F466686

General Info

Members Datasets Scaffolds Average Seq Length
587 338 1174 160

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0114088|Ga0451577_0114088_214_810
Length 198
Sequence MKRPRADGGPPSQPHRAIFMARIDRPEFGNADLPSQEKTMTPKNTICLWYDGTALDAARFYAATFPDSAVGAIFHAPSDYPMGTAGDVLTVEFTVIGIPCLGLNGGPMFKHTEAFSFQVATDDQAETDRLWNSIIDSGGQASECGWCKDKWGLSWQITPRALTEALADPDRAAAKRAFDAMMQMGKIDIAKIEAARRG

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
121 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
122 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
192 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
193 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
194 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
195 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
209 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
210 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
211 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
220 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
221 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
222 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
223 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
224 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
225 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
226 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
227 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
228 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
231 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
232 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
241 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
247 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
248 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
249 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
252 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
255 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
256 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
257 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
258 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
261 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
267 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
268 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
273 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
276 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
284 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
287 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
293 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
294 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
295 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
296 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
297 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
301 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
314 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
315 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
316 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
321 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
322 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
327 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
330 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
331 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
332 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
333 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
334 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
335 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
336 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
337 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
338 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.31
Nodule 0
Rhizoplane 4.77
Rhizosphere 77.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0114088 3300042876 Bacteria 2419
2 JGI24737J22298_10056301 3300001990 Bacteria 1188
3 JGI25156J39149_1009741 3300002705 Bacteria 2311
4 JGI25152J39213_1013807 3300002773 Bacteria 1666
5 JGI25150J39212_1002186 3300002774 Bacteria 4998
6 JGI25159J45721_1000166 3300002987 Bacteria 30609
7 JGI25159J45721_1040528 3300002987 Bacteria 682
8 JGI25151J46595_10001854 3300003187 Bacteria 13602
9 JGI25151J46595_10029968 3300003187 Bacteria 2146
10 JGI25160J50197_1000352 3300003354 Bacteria 30609
11 JGI25161J50226_1000268 3300003374 Bacteria 30609
12 Ga0055539_1000521 3300003752 Bacteria 11784
13 Ga0055533_1000073 3300003756 Bacteria 142476
14 Ga0055533_1000805 3300003756 Bacteria 9761
15 Ga0055525_1002058 3300003759 Bacteria 2411
16 Ga0055526_1000015 3300003771 Bacteria 226543
17 Ga0055526_1000802 3300003771 Bacteria 23436
18 Ga0055537_1000053 3300003773 Bacteria 82599
19 Ga0055524_1000020 3300003775 Bacteria 227971
20 Ga0055524_1000059 3300003775 Bacteria 138562
21 Ga0055534_1000017 3300003784 Bacteria 138670
22 Ga0055534_1004910 3300003784 Bacteria 3738
23 Ga0055528_1000008 3300003790 Bacteria 226543
24 Ga0055543_1000361 3300004625 Bacteria 30407
25 Ga0065165_1004330 3300005262 Bacteria 8913
26 Ga0065714_10000625 3300005288 Bacteria 3371
27 Ga0065714_10004677 3300005288 Bacteria 4620
28 Ga0065714_10017235 3300005288 Bacteria 1826
29 Ga0065714_10106783 3300005288 Bacteria 1533
30 Ga0065714_10493790 3300005288 Bacteria 527
31 Ga0065704_10214136 3300005289 Bacteria 1097
32 Ga0065715_10059901 3300005293 Bacteria 784
33 Ga0065715_10111326 3300005293 Bacteria 2578
34 Ga0065715_10533244 3300005293 Bacteria 754
35 Ga0065707_10013027 3300005295 Bacteria 2497
36 Ga0065707_10095187 3300005295 Bacteria 3407
37 Ga0070658_10010248 3300005327 Bacteria 7515
38 Ga0070658_10029811 3300005327 Bacteria 4383
39 Ga0070658_10055328 3300005327 Bacteria 3223
40 Ga0070676_10132855 3300005328 Bacteria 1576
41 Ga0070683_100001582 3300005329 Bacteria 17608
42 Ga0070683_100091563 3300005329 Bacteria 2855
43 Ga0070690_100181988 3300005330 Bacteria 1453
44 Ga0070690_100427305 3300005330 Bacteria 978
45 Ga0070670_100045953 3300005331 Bacteria 3754
46 Ga0070670_100047703 3300005331 Bacteria 3686
47 Ga0070677_10467642 3300005333 Bacteria 678
48 Ga0068869_100010901 3300005334 Bacteria 5946
49 Ga0070666_10110394 3300005335 Bacteria 1901
50 Ga0070680_100000041 3300005336 Bacteria 66075
51 Ga0070680_100131720 3300005336 Bacteria 2092
52 Ga0068868_100004978 3300005338 Bacteria 9331
53 Ga0068868_101140604 3300005338 Bacteria 719
54 Ga0070660_100010221 3300005339 Bacteria 6623
55 Ga0070660_100165522 3300005339 Bacteria 1784
56 Ga0070660_100419115 3300005339 Bacteria 1108
57 Ga0070689_100023905 3300005340 Bacteria 4581
58 Ga0070661_100006146 3300005344 Bacteria 8272
59 Ga0070661_100435245 3300005344 Bacteria 1041
60 Ga0070661_100520883 3300005344 Bacteria 954
61 Ga0070661_100960164 3300005344 Bacteria 707
62 Ga0070668_100026333 3300005347 Bacteria 4413
63 Ga0070668_101330100 3300005347 Bacteria 654
64 Ga0070669_100016215 3300005353 Bacteria 5314
65 Ga0070669_100039483 3300005353 Bacteria 3430
66 Ga0070669_100429310 3300005353 Bacteria 1086
67 Ga0070675_100004394 3300005354 Bacteria 10754
68 Ga0070675_100007321 3300005354 Bacteria 8519
69 Ga0070675_100018914 3300005354 Bacteria 5487
70 Ga0070675_100028447 3300005354 Bacteria 4498
71 Ga0070675_100207935 3300005354 Bacteria 1700
72 Ga0070675_100704322 3300005354 Bacteria 920
73 Ga0070671_100007061 3300005355 Bacteria 8994
74 Ga0070674_100002771 3300005356 Bacteria 9684
75 Ga0070673_100008183 3300005364 Bacteria 6940
76 Ga0070673_100036119 3300005364 Bacteria 3753
77 Ga0070673_100164912 3300005364 Bacteria 1887
78 Ga0070673_100599499 3300005364 Bacteria 1005
79 Ga0070688_100006764 3300005365 Bacteria 6147
80 Ga0070659_100035370 3300005366 Bacteria 3890
81 Ga0070659_100049641 3300005366 Bacteria 3300
82 Ga0070659_100182942 3300005366 Bacteria 1720
83 Ga0070659_100612650 3300005366 Bacteria 936
84 Ga0070659_100790481 3300005366 Bacteria 825
85 Ga0070667_100014655 3300005367 Bacteria 6477
86 Ga0070667_100130592 3300005367 Bacteria 2192
87 Ga0070667_100214261 3300005367 Bacteria 1713
88 Ga0070667_100265847 3300005367 Bacteria 1537
89 Ga0070714_100007323 3300005435 Bacteria 8582
90 Ga0070711_100006250 3300005439 Bacteria 7172
91 Ga0070700_100038543 3300005441 Bacteria 2913
92 Ga0070700_100982256 3300005441 Bacteria 693
93 Ga0070663_100122120 3300005455 Bacteria 1969
94 Ga0070663_100485559 3300005455 Bacteria 1023
95 Ga0070678_100001706 3300005456 Bacteria 11799
96 Ga0070678_100446090 3300005456 Bacteria 1133
97 Ga0070662_100106107 3300005457 Bacteria 2133
98 Ga0068867_100004255 3300005459 Bacteria 10073
99 Ga0068867_100079565 3300005459 Bacteria 2467
100 Ga0068867_100987525 3300005459 Bacteria 763
101 Ga0070679_101126552 3300005530 Bacteria 729
102 Ga0070684_100005545 3300005535 Bacteria 9684
103 Ga0070684_100548730 3300005535 Bacteria 1072
104 Ga0068853_100282417 3300005539 Bacteria 1530
105 Ga0068853_100336097 3300005539 Bacteria 1403
106 Ga0068853_100482508 3300005539 Bacteria 1169
107 Ga0070672_100009342 3300005543 Bacteria 6754
108 Ga0070672_100010541 3300005543 Bacteria 6414
109 Ga0070672_100205615 3300005543 Bacteria 1647
110 Ga0070672_100409992 3300005543 Bacteria 1162
111 Ga0070695_100410240 3300005545 Bacteria 1029
112 Ga0070693_100100735 3300005547 Bacteria 1759
113 Ga0068855_100000557 3300005563 Bacteria 45786
114 Ga0068855_100009023 3300005563 Bacteria 12049
115 Ga0068855_100027441 3300005563 Bacteria 6810
116 Ga0068855_100827487 3300005563 Bacteria 982
117 Ga0070664_100020556 3300005564 Bacteria 5436
118 Ga0070664_100096849 3300005564 Bacteria 2561
119 Ga0070664_100111261 3300005564 Bacteria 2390
120 Ga0070664_100193987 3300005564 Bacteria 1810
121 Ga0068857_100013457 3300005577 Bacteria 7126
122 Ga0068857_101315633 3300005577 Bacteria 702
123 Ga0068854_100000054 3300005578 Bacteria 84435
124 Ga0068854_100235699 3300005578 Bacteria 1455
125 Ga0068856_100144590 3300005614 Bacteria 2385
126 Ga0068856_100902215 3300005614 Bacteria 903
127 Ga0070702_100928410 3300005615 Bacteria 683
128 Ga0070702_100969993 3300005615 Bacteria 671
129 Ga0068852_100566344 3300005616 Bacteria 1138
130 Ga0068859_100325510 3300005617 Bacteria 1631
131 Ga0068859_101103405 3300005617 Bacteria 873
132 Ga0068864_100059273 3300005618 Bacteria 3311
133 Ga0068864_100257580 3300005618 Bacteria 1622
134 Ga0068864_100806571 3300005618 Bacteria 923
135 Ga0068866_10010553 3300005718 Bacteria 3965
136 Ga0068866_10378732 3300005718 Bacteria 907
137 Ga0068861_100003049 3300005719 Bacteria 11062
138 Ga0068861_100006599 3300005719 Bacteria 7918
139 Ga0068851_10019685 3300005834 Bacteria 3263
140 Ga0068863_100074984 3300005841 Bacteria 3201
141 Ga0068863_100296172 3300005841 Bacteria 1569
142 Ga0068863_100693806 3300005841 Bacteria 1012
143 Ga0068863_101096238 3300005841 Bacteria 801
144 Ga0068858_100541377 3300005842 Bacteria 1127
145 Ga0068858_100949215 3300005842 Bacteria 842
146 Ga0068860_100004998 3300005843 Bacteria 13512
147 Ga0068860_100240302 3300005843 Bacteria 1761
148 Ga0068862_100072016 3300005844 Bacteria 2985
149 Ga0068862_100102941 3300005844 Bacteria 2500
150 Ga0075368_10254408 3300006042 Bacteria 751
151 Ga0075363_100051072 3300006048 Bacteria 2204
152 Ga0075364_10152316 3300006051 Bacteria 1558
153 Ga0075432_10062752 3300006058 Bacteria 1326
154 Ga0075362_10007518 3300006177 Bacteria 4130
155 Ga0075362_10112917 3300006177 Bacteria 1280
156 Ga0075369_10116449 3300006186 Bacteria 1207
157 Ga0075366_10011855 3300006195 Bacteria 4932
158 Ga0075366_10121666 3300006195 Bacteria 1573
159 Ga0075366_10417142 3300006195 Bacteria 827
160 Ga0097621_100019420 3300006237 Bacteria 5215
161 Ga0097621_100027470 3300006237 Bacteria 4475
162 Ga0075370_10002921 3300006353 Bacteria 8031
163 Ga0075370_10004114 3300006353 Bacteria 7009
164 Ga0075370_10009981 3300006353 Bacteria 4949
165 Ga0075370_10186863 3300006353 Bacteria 1220
166 Ga0075370_10312715 3300006353 Bacteria 935
167 Ga0068871_100040501 3300006358 Bacteria 3731
168 Ga0068871_100434357 3300006358 Bacteria 1174
169 Ga0075430_100543998 3300006846 Bacteria 958
170 Ga0068865_100004612 3300006881 Bacteria 8321
171 Ga0097620_100325483 3300006931 Bacteria 1631
172 Ga0097620_101103557 3300006931 Bacteria 873
173 Ga0105244_10022162 3300009036 Bacteria 3498
174 Ga0105240_10041264 3300009093 Bacteria 5892
175 Ga0105240_10176421 3300009093 Bacteria 2526
176 Ga0105240_10755085 3300009093 Bacteria 1057
177 Ga0111539_10078852 3300009094 Bacteria 3873
178 Ga0111539_10420615 3300009094 Bacteria 1556
179 Ga0105245_10071877 3300009098 Bacteria 3142
180 Ga0105245_12490765 3300009098 Bacteria 571
181 Ga0105247_10107539 3300009101 Bacteria 1791
182 Ga0105248_10142710 3300009177 Bacteria 2702
183 Ga0105248_10292627 3300009177 Bacteria 1834
184 Ga0105248_10378080 3300009177 Bacteria 1595
185 Ga0105248_10401178 3300009177 Bacteria 1544
186 Ga0105237_10028309 3300009545 Bacteria 5709
187 Ga0105237_10104756 3300009545 Bacteria 2820
188 Ga0105238_10074057 3300009551 Bacteria 3398
189 Ga0105238_10079054 3300009551 Bacteria 3278
190 Ga0105238_10550934 3300009551 Bacteria 1158
191 Ga0105239_10886089 3300010375 Bacteria 1024
192 Ga0157373_10323525 3300013100 Bacteria 1097
193 Ga0157371_10149126 3300013102 Bacteria 1667
194 Ga0157370_10024804 3300013104 Bacteria 5937
195 Ga0157370_10082622 3300013104 Bacteria 3021
196 Ga0157370_10816387 3300013104 Bacteria 848
197 Ga0157370_11091654 3300013104 Bacteria 721
198 Ga0157369_10269500 3300013105 Bacteria 1774
199 Ga0157374_10005044 3300013296 Bacteria 11075
200 Ga0157374_10014248 3300013296 Bacteria 6953
201 Ga0157374_10114617 3300013296 Bacteria 2595
202 Ga0157374_10152900 3300013296 Bacteria 2244
203 Ga0157378_10015098 3300013297 Bacteria 6760
204 Ga0157378_10633558 3300013297 Bacteria 1083
205 Ga0163162_10005279 3300013306 Bacteria 12465
206 Ga0163162_10160195 3300013306 Bacteria 2372
207 Ga0163162_10384544 3300013306 Bacteria 1537
208 Ga0163162_11682808 3300013306 Bacteria 724
209 Ga0163162_11916346 3300013306 Bacteria 678
210 Ga0157372_10038778 3300013307 Bacteria 5258
211 Ga0157372_10053836 3300013307 Bacteria 4487
212 Ga0157375_10001449 3300013308 Bacteria 20400
213 Ga0157375_10642021 3300013308 Bacteria 1218
214 Ga0157375_10918574 3300013308 Bacteria 1018
215 Ga0163163_10026023 3300014325 Bacteria 5587
216 Ga0163163_10612352 3300014325 Bacteria 1152
217 Ga0163163_11060730 3300014325 Bacteria 873
218 Ga0182008_10009806 3300014497 Bacteria 5153
219 Ga0157377_10020376 3300014745 Bacteria 3473
220 Ga0157377_10049289 3300014745 Bacteria 2367
221 Ga0157379_10039193 3300014968 Bacteria 4227
222 Ga0157379_10409677 3300014968 Bacteria 1247
223 Ga0157379_11046843 3300014968 Bacteria 780
224 Ga0157376_10062869 3300014969 Bacteria 3125
225 Ga0157376_10146612 3300014969 Bacteria 2124
226 Ga0157376_11474270 3300014969 Bacteria 713
227 Ga0182006_1101622 3300015261 Bacteria 1020
228 Ga0183360_10002 3300015689 Bacteria 953821
229 Ga0163161_10037395 3300017792 Bacteria 3480
230 Ga0163161_10104378 3300017792 Bacteria 2113
231 Ga0163161_10629547 3300017792 Bacteria 887
232 Ga0163161_10770943 3300017792 Bacteria 806
233 Ga0209436_103839 3300025208 Bacteria 3849
234 Ga0209674_100014 3300025226 Bacteria 704989
235 Ga0209674_100039 3300025226 Bacteria 402292
236 Ga0209563_100110 3300025230 Bacteria 142518
237 Ga0209563_113760 3300025230 Bacteria 1057
238 Ga0207427_102251 3300025231 Bacteria 5411
239 Ga0207425_1001058 3300025245 Bacteria 12702
240 Ga0209677_100151 3300025253 Bacteria 63642
241 Ga0209759_1002704 3300025256 Bacteria 7560
242 Ga0209129_1011522 3300025258 Bacteria 2103
243 Ga0209565_1000001 3300025263 Bacteria 2950419
244 Ga0209565_1000715 3300025263 Bacteria 20127
245 Ga0209565_1001682 3300025263 Bacteria 9177
246 Ga0209673_1000001 3300025273 Bacteria 3176258
247 Ga0209673_1031221 3300025273 Bacteria 1661
248 Ga0209673_1041159 3300025273 Bacteria 1315
249 Ga0209130_1000202 3300025284 Bacteria 80333
250 Ga0209130_1019365 3300025284 Bacteria 1579
251 Ga0209675_1000001 3300025291 Bacteria 2950293
252 Ga0209675_1001344 3300025291 Bacteria 14518
253 Ga0209675_1001827 3300025291 Bacteria 11609
254 Ga0209675_1009899 3300025291 Bacteria 3313
255 Ga0209676_1024661 3300025292 Bacteria 1942
256 Ga0209025_1000008 3300025294 Bacteria 1130876
257 Ga0209025_1002511 3300025294 Bacteria 19206
258 Ga0209025_1014325 3300025294 Bacteria 4889
259 Ga0209025_1047426 3300025294 Bacteria 1754
260 Ga0209564_1000001 3300025295 Bacteria 3176258
261 Ga0209564_1000049 3300025295 Bacteria 362075
262 Ga0209564_1041766 3300025295 Bacteria 1226
263 Ga0209758_1049721 3300025297 Bacteria 1477
264 Ga0209050_1004979 3300025298 Bacteria 8645
265 Ga0209256_1000006 3300025299 Bacteria 1250310
266 Ga0209256_1000014 3300025299 Bacteria 687409
267 Ga0207426_1000145 3300025302 Bacteria 191065
268 Ga0209257_1007844 3300025304 Bacteria 6303
269 Ga0207697_10029375 3300025315 Bacteria 2250
270 Ga0207656_10237648 3300025321 Bacteria 889
271 Ga0207656_10376132 3300025321 Bacteria 712
272 Ga0207696_1031516 3300025711 Bacteria 1603
273 Ga0207655_1026871 3300025728 Bacteria 2755
274 Ga0207713_1055262 3300025735 Bacteria 1551
275 Ga0207682_10011620 3300025893 Bacteria 3440
276 Ga0207688_10014298 3300025901 Bacteria 4319
277 Ga0207688_10265002 3300025901 Bacteria 1044
278 Ga0207688_10428542 3300025901 Bacteria 823
279 Ga0207645_10010376 3300025907 Bacteria 6394
280 Ga0207645_10210049 3300025907 Bacteria 1282
281 Ga0207643_10135149 3300025908 Bacteria 1470
282 Ga0207705_10018657 3300025909 Bacteria 4961
283 Ga0207705_10169706 3300025909 Bacteria 1642
284 Ga0207695_10781901 3300025913 Bacteria 835
285 Ga0207695_10798367 3300025913 Bacteria 824
286 Ga0207671_10132077 3300025914 Bacteria 1917
287 Ga0207671_10133942 3300025914 Bacteria 1904
288 Ga0207660_10008583 3300025917 Bacteria 6610
289 Ga0207660_10606994 3300025917 Bacteria 891
290 Ga0207657_10008125 3300025919 Bacteria 10700
291 Ga0207657_10015410 3300025919 Bacteria 7404
292 Ga0207657_10041456 3300025919 Bacteria 4070
293 Ga0207657_10063799 3300025919 Bacteria 3147
294 Ga0207657_10133216 3300025919 Bacteria 2035
295 Ga0207657_10321636 3300025919 Bacteria 1223
296 Ga0207649_10678676 3300025920 Bacteria 798
297 Ga0207649_11006988 3300025920 Bacteria 656
298 Ga0207681_10032402 3300025923 Bacteria 3421
299 Ga0207681_10042853 3300025923 Bacteria 3026
300 Ga0207681_10059547 3300025923 Bacteria 2618
301 Ga0207681_10193700 3300025923 Bacteria 1557
302 Ga0207694_10004583 3300025924 Bacteria 10769
303 Ga0207694_10401792 3300025924 Bacteria 1139
304 Ga0207650_10007016 3300025925 Bacteria 7685
305 Ga0207650_10011973 3300025925 Bacteria 5979
306 Ga0207650_10416344 3300025925 Bacteria 1114
307 Ga0207659_10007489 3300025926 Bacteria 6716
308 Ga0207659_10377058 3300025926 Bacteria 1182
309 Ga0207659_10649221 3300025926 Bacteria 902
310 Ga0207687_10532649 3300025927 Bacteria 984
311 Ga0207664_10025854 3300025929 Bacteria 4429
312 Ga0207644_10039506 3300025931 Bacteria 3331
313 Ga0207690_10023767 3300025932 Bacteria 3830
314 Ga0207690_10049880 3300025932 Bacteria 2792
315 Ga0207690_10110381 3300025932 Bacteria 1980
316 Ga0207690_10689691 3300025932 Bacteria 839
317 Ga0207706_10000377 3300025933 Bacteria 48494
318 Ga0207706_10271971 3300025933 Bacteria 1478
319 Ga0207706_10489415 3300025933 Bacteria 1062
320 Ga0207686_10163158 3300025934 Bacteria 1564
321 Ga0207670_10004663 3300025936 Bacteria 7430
322 Ga0207669_10006834 3300025937 Bacteria 5246
323 Ga0207704_10002130 3300025938 Bacteria 8874
324 Ga0207691_10001087 3300025940 Bacteria 27045
325 Ga0207691_10017913 3300025940 Bacteria 6712
326 Ga0207691_10066542 3300025940 Bacteria 3260
327 Ga0207691_10069635 3300025940 Bacteria 3178
328 Ga0207691_10173395 3300025940 Bacteria 1888
329 Ga0207691_10701883 3300025940 Bacteria 853
330 Ga0207711_10028975 3300025941 Bacteria 4665
331 Ga0207689_10000312 3300025942 Bacteria 44850
332 Ga0207661_10220419 3300025944 Bacteria 1676
333 Ga0207679_10118564 3300025945 Bacteria 2102
334 Ga0207679_10430411 3300025945 Bacteria 1166
335 Ga0207679_11140853 3300025945 Bacteria 715
336 Ga0207679_11467432 3300025945 Bacteria 626
337 Ga0207667_10000062 3300025949 Bacteria 190422
338 Ga0207667_10014452 3300025949 Bacteria 9000
339 Ga0207667_10124236 3300025949 Bacteria 2659
340 Ga0207667_10329064 3300025949 Bacteria 1560
341 Ga0207667_10459970 3300025949 Bacteria 1292
342 Ga0207667_11398262 3300025949 Bacteria 673
343 Ga0207651_10004049 3300025960 Bacteria 7300
344 Ga0207651_10006137 3300025960 Bacteria 6248
345 Ga0207651_10069966 3300025960 Bacteria 2480
346 Ga0207712_10211137 3300025961 Bacteria 1546
347 Ga0207668_10003807 3300025972 Bacteria 8889
348 Ga0207668_10025498 3300025972 Bacteria 3827
349 Ga0207640_10000022 3300025981 Bacteria 167526
350 Ga0207640_10417242 3300025981 Bacteria 1097
351 Ga0207658_10092952 3300025986 Bacteria 2344
352 Ga0207658_10585579 3300025986 Bacteria 1001
353 Ga0207658_11101495 3300025986 Bacteria 725
354 Ga0207677_10014689 3300026023 Bacteria 4582
355 Ga0207703_10316055 3300026035 Bacteria 1429
356 Ga0207703_10878048 3300026035 Bacteria 858
357 Ga0207639_10028948 3300026041 Bacteria 4050
358 Ga0207639_10236220 3300026041 Bacteria 1587
359 Ga0207639_10780721 3300026041 Bacteria 889
360 Ga0207678_10015906 3300026067 Bacteria 6610
361 Ga0207678_10068028 3300026067 Bacteria 3056
362 Ga0207678_10189412 3300026067 Bacteria 1758
363 Ga0207708_10047022 3300026075 Bacteria 3287
364 Ga0207702_10930754 3300026078 Bacteria 861
365 Ga0207641_10005319 3300026088 Bacteria 10991
366 Ga0207641_10223664 3300026088 Bacteria 1747
367 Ga0207648_10002883 3300026089 Bacteria 18211
368 Ga0207648_10105675 3300026089 Bacteria 2470
369 Ga0207648_10354638 3300026089 Bacteria 1323
370 Ga0207676_10015577 3300026095 Bacteria 5488
371 Ga0207676_10653995 3300026095 Bacteria 1014
372 Ga0207674_10004125 3300026116 Bacteria 17573
373 Ga0207674_10120585 3300026116 Bacteria 2591
374 Ga0207675_100000484 3300026118 Bacteria 38611
375 Ga0207675_100098057 3300026118 Bacteria 2760
376 Ga0207683_10028823 3300026121 Bacteria 4804
377 Ga0207683_10068898 3300026121 Bacteria 3124
378 Ga0207698_10135407 3300026142 Bacteria 2113
379 Ga0207698_10299062 3300026142 Bacteria 1497
380 Ga0207698_10476213 3300026142 Bacteria 1210
381 Ga0209813_10427011 3300027866 Bacteria 538
382 Ga0207428_10408270 3300027907 Bacteria 994
383 Ga0268266_10267412 3300028379 Bacteria 1586
384 Ga0268265_10005260 3300028380 Bacteria 8858
385 Ga0268264_10092018 3300028381 Bacteria 2617
386 Ga0265336_10000010 3300028666 Bacteria 277947
387 Ga0307517_10362783 3300028786 Bacteria 782
388 Ga0307515_10773987 3300028794 Bacteria 580
389 Ga0265324_10001918 3300029957 Bacteria 11166
390 Ga0265328_10023123 3300031239 Bacteria 2359
391 Ga0265331_10001794 3300031250 Bacteria 15294
392 Ga0265327_10000035 3300031251 Bacteria 314419
393 Ga0307513_10002924 3300031456 Bacteria 23356
394 Ga0307408_100001343 3300031548 Bacteria 18435
395 Ga0307408_101885909 3300031548 Bacteria 573
396 Ga0307516_10000414 3300031730 Bacteria 55918
397 Ga0307516_10098574 3300031730 Bacteria 2741
398 Ga0307413_10378574 3300031824 Bacteria 1102
399 Ga0307406_10126661 3300031901 Bacteria 1786
400 Ga0307407_10428405 3300031903 Bacteria 955
401 Ga0307412_10719979 3300031911 Bacteria 858
402 Ga0307416_102062651 3300032002 Bacteria 672
403 Ga0307414_10143666 3300032004 Bacteria 1872
404 Ga0307414_10316368 3300032004 Bacteria 1327
405 Ga0307411_10760013 3300032005 Bacteria 850
406 Ga0373934_0089134 3300035086 Bacteria 1243
407 Ga0373940_0178108 3300035088 Bacteria 690
408 Ga0373944_0011729 3300035089 Bacteria 2405
409 Ga0373960_0149668 3300035121 Bacteria 796
410 Ga0373931_0002297 3300035691 Bacteria 8449
411 Ga0373931_0069220 3300035691 Bacteria 1923
412 Ga0373931_0257880 3300035691 Bacteria 1063
413 Ga0373927_0015547 3300035695 Bacteria 5027
414 Ga0373925_0005471 3300037068 Bacteria 9455
415 Ga0373925_0523925 3300037068 Bacteria 974
416 Ga0395898_0100671 3300037466 Bacteria 2775
417 Ga0395905_0758475 3300037471 Bacteria 873
418 Ga0436364_0315105 3300037853 Bacteria 1139
419 Ga0436364_0513231 3300037853 Bacteria 893
420 Ga0395901_0006003 3300038443 Bacteria 12303
421 Ga0395901_0506109 3300038443 Bacteria 1229
422 Ga0439439_0067088 3300041406 Bacteria 958
423 Ga0439447_000358 3300041407 Bacteria 16566
424 Ga0439453_0016610 3300041408 Bacteria 1285
425 Ga0451787_603998 3300041441 Bacteria 563
426 Ga0451789_1110718 3300041443 Bacteria 833
427 Ga0451793_0837470 3300041452 Bacteria 2282
428 Ga0451800_0379387 3300041459 Bacteria 971
429 Ga0451804_0978710 3300041463 Bacteria 962
430 Ga0451807_0221148 3300041486 Bacteria 1049
431 Ga0451849_0693586 3300041505 Bacteria 1352
432 Ga0451853_2526807 3300041512 Bacteria 846
433 Ga0450898_008446 3300042134 Bacteria 1625
434 Ga0450903_000708 3300042138 Bacteria 6634
435 Ga0450893_0009900 3300042532 Bacteria 1560
436 Ga0451577_0127603 3300042876 Bacteria 2280
437 Ga0466965_0070068 3300044683 Bacteria 1762
438 Ga0466963_0420326 3300044694 Bacteria 943
439 Ga0453684_0001907 3300044712 Bacteria 54115
440 Ga0451576_0155907 3300045051 Bacteria 2382
441 Ga0495617_002342 3300046452 Bacteria 7599
442 Ga0495592_0030903 3300046454 Bacteria 4051
443 Ga0495603_0005347 3300046455 Bacteria 7660
444 Ga0495590_0005444 3300046457 Bacteria 5053
445 Ga0495591_001925 3300046458 Bacteria 12176
446 Ga0495629_0083677 3300046459 Bacteria 2227
447 Ga0495629_0116301 3300046459 Bacteria 1864
448 Ga0495638_0208016 3300046460 Bacteria 1100
449 Ga0495653_0026095 3300046463 Bacteria 4689
450 Ga0495650_0003373 3300046471 Bacteria 11701
451 Ga0495605_0001792 3300046474 Bacteria 13780
452 Ga0495584_0021626 3300046491 Bacteria 3266
453 Ga0495585_0002387 3300046492 Bacteria 13468
454 Ga0495585_0003550 3300046492 Bacteria 10475
455 Ga0495607_0035702 3300046501 Bacteria 3004
456 Ga0495583_0048231 3300046506 Bacteria 1955
457 Ga0495610_0019865 3300046512 Bacteria 3745
458 Ga0495616_0088322 3300046513 Bacteria 1471
459 Ga0495616_0094174 3300046513 Bacteria 1413
460 Ga0495628_0063187 3300046516 Bacteria 2901
461 Ga0495631_0002606 3300046518 Bacteria 10080
462 Ga0495632_0001099 3300046519 Bacteria 23165
463 Ga0495632_0007523 3300046519 Bacteria 6825
464 Ga0495637_0007043 3300046520 Bacteria 5599
465 Ga0495643_0021242 3300046522 Bacteria 3727
466 Ga0495644_0047350 3300046523 Bacteria 1615
467 Ga0495644_0146595 3300046523 Bacteria 902
468 Ga0495648_0188691 3300046524 Bacteria 1041
469 Ga0495648_0188962 3300046524 Bacteria 1040
470 Ga0495642_0000415 3300046528 Bacteria 22842
471 Ga0495642_0022979 3300046528 Bacteria 2460
472 Ga0495654_0051871 3300046530 Bacteria 2000
473 Ga0495665_0380762 3300046531 Bacteria 717
474 Ga0495640_0027391 3300046533 Bacteria 4111
475 Ga0495586_0102952 3300046535 Bacteria 1585
476 Ga0495587_0000190 3300046536 Bacteria 45240
477 Ga0495609_0001763 3300046538 Bacteria 13897
478 Ga0495609_0093097 3300046538 Bacteria 1309
479 Ga0495597_0030641 3300046542 Bacteria 2450
480 Ga0495597_0124504 3300046542 Bacteria 1072
481 Ga0495622_0001288 3300046557 Bacteria 12869
482 Ga0495622_0027356 3300046557 Bacteria 2662
483 Ga0495622_0084328 3300046557 Bacteria 1461
484 Ga0495656_0030780 3300046615 Bacteria 2171
485 Ga0495656_0249341 3300046615 Bacteria 896
486 Ga0495668_0377480 3300046616 Bacteria 778
487 Ga0495634_0001714 3300046642 Bacteria 19026
488 Ga0495634_0283130 3300046642 Bacteria 1006
489 Ga0495611_0033499 3300046648 Bacteria 2267
490 Ga0495625_0087225 3300046660 Bacteria 2163
491 Ga0495625_0132768 3300046660 Bacteria 1685
492 Ga0495635_0000350 3300046663 Bacteria 29321
493 Ga0495661_0177388 3300046665 Bacteria 1131
494 Ga0495588_0015425 3300046674 Bacteria 3677
495 Ga0495588_0118185 3300046674 Bacteria 1397
496 Ga0495623_0000943 3300046679 Bacteria 19601
497 Ga0495646_0000790 3300046680 Bacteria 17703
498 Ga0495646_0003348 3300046680 Bacteria 9963
499 Ga0495647_0100292 3300046681 Bacteria 1198
500 Ga0495658_0057510 3300046683 Bacteria 2222
501 Ga0495669_0005909 3300046684 Bacteria 5101
502 Ga0495669_0154975 3300046684 Bacteria 1085
503 Ga0495613_0088680 3300046689 Bacteria 2241
504 Ga0495670_0030514 3300046691 Bacteria 2677
505 Ga0495670_0041789 3300046691 Bacteria 2288
506 Ga0495671_0002591 3300046692 Bacteria 11374
507 Ga0495671_0090853 3300046692 Bacteria 1494
508 Ga0495671_0404444 3300046692 Bacteria 653
509 Ga0495649_0035434 3300046694 Bacteria 2745
510 Ga0495589_0036578 3300046794 Bacteria 2460
511 Ga0495660_0060106 3300046810 Bacteria 2042
512 Ga0495660_0179410 3300046810 Bacteria 1025
513 Ga0495674_0013811 3300047319 Bacteria 7579
514 Ga0495672_0103464 3300047320 Bacteria 1540
515 Ga0495676_0095568 3300047321 Bacteria 2211
516 Ga0495680_0046363 3300047322 Bacteria 3427
517 Ga0495683_0144893 3300047323 Bacteria 1110
518 Ga0495675_0003809 3300047444 Bacteria 9133
519 Ga0495677_0001204 3300047445 Bacteria 10364
520 Ga0495677_0036075 3300047445 Bacteria 1805
521 Ga0495685_014601 3300047447 Bacteria 2670
522 Ga0495673_0001372 3300047469 Bacteria 19678
523 Ga0495673_0022361 3300047469 Bacteria 3101
524 Ga0495673_0120106 3300047469 Bacteria 1041
525 Ga0495681_0002913 3300047470 Bacteria 12093
526 Ga0495681_0121745 3300047470 Bacteria 1119
527 Ga0495593_0070663 3300047673 Bacteria 1813
528 Ga0495593_0098503 3300047673 Bacteria 1501
529 Ga0496100_0016146 3300048903 Bacteria 4378
530 Ga0496102_0000821 3300048905 Bacteria 30135
531 Ga0496102_0262216 3300048905 Bacteria 1629
532 Ga0496103_0001316 3300048906 Bacteria 16847
533 Ga0496104_0222530 3300048907 Bacteria 1800
534 Ga0496104_0748819 3300048907 Bacteria 884
535 Ga0496105_0020731 3300048908 Bacteria 5314
536 Ga0496105_0410507 3300048908 Bacteria 1074
537 Ga0496106_0107708 3300048909 Bacteria 2167
538 Ga0496107_0658980 3300048910 Bacteria 771
539 Ga0496108_0033870 3300048911 Bacteria 4243
540 Ga0496108_1171137 3300048911 Bacteria 651
541 Ga0496109_0067738 3300048912 Bacteria 3271
542 Ga0496110_0113356 3300048913 Bacteria 2438
543 Ga0496110_0175764 3300048913 Bacteria 1943
544 Ga0496110_0226727 3300048913 Bacteria 1699
545 Ga0496111_0063457 3300048914 Bacteria 2679
546 Ga0496113_0343318 3300048916 Bacteria 1197
547 Ga0496114_0146173 3300048917 Bacteria 2049
548 Ga0496115_0004304 3300048918 Bacteria 10306
549 Ga0496115_0321587 3300048918 Bacteria 1265
550 Ga0496115_0792429 3300048918 Bacteria 738
551 Ga0496116_0011895 3300048919 Bacteria 7159
552 Ga0496117_0013466 3300048920 Bacteria 7133
553 Ga0496117_0013650 3300048920 Bacteria 7068
554 Ga0496118_0003083 3300048921 Bacteria 21369
555 Ga0496118_0004488 3300048921 Bacteria 16523
556 Ga0496121_0001221 3300048924 Bacteria 44771
557 Ga0496121_0321052 3300048924 Bacteria 1042
558 Ga0496124_0241392 3300048927 Bacteria 1343
559 Ga0496125_0014795 3300048928 Bacteria 7579
560 Ga0496126_0000134 3300048929 Bacteria 169693
561 Ga0496126_0094223 3300048929 Bacteria 2628
562 Ga0495678_176468 3300049459 Bacteria 672
563 Ga0495682_0002634 3300049460 Bacteria 8392
564 Ga0495682_0110363 3300049460 Bacteria 985
565 Ga0501036_0011020 3300049572 Bacteria 7478
566 Ga0501037_0021408 3300049573 Bacteria 4778
567 Ga0501043_0005420 3300049579 Bacteria 10310
568 Ga0501046_0202587 3300049580 Bacteria 1476
569 Ga0501239_007749 3300049672 Bacteria 1132
570 Ga0501241_017980 3300049758 Bacteria 1294
571 Ga0501044_0009893 3300049823 Bacteria 10363
572 nmdc:mga03683_141319_c1 3300050489 Bacteria 1082
573 nmdc:mga0k408_104369_c1 3300050493 Bacteria 1673
574 nmdc:mga0k408_127377_c1 3300050493 Bacteria 1510
575 nmdc:mga0k408_1391_c2 3300050493 Bacteria 12211
576 nmdc:mga0k408_258090_c1 3300050493 Bacteria 1041
577 nmdc:mga06z11_25701_c1 3300050494 Bacteria 2794
578 nmdc:mga07m45_1397_c1 3300050496 Bacteria 11030
579 nmdc:mga07m45_218_c2 3300050496 Bacteria 22025
580 nmdc:mga07m45_228436_c1 3300050496 Bacteria 1083
581 nmdc:mga07m45_5866_c1 3300050496 Bacteria 6164
582 nmdc:mga09592_736429_c1 3300050508 Bacteria 837
583 nmdc:mga0qj67_314293_c1 3300050509 Bacteria 1268
584 nmdc:mga0n895_680479_c1 3300050512 Bacteria 1026
585 nmdc:mga0sz30_7459_c1 3300050516 Bacteria 4102
586 Ga0500555_140833 3300053103 Bacteria 594
587 2588291836 2588253510 Bacteria 6901809
588 Ga0451577_0114088
589 JGI24737J22298_10056301
590 JGI25156J39149_1009741
591 JGI25152J39213_1013807
592 JGI25150J39212_1002186
593 JGI25159J45721_1000166
594 JGI25159J45721_1040528
595 JGI25151J46595_10001854
596 JGI25151J46595_10029968
597 JGI25160J50197_1000352
598 JGI25161J50226_1000268
599 Ga0055539_1000521
600 Ga0055533_1000073
601 Ga0055533_1000805
602 Ga0055525_1002058
603 Ga0055526_1000015
604 Ga0055526_1000802
605 Ga0055537_1000053
606 Ga0055524_1000020
607 Ga0055524_1000059
608 Ga0055534_1000017
609 Ga0055534_1004910
610 Ga0055528_1000008
611 Ga0055543_1000361
612 Ga0065165_1004330
613 Ga0065714_10000625
614 Ga0065714_10004677
615 Ga0065714_10017235
616 Ga0065714_10106783
617 Ga0065714_10493790
618 Ga0065704_10214136
619 Ga0065715_10059901
620 Ga0065715_10111326
621 Ga0065715_10533244
622 Ga0065707_10013027
623 Ga0065707_10095187
624 Ga0070658_10010248
625 Ga0070658_10029811
626 Ga0070658_10055328
627 Ga0070676_10132855
628 Ga0070683_100001582
629 Ga0070683_100091563
630 Ga0070690_100181988
631 Ga0070690_100427305
632 Ga0070670_100045953
633 Ga0070670_100047703
634 Ga0070677_10467642
635 Ga0068869_100010901
636 Ga0070666_10110394
637 Ga0070680_100000041
638 Ga0070680_100131720
639 Ga0068868_100004978
640 Ga0068868_101140604
641 Ga0070660_100010221
642 Ga0070660_100165522
643 Ga0070660_100419115
644 Ga0070689_100023905
645 Ga0070661_100006146
646 Ga0070661_100435245
647 Ga0070661_100520883
648 Ga0070661_100960164
649 Ga0070668_100026333
650 Ga0070668_101330100
651 Ga0070669_100016215
652 Ga0070669_100039483
653 Ga0070669_100429310
654 Ga0070675_100004394
655 Ga0070675_100007321
656 Ga0070675_100018914
657 Ga0070675_100028447
658 Ga0070675_100207935
659 Ga0070675_100704322
660 Ga0070671_100007061
661 Ga0070674_100002771
662 Ga0070673_100008183
663 Ga0070673_100036119
664 Ga0070673_100164912
665 Ga0070673_100599499
666 Ga0070688_100006764
667 Ga0070659_100035370
668 Ga0070659_100049641
669 Ga0070659_100182942
670 Ga0070659_100612650
671 Ga0070659_100790481
672 Ga0070667_100014655
673 Ga0070667_100130592
674 Ga0070667_100214261
675 Ga0070667_100265847
676 Ga0070714_100007323
677 Ga0070711_100006250
678 Ga0070700_100038543
679 Ga0070700_100982256
680 Ga0070663_100122120
681 Ga0070663_100485559
682 Ga0070678_100001706
683 Ga0070678_100446090
684 Ga0070662_100106107
685 Ga0068867_100004255
686 Ga0068867_100079565
687 Ga0068867_100987525
688 Ga0070679_101126552
689 Ga0070684_100005545
690 Ga0070684_100548730
691 Ga0068853_100282417
692 Ga0068853_100336097
693 Ga0068853_100482508
694 Ga0070672_100009342
695 Ga0070672_100010541
696 Ga0070672_100205615
697 Ga0070672_100409992
698 Ga0070695_100410240
699 Ga0070693_100100735
700 Ga0068855_100000557
701 Ga0068855_100009023
702 Ga0068855_100027441
703 Ga0068855_100827487
704 Ga0070664_100020556
705 Ga0070664_100096849
706 Ga0070664_100111261
707 Ga0070664_100193987
708 Ga0068857_100013457
709 Ga0068857_101315633
710 Ga0068854_100000054
711 Ga0068854_100235699
712 Ga0068856_100144590
713 Ga0068856_100902215
714 Ga0070702_100928410
715 Ga0070702_100969993
716 Ga0068852_100566344
717 Ga0068859_100325510
718 Ga0068859_101103405
719 Ga0068864_100059273
720 Ga0068864_100257580
721 Ga0068864_100806571
722 Ga0068866_10010553
723 Ga0068866_10378732
724 Ga0068861_100003049
725 Ga0068861_100006599
726 Ga0068851_10019685
727 Ga0068863_100074984
728 Ga0068863_100296172
729 Ga0068863_100693806
730 Ga0068863_101096238
731 Ga0068858_100541377
732 Ga0068858_100949215
733 Ga0068860_100004998
734 Ga0068860_100240302
735 Ga0068862_100072016
736 Ga0068862_100102941
737 Ga0075368_10254408
738 Ga0075363_100051072
739 Ga0075364_10152316
740 Ga0075432_10062752
741 Ga0075362_10007518
742 Ga0075362_10112917
743 Ga0075369_10116449
744 Ga0075366_10011855
745 Ga0075366_10121666
746 Ga0075366_10417142
747 Ga0097621_100019420
748 Ga0097621_100027470
749 Ga0075370_10002921
750 Ga0075370_10004114
751 Ga0075370_10009981
752 Ga0075370_10186863
753 Ga0075370_10312715
754 Ga0068871_100040501
755 Ga0068871_100434357
756 Ga0075430_100543998
757 Ga0068865_100004612
758 Ga0097620_100325483
759 Ga0097620_101103557
760 Ga0105244_10022162
761 Ga0105240_10041264
762 Ga0105240_10176421
763 Ga0105240_10755085
764 Ga0111539_10078852
765 Ga0111539_10420615
766 Ga0105245_10071877
767 Ga0105245_12490765
768 Ga0105247_10107539
769 Ga0105248_10142710
770 Ga0105248_10292627
771 Ga0105248_10378080
772 Ga0105248_10401178
773 Ga0105237_10028309
774 Ga0105237_10104756
775 Ga0105238_10074057
776 Ga0105238_10079054
777 Ga0105238_10550934
778 Ga0105239_10886089
779 Ga0157373_10323525
780 Ga0157371_10149126
781 Ga0157370_10024804
782 Ga0157370_10082622
783 Ga0157370_10816387
784 Ga0157370_11091654
785 Ga0157369_10269500
786 Ga0157374_10005044
787 Ga0157374_10014248
788 Ga0157374_10114617
789 Ga0157374_10152900
790 Ga0157378_10015098
791 Ga0157378_10633558
792 Ga0163162_10005279
793 Ga0163162_10160195
794 Ga0163162_10384544
795 Ga0163162_11682808
796 Ga0163162_11916346
797 Ga0157372_10038778
798 Ga0157372_10053836
799 Ga0157375_10001449
800 Ga0157375_10642021
801 Ga0157375_10918574
802 Ga0163163_10026023
803 Ga0163163_10612352
804 Ga0163163_11060730
805 Ga0182008_10009806
806 Ga0157377_10020376
807 Ga0157377_10049289
808 Ga0157379_10039193
809 Ga0157379_10409677
810 Ga0157379_11046843
811 Ga0157376_10062869
812 Ga0157376_10146612
813 Ga0157376_11474270
814 Ga0182006_1101622
815 Ga0183360_10002
816 Ga0163161_10037395
817 Ga0163161_10104378
818 Ga0163161_10629547
819 Ga0163161_10770943
820 Ga0209436_103839
821 Ga0209674_100014
822 Ga0209674_100039
823 Ga0209563_100110
824 Ga0209563_113760
825 Ga0207427_102251
826 Ga0207425_1001058
827 Ga0209677_100151
828 Ga0209759_1002704
829 Ga0209129_1011522
830 Ga0209565_1000001
831 Ga0209565_1000715
832 Ga0209565_1001682
833 Ga0209673_1000001
834 Ga0209673_1031221
835 Ga0209673_1041159
836 Ga0209130_1000202
837 Ga0209130_1019365
838 Ga0209675_1000001
839 Ga0209675_1001344
840 Ga0209675_1001827
841 Ga0209675_1009899
842 Ga0209676_1024661
843 Ga0209025_1000008
844 Ga0209025_1002511
845 Ga0209025_1014325
846 Ga0209025_1047426
847 Ga0209564_1000001
848 Ga0209564_1000049
849 Ga0209564_1041766
850 Ga0209758_1049721
851 Ga0209050_1004979
852 Ga0209256_1000006
853 Ga0209256_1000014
854 Ga0207426_1000145
855 Ga0209257_1007844
856 Ga0207697_10029375
857 Ga0207656_10237648
858 Ga0207656_10376132
859 Ga0207696_1031516
860 Ga0207655_1026871
861 Ga0207713_1055262
862 Ga0207682_10011620
863 Ga0207688_10014298
864 Ga0207688_10265002
865 Ga0207688_10428542
866 Ga0207645_10010376
867 Ga0207645_10210049
868 Ga0207643_10135149
869 Ga0207705_10018657
870 Ga0207705_10169706
871 Ga0207695_10781901
872 Ga0207695_10798367
873 Ga0207671_10132077
874 Ga0207671_10133942
875 Ga0207660_10008583
876 Ga0207660_10606994
877 Ga0207657_10008125
878 Ga0207657_10015410
879 Ga0207657_10041456
880 Ga0207657_10063799
881 Ga0207657_10133216
882 Ga0207657_10321636
883 Ga0207649_10678676
884 Ga0207649_11006988
885 Ga0207681_10032402
886 Ga0207681_10042853
887 Ga0207681_10059547
888 Ga0207681_10193700
889 Ga0207694_10004583
890 Ga0207694_10401792
891 Ga0207650_10007016
892 Ga0207650_10011973
893 Ga0207650_10416344
894 Ga0207659_10007489
895 Ga0207659_10377058
896 Ga0207659_10649221
897 Ga0207687_10532649
898 Ga0207664_10025854
899 Ga0207644_10039506
900 Ga0207690_10023767
901 Ga0207690_10049880
902 Ga0207690_10110381
903 Ga0207690_10689691
904 Ga0207706_10000377
905 Ga0207706_10271971
906 Ga0207706_10489415
907 Ga0207686_10163158
908 Ga0207670_10004663
909 Ga0207669_10006834
910 Ga0207704_10002130
911 Ga0207691_10001087
912 Ga0207691_10017913
913 Ga0207691_10066542
914 Ga0207691_10069635
915 Ga0207691_10173395
916 Ga0207691_10701883
917 Ga0207711_10028975
918 Ga0207689_10000312
919 Ga0207661_10220419
920 Ga0207679_10118564
921 Ga0207679_10430411
922 Ga0207679_11140853
923 Ga0207679_11467432
924 Ga0207667_10000062
925 Ga0207667_10014452
926 Ga0207667_10124236
927 Ga0207667_10329064
928 Ga0207667_10459970
929 Ga0207667_11398262
930 Ga0207651_10004049
931 Ga0207651_10006137
932 Ga0207651_10069966
933 Ga0207712_10211137
934 Ga0207668_10003807
935 Ga0207668_10025498
936 Ga0207640_10000022
937 Ga0207640_10417242
938 Ga0207658_10092952
939 Ga0207658_10585579
940 Ga0207658_11101495
941 Ga0207677_10014689
942 Ga0207703_10316055
943 Ga0207703_10878048
944 Ga0207639_10028948
945 Ga0207639_10236220
946 Ga0207639_10780721
947 Ga0207678_10015906
948 Ga0207678_10068028
949 Ga0207678_10189412
950 Ga0207708_10047022
951 Ga0207702_10930754
952 Ga0207641_10005319
953 Ga0207641_10223664
954 Ga0207648_10002883
955 Ga0207648_10105675
956 Ga0207648_10354638
957 Ga0207676_10015577
958 Ga0207676_10653995
959 Ga0207674_10004125
960 Ga0207674_10120585
961 Ga0207675_100000484
962 Ga0207675_100098057
963 Ga0207683_10028823
964 Ga0207683_10068898
965 Ga0207698_10135407
966 Ga0207698_10299062
967 Ga0207698_10476213
968 Ga0209813_10427011
969 Ga0207428_10408270
970 Ga0268266_10267412
971 Ga0268265_10005260
972 Ga0268264_10092018
973 Ga0265336_10000010
974 Ga0307517_10362783
975 Ga0307515_10773987
976 Ga0265324_10001918
977 Ga0265328_10023123
978 Ga0265331_10001794
979 Ga0265327_10000035
980 Ga0307513_10002924
981 Ga0307408_100001343
982 Ga0307408_101885909
983 Ga0307516_10000414
984 Ga0307516_10098574
985 Ga0307413_10378574
986 Ga0307406_10126661
987 Ga0307407_10428405
988 Ga0307412_10719979
989 Ga0307416_102062651
990 Ga0307414_10143666
991 Ga0307414_10316368
992 Ga0307411_10760013
993 Ga0373934_0089134
994 Ga0373940_0178108
995 Ga0373944_0011729
996 Ga0373960_0149668
997 Ga0373931_0002297
998 Ga0373931_0069220
999 Ga0373931_0257880
1000 Ga0373927_0015547
1001 Ga0373925_0005471
1002 Ga0373925_0523925
1003 Ga0395898_0100671
1004 Ga0395905_0758475
1005 Ga0436364_0315105
1006 Ga0436364_0513231
1007 Ga0395901_0006003
1008 Ga0395901_0506109
1009 Ga0439439_0067088
1010 Ga0439447_000358
1011 Ga0439453_0016610
1012 Ga0451787_603998
1013 Ga0451789_1110718
1014 Ga0451793_0837470
1015 Ga0451800_0379387
1016 Ga0451804_0978710
1017 Ga0451807_0221148
1018 Ga0451849_0693586
1019 Ga0451853_2526807
1020 Ga0450898_008446
1021 Ga0450903_000708
1022 Ga0450893_0009900
1023 Ga0451577_0127603
1024 Ga0466965_0070068
1025 Ga0466963_0420326
1026 Ga0453684_0001907
1027 Ga0451576_0155907
1028 Ga0495617_002342
1029 Ga0495592_0030903
1030 Ga0495603_0005347
1031 Ga0495590_0005444
1032 Ga0495591_001925
1033 Ga0495629_0083677
1034 Ga0495629_0116301
1035 Ga0495638_0208016
1036 Ga0495653_0026095
1037 Ga0495650_0003373
1038 Ga0495605_0001792
1039 Ga0495584_0021626
1040 Ga0495585_0002387
1041 Ga0495585_0003550
1042 Ga0495607_0035702
1043 Ga0495583_0048231
1044 Ga0495610_0019865
1045 Ga0495616_0088322
1046 Ga0495616_0094174
1047 Ga0495628_0063187
1048 Ga0495631_0002606
1049 Ga0495632_0001099
1050 Ga0495632_0007523
1051 Ga0495637_0007043
1052 Ga0495643_0021242
1053 Ga0495644_0047350
1054 Ga0495644_0146595
1055 Ga0495648_0188691
1056 Ga0495648_0188962
1057 Ga0495642_0000415
1058 Ga0495642_0022979
1059 Ga0495654_0051871
1060 Ga0495665_0380762
1061 Ga0495640_0027391
1062 Ga0495586_0102952
1063 Ga0495587_0000190
1064 Ga0495609_0001763
1065 Ga0495609_0093097
1066 Ga0495597_0030641
1067 Ga0495597_0124504
1068 Ga0495622_0001288
1069 Ga0495622_0027356
1070 Ga0495622_0084328
1071 Ga0495656_0030780
1072 Ga0495656_0249341
1073 Ga0495668_0377480
1074 Ga0495634_0001714
1075 Ga0495634_0283130
1076 Ga0495611_0033499
1077 Ga0495625_0087225
1078 Ga0495625_0132768
1079 Ga0495635_0000350
1080 Ga0495661_0177388
1081 Ga0495588_0015425
1082 Ga0495588_0118185
1083 Ga0495623_0000943
1084 Ga0495646_0000790
1085 Ga0495646_0003348
1086 Ga0495647_0100292
1087 Ga0495658_0057510
1088 Ga0495669_0005909
1089 Ga0495669_0154975
1090 Ga0495613_0088680
1091 Ga0495670_0030514
1092 Ga0495670_0041789
1093 Ga0495671_0002591
1094 Ga0495671_0090853
1095 Ga0495671_0404444
1096 Ga0495649_0035434
1097 Ga0495589_0036578
1098 Ga0495660_0060106
1099 Ga0495660_0179410
1100 Ga0495674_0013811
1101 Ga0495672_0103464
1102 Ga0495676_0095568
1103 Ga0495680_0046363
1104 Ga0495683_0144893
1105 Ga0495675_0003809
1106 Ga0495677_0001204
1107 Ga0495677_0036075
1108 Ga0495685_014601
1109 Ga0495673_0001372
1110 Ga0495673_0022361
1111 Ga0495673_0120106
1112 Ga0495681_0002913
1113 Ga0495681_0121745
1114 Ga0495593_0070663
1115 Ga0495593_0098503
1116 Ga0496100_0016146
1117 Ga0496102_0000821
1118 Ga0496102_0262216
1119 Ga0496103_0001316
1120 Ga0496104_0222530
1121 Ga0496104_0748819
1122 Ga0496105_0020731
1123 Ga0496105_0410507
1124 Ga0496106_0107708
1125 Ga0496107_0658980
1126 Ga0496108_0033870
1127 Ga0496108_1171137
1128 Ga0496109_0067738
1129 Ga0496110_0113356
1130 Ga0496110_0175764
1131 Ga0496110_0226727
1132 Ga0496111_0063457
1133 Ga0496113_0343318
1134 Ga0496114_0146173
1135 Ga0496115_0004304
1136 Ga0496115_0321587
1137 Ga0496115_0792429
1138 Ga0496116_0011895
1139 Ga0496117_0013466
1140 Ga0496117_0013650
1141 Ga0496118_0003083
1142 Ga0496118_0004488
1143 Ga0496121_0001221
1144 Ga0496121_0321052
1145 Ga0496124_0241392
1146 Ga0496125_0014795
1147 Ga0496126_0000134
1148 Ga0496126_0094223
1149 Ga0495678_176468
1150 Ga0495682_0002634
1151 Ga0495682_0110363
1152 Ga0501036_0011020
1153 Ga0501037_0021408
1154 Ga0501043_0005420
1155 Ga0501046_0202587
1156 Ga0501239_007749
1157 Ga0501241_017980
1158 Ga0501044_0009893
1159 nmdc:mga03683_141319_c1
1160 nmdc:mga0k408_104369_c1
1161 nmdc:mga0k408_127377_c1
1162 nmdc:mga0k408_1391_c2
1163 nmdc:mga0k408_258090_c1
1164 nmdc:mga06z11_25701_c1
1165 nmdc:mga07m45_1397_c1
1166 nmdc:mga07m45_218_c2
1167 nmdc:mga07m45_228436_c1
1168 nmdc:mga07m45_5866_c1
1169 nmdc:mga09592_736429_c1
1170 nmdc:mga0qj67_314293_c1
1171 nmdc:mga0n895_680479_c1
1172 nmdc:mga0sz30_7459_c1
1173 Ga0500555_140833
1174 2588291836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

42

158

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tsj-assembly1.cif.gz_A crystal structure of protein from staphylococcus aureus 0.7887 1 120
1tsj-assembly1.cif.gz_A crystal structure of protein from staphylococcus aureus 0.7575 1 120
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.6726 7 122
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.6533 7 122
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.6437 5 122
ID Description Score Start End Superfamily
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8777 81 122 3.30.720.110
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8542 81 122 3.30.720.110
af_P0AG24_192_325_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7164 76 122 3.30.460.10
1tsjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7108 1 120 3.10.180.10
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.6864 10 76 3.30.720.100
ID Description Score Start End GO Terms
AF-A0A4Q6GFM2-F1-model_v4 deleted 1.008 84 161
AF-A0A534H6Z1-F1-model_v4 VOC family protein 1.007 81 161
AF-A0A4Q3P670-F1-model_v4 deleted 0.9995 86 161
AF-A0A6J7U880-F1-model_v4 Unannotated protein 0.9957 81 159
AF-A0A3D3I036-F1-model_v4 PhnB-like domain-containing protein 0.9939 107 161

Map