | Ga0436361_0368120 | |||
| 958 | Ga0436363_0434067 | |||
| 959 | Ga0436363_1570897 | |||
| 960 | Ga0451577_0041420 | |||
| 961 | Ga0451577_0226955 | |||
| 962 | Ga0451577_1415465 | |||
| 963 | Ga0451577_1704862 | |||
| 964 | Ga0453683_0006843 | |||
| 965 | Ga0453683_0008784 | |||
| 966 | Ga0453683_0012952 | |||
| 967 | Ga0453684_0008349 | |||
| 968 | Ga0453684_2062892 | |||
| 969 | Ga0451576_0093519 | |||
| 970 | Ga0451576_0213585 | |||
| 971 | Ga0495592_0002866 | |||
| 972 | Ga0495592_0071618 | |||
| 973 | Ga0495592_0161903 | |||
| 974 | Ga0495592_0169546 | |||
| 975 | Ga0495592_0299554 | |||
| 976 | Ga0495592_0476194 | |||
| 977 | Ga0495592_0498954 | |||
| 978 | Ga0495603_0016598 | |||
| 979 | Ga0495603_0584023 | |||
| 980 | Ga0495629_0007707 | |||
| 981 | Ga0495641_0041758 | |||
| 982 | Ga0495641_0047852 | |||
| 983 | Ga0495651_0000269 | |||
| 984 | Ga0495651_0002930 | |||
| 985 | Ga0495651_0003059 | |||
| 986 | Ga0495651_0020297 | |||
| 987 | Ga0495651_0042906 | |||
| 988 | Ga0495651_0497006 | |||
| 989 | Ga0495653_0005252 | |||
| 990 | Ga0495653_0008279 | |||
| 991 | Ga0495653_0055021 | |||
| 992 | Ga0495653_0385435 | |||
| 993 | Ga0495653_0421112 | |||
| 994 | Ga0495580_0002827 | |||
| 995 | Ga0495580_0012791 | |||
| 996 | Ga0495580_0032790 | |||
| 997 | Ga0495580_0050436 | |||
| 998 | Ga0495580_0095127 | |||
| 999 | Ga0495580_0106198 | |||
| 1000 | Ga0495580_0137376 | |||
| 1001 | Ga0495580_0387803 | |||
| 1002 | Ga0495582_0000113 | |||
| 1003 | Ga0495582_0079298 | |||
| 1004 | Ga0495582_0311139 | |||
| 1005 | Ga0495639_0020227 | |||
| 1006 | Ga0495662_0064226 | |||
| 1007 | Ga0495664_0055549 | |||
| 1008 | Ga0495664_0095937 | |||
| 1009 | Ga0495584_0699380 | |||
| 1010 | Ga0495594_0021611 | |||
| 1011 | Ga0495594_0535719 | |||
| 1012 | Ga0495608_0004716 | |||
| 1013 | Ga0495608_0090859 | |||
| 1014 | Ga0495608_0117667 | |||
| 1015 | Ga0495608_0781711 | |||
| 1016 | Ga0495618_0008519 | |||
| 1017 | Ga0495618_0223762 | |||
| 1018 | Ga0495628_0007627 | |||
| 1019 | Ga0495628_0011006 | |||
| 1020 | Ga0495628_0017722 | |||
| 1021 | Ga0495628_0268257 | |||
| 1022 | Ga0495628_0278653 | |||
| 1023 | Ga0495630_0003394 | |||
| 1024 | Ga0495630_0017723 | |||
| 1025 | Ga0495630_0019992 | |||
| 1026 | Ga0495630_0118248 | |||
| 1027 | Ga0495630_0298740 | |||
| 1028 | Ga0495666_0012329 | |||
| 1029 | Ga0495652_0006579 | |||
| 1030 | Ga0495652_0022566 | |||
| 1031 | Ga0495652_0384663 | |||
| 1032 | Ga0495652_0906920 | |||
| 1033 | Ga0495665_0002133 | |||
| 1034 | Ga0495665_0113253 | |||
| 1035 | Ga0495665_0461741 | |||
| 1036 | Ga0495640_0012136 | |||
| 1037 | Ga0495640_0029374 | |||
| 1038 | Ga0495640_0084228 | |||
| 1039 | Ga0495640_0805252 | |||
| 1040 | Ga0495586_0001676 | |||
| 1041 | Ga0495586_0031189 | |||
| 1042 | Ga0495587_0001208 | |||
| 1043 | Ga0495587_0001711 | |||
| 1044 | Ga0495587_0002355 | |||
| 1045 | Ga0495587_0119016 | |||
| 1046 | Ga0495645_0034004 | |||
| 1047 | Ga0495645_0065578 | |||
| 1048 | Ga0495645_0230392 | |||
| 1049 | Ga0495667_0005671 | |||
| 1050 | Ga0495667_0006456 | |||
| 1051 | Ga0495667_0056467 | |||
| 1052 | Ga0495667_0271874 | |||
| 1053 | Ga0495667_0332191 | |||
| 1054 | Ga0495667_0706359 | |||
| 1055 | Ga0495634_0023116 | |||
| 1056 | Ga0495657_0010259 | |||
| 1057 | Ga0495657_0028345 | |||
| 1058 | Ga0495657_0110134 | |||
| 1059 | Ga0495657_0237966 | |||
| 1060 | Ga0495657_0282452 | |||
| 1061 | Ga0495657_0363491 | |||
| 1062 | Ga0495599_0004201 | |||
| 1063 | Ga0495599_0055759 | |||
| 1064 | Ga0495623_0001135 | |||
| 1065 | Ga0495623_0019785 | |||
| 1066 | Ga0495623_0218785 | |||
| 1067 | Ga0495646_0001681 | |||
| 1068 | Ga0495646_0142877 | |||
| 1069 | Ga0495646_0510970 | |||
| 1070 | Ga0495647_0004304 | |||
| 1071 | Ga0495658_0056441 | |||
| 1072 | Ga0495658_0189652 | |||
| 1073 | Ga0495658_1121321 | |||
| 1074 | Ga0495613_0010929 | |||
| 1075 | Ga0495613_0035909 | |||
| 1076 | Ga0495613_0042407 | |||
| 1077 | Ga0495613_0221114 | |||
| 1078 | Ga0495613_0497832 | |||
| 1079 | Ga0495624_0023361 | |||
| 1080 | Ga0495600_0006881 | |||
| 1081 | Ga0495600_0058659 | |||
| 1082 | Ga0495581_0138688 | |||
| 1083 | Ga0495581_0459883 | |||
| 1084 | Ga0495604_0000736 | |||
| 1085 | Ga0495604_0000785 | |||
| 1086 | Ga0495604_0021714 | |||
| 1087 | Ga0495604_0039896 | |||
| 1088 | Ga0495604_0125336 | |||
| 1089 | Ga0495604_0127195 | |||
| 1090 | Ga0495674_0006002 | |||
| 1091 | Ga0495674_0036483 | |||
| 1092 | Ga0495674_0097866 | |||
| 1093 | Ga0495674_0297662 | |||
| 1094 | Ga0495674_0776670 | |||
| 1095 | Ga0495674_1024607 | |||
| 1096 | Ga0495674_1030970 | |||
| 1097 | Ga0495676_0030282 | |||
| 1098 | Ga0495676_0089697 | |||
| 1099 | Ga0495680_0000041 | |||
| 1100 | Ga0495680_0015439 | |||
| 1101 | Ga0495680_0030107 | |||
| 1102 | Ga0495680_0336473 | |||
| 1103 | Ga0495675_0000349 | |||
| 1104 | Ga0495675_0002324 | |||
| 1105 | Ga0495675_0022839 | |||
| 1106 | Ga0495675_0036213 | |||
| 1107 | Ga0495675_0135124 | |||
| 1108 | Ga0495675_0193731 | |||
| 1109 | Ga0495684_0005536 | |||
| 1110 | Ga0495684_0006019 | |||
| 1111 | Ga0495684_0010523 | |||
| 1112 | Ga0495684_0026659 | |||
| 1113 | Ga0495684_0163657 | |||
| 1114 | Ga0495684_0382522 | |||
| 1115 | Ga0495593_0000774 | |||
| 1116 | Ga0495593_0078777 | |||
| 1117 | Ga0495602_0008800 | |||
| 1118 | Ga0495602_0019524 | |||
| 1119 | Ga0495602_0021215 | |||
| 1120 | Ga0495602_0227086 | |||
| 1121 | Ga0495602_0500450 | |||
| 1122 | Ga0495614_0002304 | |||
| 1123 | Ga0495614_0010953 | |||
| 1124 | Ga0495614_0128581 | |||
| 1125 | Ga0496100_0368889 | |||
| 1126 | Ga0496100_0418564 | |||
| 1127 | Ga0496100_0771821 | |||
| 1128 | Ga0496101_0179518 | |||
| 1129 | Ga0496102_0000916 | |||
| 1130 | Ga0496102_0916517 | |||
| 1131 | Ga0496103_0287858 | |||
| 1132 | Ga0496104_0449549 | |||
| 1133 | Ga0496104_1034479 | |||
| 1134 | Ga0496105_0176269 | |||
| 1135 | Ga0496105_0580390 | |||
| 1136 | Ga0496106_0031829 | |||
| 1137 | Ga0496110_0685401 | |||
| 1138 | Ga0496112_0552409 | |||
| 1139 | Ga0496114_0001141 | |||
| 1140 | Ga0496115_0006616 | |||
| 1141 | Ga0496115_0170607 | |||
| 1142 | Ga0496115_0512762 | |||
| 1143 | Ga0501034_0031177 | |||
| 1144 | Ga0501034_0224411 | |||
| 1145 | Ga0501037_0036974 | |||
| 1146 | Ga0501038_0088044 | |||
| 1147 | Ga0501070_0006350 | |||
| 1148 | Ga0501073_0014501 | |||
| 1149 | Ga0501074_0000217 | |||
| 1150 | Ga0501074_0180630 | |||
| 1151 | Ga0501075_1443834 | |||
| 1152 | Ga0501198_049788 | |||
| 1153 | Ga0501080_0063331 | |||
| 1154 | Ga0501080_0352344 | |||
| 1155 | Ga0501044_0488642 | |||
| 1156 | nmdc:mga0n895_116858_c1 | |||
| 1157 | nmdc:mga0n895_157994_c1 | |||
| 1158 | nmdc:mga0n895_16211_c1 | |||
| 1159 | nmdc:mga0rr50_70361_c1 | |||
| 1160 | nmdc:mga08x19_1057340_c1 | |||
| 1161 | nmdc:mga08x19_12242_c1 | |||
| 1162 | nmdc:mga08x19_173238_c1 | |||
| 1163 | nmdc:mga08x19_263061_c1 | |||
| 1164 | nmdc:mga08x19_365_c1 | |||
| 1165 | nmdc:mga08x19_474808_c1 | |||
| 1166 | nmdc:mga08x19_522370_c1 | |||
| 1167 | nmdc:mga0a205_1241041_c1 | |||
| 1168 | Ga0495601_0056414 | |||
| 1169 | Ga0495601_0295224 | |||
| 1170 | Ga0495612_0000772 | |||
| 1171 | Ga0495612_0568965 | |||
| 1172 | Ga0495595_0156965 | |||
| 1173 | Ga0495619_0027932 | |||
| 1174 | Ga0587066_144759 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v4b-assembly1.cif.gz_AQ | structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for rna and protein components into a 11.7 a cryo-em map. | 0.9354 | 9 | 80 |
| 1i96-assembly1.cif.gz_Q | crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain) | 0.9176 | 8 | 80 |
| 8d8k-assembly1.cif.gz_Q | yeast mitochondrial small subunit assembly intermediate (state 2) | 0.9138 | 8 | 80 |
| 1n36-assembly1.cif.gz_Q | structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position | 0.9132 | 8 | 78 |
| 4v4w-assembly1.cif.gz_AQ | structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 | 0.912 | 9 | 80 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MCQ9_44_132_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9306 | 9 | 78 | 2.40.50.140 |
| af_C6T0V9_1_79_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.926 | 9 | 80 | 2.40.50.140 |
| af_Q03246_1_107_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9189 | 8 | 80 | 2.40.50.140 |
| af_Q9LHN1_1_100_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9113 | 9 | 80 | 2.40.50.140 |
| 5xyuQ00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9073 | 7 | 80 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F6ECI9-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9543 | 7 | 79 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A7X7L2N5-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9468 | 8 | 80 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A1G3Y890-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9438 | 8 | 80 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A7V3PY76-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9436 | 7 | 80 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A2S6SCJ9-F1-model_v4 | Small ribosomal subunit protein uS17 | 0.9434 | 8 | 80 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |