F466704

General Info

Members Datasets Scaffolds Average Seq Length
587 292 575 208

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0120719|Ga0495672_0120719_481_1131
Length 216
Sequence MTVAAPSGVQPSEPTADASNGVPVRTASAVWVLIAGVVGLAAAITLTIEKIEILINPDYVPSCSINPVLSCGSVMVTAQASAFGFPNPLIGIVSFSVVVVTGVLALAKVRLPRWYWAGLAAGTALGVVFIHWLIFQSLYRIGALCPYCMVVWAVTITLLVVAASIVFRPVLAERQNRTGALARVLFQWRWSITTLWFTAVFLLIMVRFWNYWSTLI

Samples

Sample ID Description Type Environment
1 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
2 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
3 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
4 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
5 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
6 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
7 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
8 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
9 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
10 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
11 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
12 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
13 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
187 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
188 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
189 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
190 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
191 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
192 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
193 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
194 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
223 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
273 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
284 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
285 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
286 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
287 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
288 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
289 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
290 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
291 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
292 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 0
Isolates 2.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.87
Nodule 0.17
Rhizoplane 9.37
Rhizosphere 65.59
Stem 0
Stem Tuber 0
Unclassified 8.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1002588 3300001977 Bacteria 2871
2 JGI24739J22299_10077915 3300001989 Bacteria 1021
3 JGI24743J22301_10007510 3300001991 Bacteria 1893
4 JGI24745J21846_1008156 3300002073 Bacteria 1178
5 JGI24744J21845_10000417 3300002077 Bacteria 7426
6 JGI24744J21845_10002763 3300002077 Bacteria 3584
7 JGI24742J22300_10001347 3300002244 Bacteria 3859
8 JGI24751J29686_10014159 3300002459 Bacteria 1647
9 Ga0055540_1006531 3300003792 Bacteria 4607
10 Ga0055540_1016834 3300003792 Bacteria 2061
11 Ga0070683_100182357 3300005329 Bacteria 1993
12 Ga0070683_100266624 3300005329 Bacteria 1629
13 Ga0070690_100085420 3300005330 Bacteria 2070
14 Ga0068869_100036242 3300005334 Bacteria 3502
15 Ga0068869_100066679 3300005334 Bacteria 2653
16 Ga0068869_100667599 3300005334 Bacteria 884
17 Ga0070666_10117361 3300005335 Bacteria 1843
18 Ga0070682_100016495 3300005337 Bacteria 4295
19 Ga0070682_100124311 3300005337 Bacteria 1736
20 Ga0068868_100000294 3300005338 Bacteria 33573
21 Ga0070689_100033159 3300005340 Bacteria 3933
22 Ga0070689_100129329 3300005340 Bacteria 2024
23 Ga0070691_10003749 3300005341 Bacteria 6865
24 Ga0070661_100174589 3300005344 Bacteria 1633
25 Ga0070692_10086713 3300005345 Bacteria 1695
26 Ga0070692_10310778 3300005345 Bacteria 965
27 Ga0070668_100013156 3300005347 Bacteria 6169
28 Ga0070669_100066978 3300005353 Bacteria 2648
29 Ga0070675_100165691 3300005354 Bacteria 1903
30 Ga0070671_100001875 3300005355 Bacteria 16075
31 Ga0070671_100048100 3300005355 Bacteria 3546
32 Ga0070671_100111611 3300005355 Bacteria 2297
33 Ga0070674_100003497 3300005356 Bacteria 8824
34 Ga0070674_100023332 3300005356 Bacteria 4003
35 Ga0070673_100047735 3300005364 Bacteria 3333
36 Ga0070673_100327149 3300005364 Bacteria 1355
37 Ga0070688_100007721 3300005365 Bacteria 5810
38 Ga0070688_100131348 3300005365 Bacteria 1690
39 Ga0070667_100000063 3300005367 Bacteria 138777
40 Ga0070667_100002143 3300005367 Bacteria 17374
41 Ga0070667_100284503 3300005367 Bacteria 1486
42 Ga0070667_100450926 3300005367 Bacteria 1175
43 Ga0070667_100620005 3300005367 Bacteria 997
44 Ga0070709_10011544 3300005434 Bacteria 4927
45 Ga0070714_100129578 3300005435 Bacteria 2253
46 Ga0070714_100247045 3300005435 Bacteria 1649
47 Ga0070714_100956396 3300005435 Bacteria 833
48 Ga0070713_100043765 3300005436 Bacteria 3663
49 Ga0070710_10000220 3300005437 Bacteria 26520
50 Ga0070701_10008181 3300005438 Bacteria 4509
51 Ga0070711_100000969 3300005439 Bacteria 15186
52 Ga0070711_100003252 3300005439 Bacteria 9443
53 Ga0070705_100026022 3300005440 Bacteria 3181
54 Ga0070705_100062434 3300005440 Bacteria 2218
55 Ga0070700_100000463 3300005441 Bacteria 20347
56 Ga0070700_100084647 3300005441 Bacteria 2055
57 Ga0070663_100131424 3300005455 Bacteria 1901
58 Ga0070663_100356904 3300005455 Bacteria 1185
59 Ga0070678_100000347 3300005456 Bacteria 21660
60 Ga0070678_100136573 3300005456 Bacteria 1956
61 Ga0070662_100025409 3300005457 Bacteria 4089
62 Ga0070662_100076347 3300005457 Bacteria 2483
63 Ga0068867_100001344 3300005459 Bacteria 17014
64 Ga0070685_10032504 3300005466 Bacteria 2923
65 Ga0068853_100014069 3300005539 Bacteria 6549
66 Ga0068853_100019567 3300005539 Bacteria 5616
67 Ga0068853_100860947 3300005539 Bacteria 869
68 Ga0070672_100067460 3300005543 Bacteria 2835
69 Ga0070672_100910950 3300005543 Bacteria 777
70 Ga0070686_100171429 3300005544 Bacteria 1535
71 Ga0070696_100006998 3300005546 Bacteria 7527
72 Ga0070696_100112297 3300005546 Bacteria 1963
73 Ga0070693_100009863 3300005547 Bacteria 4764
74 Ga0070665_100005170 3300005548 Bacteria 13500
75 Ga0070665_100018371 3300005548 Bacteria 7009
76 Ga0070704_100000118 3300005549 Bacteria 28378
77 Ga0068855_100048751 3300005563 Bacteria 4998
78 Ga0068855_100271557 3300005563 Bacteria 1885
79 Ga0068857_100909141 3300005577 Bacteria 844
80 Ga0068854_100000777 3300005578 Bacteria 18943
81 Ga0068854_100096492 3300005578 Bacteria 2209
82 Ga0068856_100223850 3300005614 Bacteria 1896
83 Ga0070702_100000798 3300005615 Bacteria 12021
84 Ga0070702_100259662 3300005615 Bacteria 1182
85 Ga0068859_100004969 3300005617 Bacteria 13509
86 Ga0068859_100033321 3300005617 Bacteria 5173
87 Ga0068859_100621609 3300005617 Bacteria 1173
88 Ga0068864_100219695 3300005618 Bacteria 1753
89 Ga0068864_100254813 3300005618 Bacteria 1630
90 Ga0068864_100535731 3300005618 Bacteria 1130
91 Ga0068866_10000197 3300005718 Bacteria 28297
92 Ga0068861_100000102 3300005719 Bacteria 42240
93 Ga0068861_100101593 3300005719 Bacteria 2288
94 Ga0068851_10250174 3300005834 Bacteria 1005
95 Ga0068870_10144949 3300005840 Bacteria 1393
96 Ga0068863_100000159 3300005841 Bacteria 71831
97 Ga0068863_100002339 3300005841 Bacteria 18841
98 Ga0068858_100001068 3300005842 Bacteria 28330
99 Ga0068858_100089329 3300005842 Bacteria 2867
100 Ga0068858_100227734 3300005842 Bacteria 1767
101 Ga0068860_100000065 3300005843 Bacteria 186634
102 Ga0068860_100000663 3300005843 Bacteria 39893
103 Ga0068862_100000028 3300005844 Bacteria 184197
104 Ga0068862_100009162 3300005844 Bacteria 8197
105 Ga0068862_100049464 3300005844 Bacteria 3590
106 Ga0068862_100884730 3300005844 Bacteria 877
107 Ga0081455_10029010 3300005937 Bacteria 5048
108 Ga0081455_10126738 3300005937 Bacteria 2002
109 Ga0075365_10005499 3300006038 Bacteria 6839
110 Ga0075365_10018637 3300006038 Bacteria 4272
111 Ga0075365_10036912 3300006038 Bacteria 3169
112 Ga0075365_10074962 3300006038 Bacteria 2283
113 Ga0075365_10263500 3300006038 Bacteria 1212
114 Ga0075365_10273246 3300006038 Bacteria 1189
115 Ga0075365_10319744 3300006038 Bacteria 1093
116 Ga0075368_10020156 3300006042 Bacteria 2522
117 Ga0075368_10100214 3300006042 Bacteria 1189
118 Ga0075363_100000310 3300006048 Bacteria 14352
119 Ga0075363_100005680 3300006048 Bacteria 5582
120 Ga0075363_100008479 3300006048 Bacteria 4789
121 Ga0075363_100020253 3300006048 Bacteria 3334
122 Ga0075363_100056757 3300006048 Bacteria 2100
123 Ga0075363_100065187 3300006048 Bacteria 1969
124 Ga0075363_100283530 3300006048 Bacteria 959
125 Ga0075363_100484127 3300006048 Bacteria 733
126 Ga0075364_10001023 3300006051 Bacteria 14840
127 Ga0075364_10004805 3300006051 Bacteria 7818
128 Ga0075364_10014566 3300006051 Bacteria 4861
129 Ga0075364_10015287 3300006051 Bacteria 4759
130 Ga0075364_10033220 3300006051 Bacteria 3321
131 Ga0075364_10035758 3300006051 Bacteria 3210
132 Ga0075364_10048046 3300006051 Bacteria 2780
133 Ga0075364_10053477 3300006051 Bacteria 2639
134 Ga0075364_10059770 3300006051 Bacteria 2499
135 Ga0075364_10120429 3300006051 Bacteria 1756
136 Ga0075364_10321797 3300006051 Bacteria 1053
137 Ga0070715_10002672 3300006163 Bacteria 5520
138 Ga0070715_10030598 3300006163 Bacteria 2178
139 Ga0070716_100000479 3300006173 Bacteria 16547
140 Ga0070716_100002564 3300006173 Bacteria 8405
141 Ga0070712_100000901 3300006175 Bacteria 17767
142 Ga0070712_100041807 3300006175 Bacteria 3149
143 Ga0075362_10021169 3300006177 Bacteria 2725
144 Ga0075362_10055389 3300006177 Bacteria 1784
145 Ga0075362_10057041 3300006177 Bacteria 1759
146 Ga0075367_10139194 3300006178 Bacteria 1503
147 Ga0075369_10001003 3300006186 Bacteria 9402
148 Ga0075369_10003320 3300006186 Bacteria 5844
149 Ga0075369_10009039 3300006186 Bacteria 3857
150 Ga0075369_10042117 3300006186 Bacteria 1957
151 Ga0075369_10049955 3300006186 Bacteria 1807
152 Ga0075369_10052159 3300006186 Bacteria 1773
153 Ga0075369_10078887 3300006186 Bacteria 1458
154 Ga0075370_10000764 3300006353 Bacteria 12869
155 Ga0075370_10011914 3300006353 Bacteria 4581
156 Ga0075370_10026349 3300006353 Bacteria 3220
157 Ga0075370_10044644 3300006353 Bacteria 2505
158 Ga0075428_100005745 3300006844 Bacteria 13782
159 Ga0075430_100014131 3300006846 Bacteria 6807
160 Ga0068865_100000554 3300006881 Bacteria 20777
161 Ga0097620_100004970 3300006931 Bacteria 13509
162 Ga0097620_100033322 3300006931 Bacteria 5173
163 Ga0097620_100621711 3300006931 Bacteria 1173
164 Ga0105250_10022796 3300009092 Bacteria 2523
165 Ga0105250_10097473 3300009092 Bacteria 1199
166 Ga0105245_10000172 3300009098 Bacteria 61572
167 Ga0105245_10739184 3300009098 Bacteria 1019
168 Ga0105247_10000910 3300009101 Bacteria 22259
169 Ga0105247_10002035 3300009101 Bacteria 14006
170 Ga0105247_10013582 3300009101 Bacteria 4883
171 Ga0114129_10062195 3300009147 Bacteria 5216
172 Ga0105243_10060775 3300009148 Bacteria 3019
173 Ga0105241_10056757 3300009174 Bacteria 3002
174 Ga0105241_10164353 3300009174 Bacteria 1828
175 Ga0105241_10404668 3300009174 Bacteria 1198
176 Ga0105242_10001106 3300009176 Bacteria 21246
177 Ga0105242_10080594 3300009176 Bacteria 2721
178 Ga0105248_10000074 3300009177 Bacteria 114554
179 Ga0105248_10002067 3300009177 Bacteria 22238
180 Ga0105248_10240389 3300009177 Bacteria 2038
181 Ga0105248_10368436 3300009177 Bacteria 1617
182 Ga0105237_10017185 3300009545 Bacteria 7505
183 Ga0105237_10126811 3300009545 Bacteria 2547
184 Ga0105237_10399246 3300009545 Bacteria 1380
185 Ga0105237_10501906 3300009545 Bacteria 1220
186 Ga0105238_10204763 3300009551 Bacteria 1949
187 Ga0105238_11526090 3300009551 Bacteria 697
188 Ga0105249_10000011 3300009553 Bacteria 292812
189 Ga0105249_10000817 3300009553 Bacteria 28085
190 Ga0105249_10181471 3300009553 Bacteria 2048
191 Ga0105249_10948394 3300009553 Bacteria 928
192 Ga0105239_10061339 3300010375 Bacteria 4127
193 Ga0105239_10115788 3300010375 Bacteria 2974
194 Ga0105239_10189273 3300010375 Bacteria 2303
195 Ga0105246_10040128 3300011119 Bacteria 3157
196 Ga0157371_10091246 3300013102 Bacteria 2158
197 Ga0157369_10055936 3300013105 Bacteria 4258
198 Ga0157378_10017478 3300013297 Bacteria 6295
199 Ga0163162_10002629 3300013306 Bacteria 17028
200 Ga0157380_10000237 3300014326 Bacteria 33183
201 Ga0157380_10263651 3300014326 Bacteria 1566
202 Ga0157377_10097343 3300014745 Bacteria 1747
203 Ga0157379_10003146 3300014968 Bacteria 13969
204 Ga0157379_10037773 3300014968 Bacteria 4307
205 Ga0157379_10104072 3300014968 Bacteria 2548
206 Ga0157376_10061156 3300014969 Bacteria 3165
207 Ga0163161_10001434 3300017792 Bacteria 17596
208 Ga0163161_10549706 3300017792 Bacteria 946
209 Ga0213876_10009574 3300021384 Bacteria 5212
210 Ga0213876_10017444 3300021384 Bacteria 3791
211 Ga0213876_10127377 3300021384 Bacteria 1353
212 Ga0213875_10033104 3300021388 Bacteria 2441
213 Ga0209673_1010888 3300025273 Bacteria 3796
214 Ga0209025_1032975 3300025294 Bacteria 2407
215 Ga0209051_1002890 3300025303 Bacteria 11797
216 Ga0209051_1010174 3300025303 Bacteria 4783
217 Ga0209051_1018172 3300025303 Bacteria 3119
218 Ga0207692_10000823 3300025898 Bacteria 11109
219 Ga0207692_10036131 3300025898 Bacteria 2406
220 Ga0207642_10004093 3300025899 Bacteria 4673
221 Ga0207642_10189145 3300025899 Bacteria 1128
222 Ga0207710_10000014 3300025900 Bacteria 408072
223 Ga0207710_10018541 3300025900 Bacteria 2961
224 Ga0207710_10158015 3300025900 Bacteria 1103
225 Ga0207688_10004880 3300025901 Bacteria 7302
226 Ga0207688_10006959 3300025901 Bacteria 6154
227 Ga0207647_10026240 3300025904 Bacteria 3815
228 Ga0207685_10002092 3300025905 Bacteria 4463
229 Ga0207685_10024419 3300025905 Bacteria 2072
230 Ga0207699_10021462 3300025906 Bacteria 3481
231 Ga0207643_10067096 3300025908 Bacteria 2058
232 Ga0207654_10245479 3300025911 Bacteria 1198
233 Ga0207654_10264409 3300025911 Bacteria 1158
234 Ga0207707_10598349 3300025912 Bacteria 933
235 Ga0207671_10023448 3300025914 Bacteria 4654
236 Ga0207671_10373050 3300025914 Bacteria 1133
237 Ga0207693_10000049 3300025915 Bacteria 100347
238 Ga0207693_10000258 3300025915 Bacteria 48916
239 Ga0207693_10056705 3300025915 Bacteria 3071
240 Ga0207663_10025829 3300025916 Bacteria 3402
241 Ga0207657_10054879 3300025919 Bacteria 3444
242 Ga0207649_10554221 3300025920 Bacteria 880
243 Ga0207681_10165726 3300025923 Bacteria 1670
244 Ga0207681_10629375 3300025923 Bacteria 888
245 Ga0207687_10011764 3300025927 Bacteria 5726
246 Ga0207687_10501963 3300025927 Bacteria 1013
247 Ga0207700_10495787 3300025928 Bacteria 1080
248 Ga0207664_10278946 3300025929 Bacteria 1466
249 Ga0207644_10006697 3300025931 Bacteria 7504
250 Ga0207644_10477060 3300025931 Bacteria 1027
251 Ga0207706_10012474 3300025933 Bacteria 7743
252 Ga0207706_10013178 3300025933 Bacteria 7524
253 Ga0207686_10021782 3300025934 Bacteria 3683
254 Ga0207686_10356022 3300025934 Bacteria 1103
255 Ga0207709_10009668 3300025935 Bacteria 5312
256 Ga0207670_10125308 3300025936 Bacteria 1873
257 Ga0207669_10004112 3300025937 Bacteria 6375
258 Ga0207704_10008654 3300025938 Bacteria 4878
259 Ga0207665_10003396 3300025939 Bacteria 10656
260 Ga0207711_10000149 3300025941 Bacteria 74062
261 Ga0207711_10043146 3300025941 Bacteria 3846
262 Ga0207711_10674530 3300025941 Bacteria 964
263 Ga0207689_10010339 3300025942 Bacteria 8040
264 Ga0207661_10068788 3300025944 Bacteria 2885
265 Ga0207679_10799713 3300025945 Bacteria 860
266 Ga0207667_10605637 3300025949 Bacteria 1104
267 Ga0207651_10119787 3300025960 Bacteria 1994
268 Ga0207651_10301798 3300025960 Bacteria 1332
269 Ga0207712_10000020 3300025961 Bacteria 292796
270 Ga0207712_10001309 3300025961 Bacteria 17057
271 Ga0207712_10217453 3300025961 Bacteria 1526
272 Ga0207668_10004346 3300025972 Bacteria 8322
273 Ga0207668_10072025 3300025972 Bacteria 2471
274 Ga0207668_10372958 3300025972 Bacteria 1199
275 Ga0207640_10027713 3300025981 Bacteria 3455
276 Ga0207640_10481791 3300025981 Bacteria 1029
277 Ga0207658_10004224 3300025986 Bacteria 10004
278 Ga0207658_10012013 3300025986 Bacteria 5906
279 Ga0207658_10110321 3300025986 Bacteria 2173
280 Ga0207658_10239894 3300025986 Bacteria 1535
281 Ga0207658_10584000 3300025986 Bacteria 1002
282 Ga0207677_10002239 3300026023 Bacteria 10159
283 Ga0207677_10089710 3300026023 Bacteria 2232
284 Ga0207703_10080290 3300026035 Bacteria 2716
285 Ga0207639_10005576 3300026041 Bacteria 8513
286 Ga0207639_10009918 3300026041 Bacteria 6580
287 Ga0207678_10006306 3300026067 Bacteria 10532
288 Ga0207678_10358792 3300026067 Bacteria 1258
289 Ga0207708_10000411 3300026075 Bacteria 33673
290 Ga0207708_10033920 3300026075 Bacteria 3880
291 Ga0207702_10118088 3300026078 Bacteria 2369
292 Ga0207641_10000156 3300026088 Bacteria 97171
293 Ga0207641_10007452 3300026088 Bacteria 9101
294 Ga0207641_10272550 3300026088 Bacteria 1588
295 Ga0207648_10000187 3300026089 Bacteria 65094
296 Ga0207648_10009745 3300026089 Bacteria 9181
297 Ga0207676_10116369 3300026095 Bacteria 2246
298 Ga0207676_10482481 3300026095 Bacteria 1174
299 Ga0207675_100000220 3300026118 Bacteria 53425
300 Ga0207675_100016473 3300026118 Bacteria 6903
301 Ga0207683_10000197 3300026121 Bacteria 52074
302 Ga0207683_10002676 3300026121 Bacteria 15573
303 Ga0207698_10080095 3300026142 Bacteria 2630
304 Ga0207698_10206503 3300026142 Bacteria 1764
305 Ga0209813_10008026 3300027866 Bacteria 2652
306 Ga0268266_10004901 3300028379 Bacteria 12694
307 Ga0268266_10637130 3300028379 Bacteria 1025
308 Ga0268265_10000004 3300028380 Bacteria 648376
309 Ga0268265_10096725 3300028380 Bacteria 2374
310 Ga0268265_10200168 3300028380 Bacteria 1732
311 Ga0268265_10220989 3300028380 Bacteria 1657
312 Ga0268264_10000024 3300028381 Bacteria 470081
313 Ga0268264_10012371 3300028381 Bacteria 7024
314 Ga0268264_10222512 3300028381 Bacteria 1738
315 Ga0307408_100824006 3300031548 Bacteria 844
316 Ga0307405_10034536 3300031731 Bacteria 3010
317 Ga0307413_10010632 3300031824 Bacteria 4480
318 Ga0307406_10012091 3300031901 Bacteria 4912
319 Ga0307406_10132015 3300031901 Bacteria 1755
320 Ga0307416_100019016 3300032002 Bacteria 4859
321 Ga0307415_100078432 3300032126 Bacteria 2349
322 Ga0373960_0038294 3300035121 Bacteria 1374
323 Ga0373961_0037370 3300035241 Bacteria 1387
324 Ga0373962_0066401 3300035242 Bacteria 1070
325 Ga0373931_0014544 3300035691 Bacteria 3849
326 Ga0373931_0015526 3300035691 Bacteria 3737
327 Ga0316584_0030529 3300036712 Bacteria 3980
328 Ga0395905_0724660 3300037471 Bacteria 897
329 Ga0436364_0618027 3300037853 Bacteria 743
330 Ga0436364_1537251 3300037853 Bacteria 8180
331 Ga0436365_0117277 3300039437 Bacteria 1056
332 Ga0436365_0302347 3300039437 Bacteria 26430
333 Ga0436365_0449497 3300039437 Bacteria 32186
334 Ga0436365_0663981 3300039437 Bacteria 13268
335 Ga0436365_1674159 3300039437 Bacteria 2359
336 Ga0436361_0986788 3300039447 Bacteria 1103
337 Ga0436363_0232937 3300039450 Bacteria 3944
338 Ga0439461_0001137 3300041410 Bacteria 4036
339 Ga0439466_0001598 3300041411 Bacteria 8850
340 Ga0439466_0004976 3300041411 Bacteria 5100
341 Ga0439466_0007060 3300041411 Bacteria 4253
342 Ga0439466_0059303 3300041411 Bacteria 1236
343 Ga0439465_0002454 3300041413 Bacteria 6061
344 Ga0439465_0005477 3300041413 Bacteria 4053
345 Ga0439465_0007147 3300041413 Bacteria 3548
346 Ga0439465_0085086 3300041413 Bacteria 1076
347 Ga0451793_1653830 3300041452 Bacteria 1001
348 Ga0451855_0291276 3300041511 Bacteria 899
349 Ga0439431_0002349 3300041997 Bacteria 4183
350 Ga0439442_001306 3300042002 Bacteria 4950
351 Ga0439445_0000376 3300042004 Bacteria 8956
352 Ga0439450_011778 3300042008 Bacteria 1721
353 Ga0439434_0029062 3300042435 Bacteria 1675
354 Ga0466969_0212156 3300044656 Bacteria 882
355 Ga0466972_0005939 3300044658 Bacteria 6130
356 Ga0466972_0066425 3300044658 Bacteria 1724
357 Ga0466965_0008928 3300044683 Bacteria 4648
358 Ga0466965_0035075 3300044683 Bacteria 2456
359 Ga0466966_0034127 3300044684 Bacteria 3292
360 Ga0466966_0055207 3300044684 Bacteria 2515
361 Ga0466961_0031532 3300044693 Bacteria 3408
362 Ga0466963_0177313 3300044694 Bacteria 1487
363 Ga0466963_0638556 3300044694 Bacteria 751
364 Ga0466964_0027845 3300044706 Bacteria 2222
365 Ga0466968_0005039 3300044735 Bacteria 4947
366 Ga0466968_0008274 3300044735 Bacteria 3979
367 Ga0466968_0020735 3300044735 Bacteria 2656
368 Ga0466968_0057535 3300044735 Bacteria 1671
369 Ga0466970_0028028 3300044765 Bacteria 2958
370 Ga0466970_0056098 3300044765 Bacteria 2105
371 Ga0466970_0126701 3300044765 Bacteria 1400
372 Ga0466970_0419851 3300044765 Bacteria 765
373 Ga0466957_0001674 3300044842 Bacteria 11647
374 Ga0466957_0062419 3300044842 Bacteria 2288
375 Ga0466957_0135238 3300044842 Bacteria 1583
376 Ga0466957_0153307 3300044842 Bacteria 1492
377 Ga0466957_0187280 3300044842 Bacteria 1354
378 Ga0466957_0318794 3300044842 Bacteria 1048
379 Ga0466960_0013309 3300044901 Bacteria 3493
380 Ga0466960_0016953 3300044901 Bacteria 3168
381 Ga0466960_0091704 3300044901 Bacteria 1550
382 Ga0466960_0096933 3300044901 Bacteria 1512
383 Ga0466959_0007885 3300045049 Bacteria 7496
384 Ga0466959_0008665 3300045049 Bacteria 7199
385 Ga0466959_0029585 3300045049 Bacteria 4058
386 Ga0466958_0002368 3300045836 Bacteria 9439
387 Ga0466958_0031537 3300045836 Bacteria 3150
388 Ga0466958_0035940 3300045836 Bacteria 2962
389 Ga0466958_0038741 3300045836 Bacteria 2861
390 Ga0466958_0068230 3300045836 Bacteria 2174
391 Ga0466958_0072806 3300045836 Bacteria 2105
392 Ga0466967_0011995 3300045976 Bacteria 6602
393 Ga0466967_0021171 3300045976 Bacteria 5274
394 Ga0466967_0081793 3300045976 Bacteria 2918
395 Ga0466967_0160077 3300045976 Bacteria 2112
396 Ga0466967_0444294 3300045976 Bacteria 1267
397 Ga0466967_0698034 3300045976 Bacteria 1005
398 Ga0495629_0003960 3300046459 Bacteria 11135
399 Ga0495638_0027389 3300046460 Bacteria 3689
400 Ga0495639_0018045 3300046475 Bacteria 3068
401 Ga0495606_0010471 3300046507 Bacteria 7689
402 Ga0495648_0001720 3300046524 Bacteria 21134
403 Ga0495654_0055666 3300046530 Bacteria 1914
404 Ga0495640_0031844 3300046533 Bacteria 3762
405 Ga0495668_0015261 3300046616 Bacteria 4489
406 Ga0495634_0062755 3300046642 Bacteria 2467
407 Ga0495635_0042785 3300046663 Bacteria 3127
408 Ga0495674_0062957 3300047319 Bacteria 3228
409 Ga0495672_0001112 3300047320 Bacteria 27275
410 Ga0495672_0010749 3300047320 Bacteria 6497
411 Ga0495672_0120719 3300047320 Bacteria 1394
412 Ga0495673_0000355 3300047469 Bacteria 57060
413 Ga0495686_0007564 3300047472 Bacteria 8121
414 Ga0495686_0179550 3300047472 Bacteria 1227
415 Ga0495593_0011749 3300047673 Bacteria 5022
416 Ga0495614_0067080 3300048089 Bacteria 1544
417 Ga0495626_0251474 3300048091 Bacteria 709
418 Ga0496100_0000531 3300048903 Bacteria 18147
419 Ga0496100_0000938 3300048903 Bacteria 13932
420 Ga0496100_0056834 3300048903 Bacteria 2561
421 Ga0496100_0071630 3300048903 Bacteria 2315
422 Ga0496100_0108525 3300048903 Bacteria 1925
423 Ga0496100_0199310 3300048903 Bacteria 1458
424 Ga0496101_0000102 3300048904 Bacteria 88779
425 Ga0496101_0035644 3300048904 Bacteria 3520
426 Ga0496101_0058629 3300048904 Bacteria 2789
427 Ga0496101_0091040 3300048904 Bacteria 2269
428 Ga0496101_0125326 3300048904 Bacteria 1946
429 Ga0496101_1141580 3300048904 Bacteria 611
430 Ga0496102_0000037 3300048905 Bacteria 199368
431 Ga0496102_0000780 3300048905 Bacteria 31010
432 Ga0496102_0001336 3300048905 Bacteria 22132
433 Ga0496102_0013725 3300048905 Bacteria 7025
434 Ga0496102_0100783 3300048905 Bacteria 2683
435 Ga0496102_0123289 3300048905 Bacteria 2421
436 Ga0496102_0515634 3300048905 Bacteria 1118
437 Ga0496102_0540873 3300048905 Bacteria 1087
438 Ga0496103_0000004 3300048906 Bacteria 510080
439 Ga0496103_0001409 3300048906 Bacteria 16139
440 Ga0496103_0001995 3300048906 Bacteria 13156
441 Ga0496103_0226499 3300048906 Bacteria 1202
442 Ga0496104_0013758 3300048907 Bacteria 7298
443 Ga0496104_0145383 3300048907 Bacteria 2277
444 Ga0496105_0037734 3300048908 Bacteria 3979
445 Ga0496105_0635796 3300048908 Bacteria 825
446 Ga0496106_0004574 3300048909 Bacteria 10261
447 Ga0496106_0110702 3300048909 Bacteria 2138
448 Ga0496106_0262971 3300048909 Bacteria 1381
449 Ga0496107_0004059 3300048910 Bacteria 9857
450 Ga0496108_0002904 3300048911 Bacteria 13767
451 Ga0496108_0129510 3300048911 Bacteria 2169
452 Ga0496108_0267611 3300048911 Bacteria 1487
453 Ga0496108_0375112 3300048911 Bacteria 1242
454 Ga0496109_0006914 3300048912 Bacteria 9572
455 Ga0496109_0030836 3300048912 Bacteria 4807
456 Ga0496109_0110966 3300048912 Bacteria 2550
457 Ga0496110_0012200 3300048913 Bacteria 7060
458 Ga0496110_0838760 3300048913 Bacteria 824
459 Ga0496111_0078537 3300048914 Bacteria 2407
460 Ga0496112_0006921 3300048915 Bacteria 10007
461 Ga0496112_0020042 3300048915 Bacteria 6331
462 Ga0496112_0038413 3300048915 Bacteria 4674
463 Ga0496112_0062490 3300048915 Bacteria 3673
464 Ga0496112_0067405 3300048915 Bacteria 3533
465 Ga0496112_0109776 3300048915 Bacteria 2729
466 Ga0496113_0002072 3300048916 Bacteria 11538
467 Ga0496113_0206579 3300048916 Bacteria 1562
468 Ga0496114_0000108 3300048917 Bacteria 59737
469 Ga0496114_0196867 3300048917 Bacteria 1764
470 Ga0496114_0504992 3300048917 Bacteria 1070
471 Ga0496115_0003184 3300048918 Bacteria 11793
472 Ga0496116_0000276 3300048919 Bacteria 89506
473 Ga0496116_0023122 3300048919 Bacteria 4637
474 Ga0496117_0000003 3300048920 Bacteria 1881097
475 Ga0496117_0001267 3300048920 Bacteria 37488
476 Ga0496117_0062371 3300048920 Bacteria 2555
477 Ga0496118_0000001 3300048921 Bacteria 1881100
478 Ga0496118_0000275 3300048921 Bacteria 90451
479 Ga0496118_0000292 3300048921 Bacteria 87325
480 Ga0496119_0006894 3300048922 Bacteria 10369
481 Ga0496119_0011468 3300048922 Bacteria 7331
482 Ga0496120_0007104 3300048923 Bacteria 8400
483 Ga0496121_0000338 3300048924 Bacteria 97703
484 Ga0496121_0016981 3300048924 Bacteria 7472
485 Ga0496121_0163363 3300048924 Bacteria 1626
486 Ga0496122_0018729 3300048925 Bacteria 6371
487 Ga0496124_0495407 3300048927 Bacteria 821
488 Ga0496125_0289024 3300048928 Bacteria 1011
489 Ga0496126_0001713 3300048929 Bacteria 32563
490 Ga0496126_0004123 3300048929 Bacteria 17588
491 Ga0496126_0009828 3300048929 Bacteria 10127
492 Ga0496126_0023184 3300048929 Bacteria 6018
493 Ga0496126_0052964 3300048929 Bacteria 3684
494 Ga0496126_1084751 3300048929 Bacteria 596
495 Ga0501031_0417620 3300049568 Bacteria 867
496 Ga0501032_0002086 3300049569 Bacteria 15782
497 Ga0501032_0022467 3300049569 Bacteria 4371
498 Ga0501033_0011021 3300049570 Bacteria 6924
499 Ga0501034_0001139 3300049571 Bacteria 37012
500 Ga0501034_0001642 3300049571 Bacteria 28889
501 Ga0501034_0244457 3300049571 Bacteria 1740
502 Ga0501036_0037773 3300049572 Bacteria 4085
503 Ga0501037_0007268 3300049573 Bacteria 8094
504 Ga0501038_0001528 3300049574 Bacteria 21344
505 Ga0501039_0000288 3300049575 Bacteria 35904
506 Ga0501043_0000411 3300049579 Bacteria 38553
507 Ga0501046_0000379 3300049580 Bacteria 44584
508 Ga0501047_0000372 3300049581 Bacteria 50660
509 Ga0501048_0001876 3300049582 Bacteria 15956
510 Ga0501067_0028742 3300049583 Bacteria 3081
511 Ga0501069_0031164 3300049585 Bacteria 2931
512 Ga0501069_0065837 3300049585 Bacteria 2026
513 Ga0501070_0000614 3300049586 Bacteria 32686
514 Ga0501070_0003863 3300049586 Bacteria 12920
515 Ga0501070_0049885 3300049586 Bacteria 3475
516 Ga0501073_0031355 3300049589 Bacteria 3793
517 Ga0501077_0184422 3300049593 Bacteria 1326
518 Ga0501035_0002980 3300049822 Bacteria 16277
519 Ga0501035_0678480 3300049822 Bacteria 833
520 Ga0501044_0017131 3300049823 Bacteria 7776
521 Ga0501044_0019229 3300049823 Bacteria 7312
522 Ga0501044_0023698 3300049823 Bacteria 6527
523 nmdc:mga03683_18348_c1 3300050489 Bacteria 2298
524 nmdc:mga03n38_250246_c1 3300050490 Bacteria 936
525 nmdc:mga03n38_25562_c1 3300050490 Bacteria 2427
526 nmdc:mga03n38_56339_c1 3300050490 Bacteria 1774
527 nmdc:mga03n38_57938_c1 3300050490 Bacteria 1753
528 nmdc:mga03n38_99674_c1 3300050490 Bacteria 1399
529 nmdc:mga00v17_10899_c1 3300050491 Bacteria 4980
530 nmdc:mga00v17_145410_c1 3300050491 Bacteria 1521
531 nmdc:mga00v17_14640_c1 3300050491 Bacteria 4385
532 nmdc:mga00v17_20111_c1 3300050491 Bacteria 3821
533 nmdc:mga00v17_25486_c1 3300050491 Bacteria 3438
534 nmdc:mga00v17_35209_c1 3300050491 Bacteria 2978
535 nmdc:mga00v17_4647_c1 3300050491 Bacteria 7164
536 nmdc:mga00v17_87758_c2 3300050491 Bacteria 1477
537 nmdc:mga0yw44_212640_c1 3300050492 Bacteria 1279
538 nmdc:mga0yw44_220031_c1 3300050492 Bacteria 1258
539 nmdc:mga0yw44_33553_c1 3300050492 Bacteria 3000
540 nmdc:mga0yw44_36512_c1 3300050492 Bacteria 2896
541 nmdc:mga0yw44_46269_c1 3300050492 Bacteria 2612
542 nmdc:mga0yw44_81985_c1 3300050492 Bacteria 2023
543 nmdc:mga0k408_165763_c1 3300050493 Bacteria 854
544 nmdc:mga06z11_10780_c1 3300050494 Bacteria 3910
545 nmdc:mga06z11_499249_c1 3300050494 Bacteria 737
546 nmdc:mga04h51_121500_c1 3300050495 Bacteria 973
547 nmdc:mga04h51_29663_c1 3300050495 Bacteria 1715
548 nmdc:mga04h51_9370_c1 3300050495 Bacteria 2652
549 nmdc:mga07m45_15134_c1 3300050496 Bacteria 4118
550 nmdc:mga07m45_38983_c1 3300050496 Bacteria 2654
551 nmdc:mga07m45_50288_c1 3300050496 Bacteria 2348
552 nmdc:mga07m45_57845_c1 3300050496 Bacteria 2193
553 nmdc:mga07m45_80960_c1 3300050496 Bacteria 1854
554 nmdc:mga05p37_27189_c1 3300050507 Bacteria 6964
555 nmdc:mga0qj67_7908_c1 3300050509 Bacteria 7858
556 nmdc:mga06r32_16370_c1 3300050510 Bacteria 6756
557 nmdc:mga0sz30_100109_c1 3300050516 Bacteria 1266
558 nmdc:mga0sz30_1431_c1 3300050516 Bacteria 8527
559 nmdc:mga0sz30_23826_c1 3300050516 Bacteria 2494
560 nmdc:mga0sz30_24710_c1 3300050516 Bacteria 2453
561 nmdc:mga0sz30_38774_c1 3300050516 Bacteria 1997
562 nmdc:mga0sz30_54684_c1 3300050516 Bacteria 1698
563 nmdc:mga0sz30_673_c1 3300050516 Bacteria 12605
564 nmdc:mga0sz30_71294_c1 3300050516 Bacteria 1496
565 nmdc:mga0sz30_85702_c1 3300050516 Bacteria 1367
566 Ga0500635_0080414 3300053080 Bacteria 1170
567 Ga0500578_0124242 3300053086 Bacteria 1621
568 Ga0500643_003428 3300053087 Bacteria 7642
569 Ga0500595_107567 3300053119 Bacteria 795
570 Ga0500642_0167494 3300053130 Bacteria 1029
571 Ga0500652_184953 3300053131 Bacteria 852
572 Ga0500568_0060508 3300053139 Bacteria 1467
573 Ga0500645_000075 3300053730 Bacteria 78736
574 Ga0466962_0021450 3300061719 Bacteria 3101
575 Ga0466962_0154849 3300061719 Bacteria 1113

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025945 Ga0207679_10799713 Ga0207679_107997132 158
2 3300050516 nmdc:mga0sz30_100109_c1 nmdc:mga0sz30_100109_c1_90_629 173
3 3300039437 Ga0436365_1674159 Ga0436365_1674159_1274_1846 177
4 3300048922 Ga0496119_0006894 Ga0496119_0006894_9778_10314 178
5 3300041511 Ga0451855_0291276 Ga0451855_0291276_329_868 179
6 3300042008 Ga0439450_011778 Ga0439450_011778_20_559 179
7 3300046507 Ga0495606_0010471 Ga0495606_0010471_41_580 179
8 3300050492 nmdc:mga0yw44_212640_c1 nmdc:mga0yw44_212640_c1_178_717 179
9 3300050494 nmdc:mga06z11_499249_c1 nmdc:mga06z11_499249_c1_77_616 179
10 3300050516 nmdc:mga0sz30_54684_c1 nmdc:mga0sz30_54684_c1_1127_1666 179
11 3300053080 Ga0500635_0080414 Ga0500635_0080414_16_558 179
12 3300005539 Ga0068853_100014069 Ga0068853_1000140693 181
13 3300009551 Ga0105238_11526090 Ga0105238_115260901 181
14 3300017792 Ga0163161_10549706 Ga0163161_105497062 181
15 3300026041 Ga0207639_10009918 Ga0207639_100099183 181
16 3300047472 Ga0495686_0007564 Ga0495686_0007564_1254_1883 181
17 3300048904 Ga0496101_1141580 Ga0496101_1141580_31_576 181
18 3300050493 nmdc:mga0k408_165763_c1 nmdc:mga0k408_165763_c1_14_583 183
19 iso_pu_bacteria 2917736166 2917736442 183
20 3300049585 Ga0501069_0031164 Ga0501069_0031164_865_1434 186
21 3300005435 Ga0070714_100247045 Ga0070714_1002470452 187
22 3300025929 Ga0207664_10278946 Ga0207664_102789462 187
23 3300037853 Ga0436364_0618027 Ga0436364_0618027_35_598 187
24 3300044842 Ga0466957_0318794 Ga0466957_0318794_446_1018 187
25 3300048913 Ga0496110_0838760 Ga0496110_0838760_50_613 187
26 3300048929 Ga0496126_1084751 Ga0496126_1084751_10_573 187
27 3300048091 Ga0495626_0251474 Ga0495626_0251474_133_699 188
28 3300039447 Ga0436361_0986788 Ga0436361_0986788_477_1055 189
29 3300048907 Ga0496104_0145383 Ga0496104_0145383_1679_2248 189
30 iso_pu_bacteria 2974315732 2974316672 189
31 3300049586 Ga0501070_0049885 Ga0501070_0049885_1628_2212 191
32 3300049822 Ga0501035_0678480 Ga0501035_0678480_124_708 191
33 3300006038 Ga0075365_10319744 Ga0075365_103197441 193
34 3300005937 Ga0081455_10029010 Ga0081455_100290106 196
35 3300006048 Ga0075363_100008479 Ga0075363_1000084796 196
36 3300006048 Ga0075363_100484127 Ga0075363_1004841272 196
37 3300006051 Ga0075364_10048046 Ga0075364_100480462 196
38 3300006353 Ga0075370_10044644 Ga0075370_100446442 196
39 3300048903 Ga0496100_0000531 Ga0496100_0000531_6207_6830 196
40 3300048904 Ga0496101_0000102 Ga0496101_0000102_74961_75584 196
41 3300048905 Ga0496102_0000037 Ga0496102_0000037_13236_13859 196
42 3300048906 Ga0496103_0000004 Ga0496103_0000004_323948_324571 196
43 3300048910 Ga0496107_0004059 Ga0496107_0004059_8505_9128 196
44 3300048919 Ga0496116_0000276 Ga0496116_0000276_13210_13833 196
45 3300048920 Ga0496117_0000003 Ga0496117_0000003_1522351_1522974 196
46 3300048921 Ga0496118_0000001 Ga0496118_0000001_1522354_1522977 196
47 3300048922 Ga0496119_0011468 Ga0496119_0011468_886_1509 196
48 3300048924 Ga0496121_0000338 Ga0496121_0000338_22120_22743 196
49 3300048929 Ga0496126_0004123 Ga0496126_0004123_3741_4364 196
50 3300050491 nmdc:mga00v17_20111_c1 nmdc:mga00v17_20111_c1_1037_1639 196
51 3300050496 nmdc:mga07m45_15134_c1 nmdc:mga07m45_15134_c1_1340_1942 196
52 3300050516 nmdc:mga0sz30_24710_c1 nmdc:mga0sz30_24710_c1_1565_2167 196
53 3300006038 Ga0075365_10263500 Ga0075365_102635002 197
54 3300005456 Ga0070678_100136573 Ga0070678_1001365733 198
55 3300005842 Ga0068858_100227734 Ga0068858_1002277343 198
56 3300048905 Ga0496102_0100783 Ga0496102_0100783_959_1603 198
57 3300048909 Ga0496106_0110702 Ga0496106_0110702_473_1117 198
58 3300048903 Ga0496100_0108525 Ga0496100_0108525_651_1295 199
59 3300048904 Ga0496101_0058629 Ga0496101_0058629_1569_2189 199
60 3300048915 Ga0496112_0020042 Ga0496112_0020042_3499_4119 199
61 3300048916 Ga0496113_0002072 Ga0496113_0002072_4783_5403 199
62 3300048925 Ga0496122_0018729 Ga0496122_0018729_4174_4794 199
63 3300048929 Ga0496126_0023184 Ga0496126_0023184_446_1066 199
64 3300044683 Ga0466965_0008928 Ga0466965_0008928_201_818 200
65 3300044706 Ga0466964_0027845 Ga0466964_0027845_1539_2156 200
66 3300044735 Ga0466968_0057535 Ga0466968_0057535_328_945 200
67 3300044765 Ga0466970_0126701 Ga0466970_0126701_281_898 200
68 3300044842 Ga0466957_0135238 Ga0466957_0135238_438_1055 200
69 3300044901 Ga0466960_0096933 Ga0466960_0096933_275_892 200
70 3300045049 Ga0466959_0029585 Ga0466959_0029585_2309_2926 200
71 3300045836 Ga0466958_0038741 Ga0466958_0038741_1935_2552 200
72 iso_pu_bacteria 2831935698 2831940149 200
73 3300044656 Ga0466969_0212156 Ga0466969_0212156_72_698 201
74 3300044693 Ga0466961_0031532 Ga0466961_0031532_2004_2630 201
75 3300044735 Ga0466968_0020735 Ga0466968_0020735_1241_1867 201
76 3300044765 Ga0466970_0419851 Ga0466970_0419851_93_719 201
77 3300044842 Ga0466957_0001674 Ga0466957_0001674_4637_5263 201
78 3300044901 Ga0466960_0091704 Ga0466960_0091704_145_771 201
79 3300045049 Ga0466959_0007885 Ga0466959_0007885_6108_6734 201
80 3300045836 Ga0466958_0002368 Ga0466958_0002368_7573_8199 201
81 iso_pu_bacteria 2867507094 2867509104 201
82 iso_pu_bacteria 2902810491 2902816983 201
83 3300005329 Ga0070683_100266624 Ga0070683_1002666243 203
84 3300025944 Ga0207661_10068788 Ga0207661_100687883 203
85 3300006042 Ga0075368_10020156 Ga0075368_100201562 204
86 3300006048 Ga0075363_100020253 Ga0075363_1000202534 204
87 3300006051 Ga0075364_10014566 Ga0075364_100145663 204
88 3300006177 Ga0075362_10057041 Ga0075362_100570412 204
89 3300006353 Ga0075370_10000764 Ga0075370_1000076412 204
90 3300027866 Ga0209813_10008026 Ga0209813_100080262 204
91 3300039437 Ga0436365_0302347 Ga0436365_0302347_19029_19664 204
92 3300044735 Ga0466968_0005039 Ga0466968_0005039_965_1600 204
93 3300044765 Ga0466970_0056098 Ga0466970_0056098_374_1009 204
94 3300045836 Ga0466958_0035940 Ga0466958_0035940_1630_2265 204
95 3300045976 Ga0466967_0021171 Ga0466967_0021171_466_1101 204
96 3300050489 nmdc:mga03683_18348_c1 nmdc:mga03683_18348_c1_839_1471 204
97 3300050491 nmdc:mga00v17_4647_c1 nmdc:mga00v17_4647_c1_6496_7128 204
98 3300050492 nmdc:mga0yw44_36512_c1 nmdc:mga0yw44_36512_c1_1398_2030 204
99 3300050494 nmdc:mga06z11_10780_c1 nmdc:mga06z11_10780_c1_116_748 204
100 3300050495 nmdc:mga04h51_9370_c1 nmdc:mga04h51_9370_c1_1102_1734 204
101 3300050496 nmdc:mga07m45_38983_c1 nmdc:mga07m45_38983_c1_116_748 204
102 iso_pu_bacteria 2929212328 2929214784 204
103 3300006051 Ga0075364_10033220 Ga0075364_100332202 205
104 3300031731 Ga0307405_10034536 Ga0307405_100345362 205
105 3300031901 Ga0307406_10012091 Ga0307406_100120912 205
106 3300039437 Ga0436365_0449497 Ga0436365_0449497_9192_9824 205
107 3300041410 Ga0439461_0001137 Ga0439461_0001137_422_1039 205
108 3300041411 Ga0439466_0004976 Ga0439466_0004976_1795_2412 205
109 3300041413 Ga0439465_0007147 Ga0439465_0007147_2456_3073 205
110 3300041997 Ga0439431_0002349 Ga0439431_0002349_1765_2382 205
111 3300042004 Ga0439445_0000376 Ga0439445_0000376_4669_5286 205
112 3300042435 Ga0439434_0029062 Ga0439434_0029062_41_658 205
113 3300045976 Ga0466967_0160077 Ga0466967_0160077_1360_1980 205
114 3300046642 Ga0495634_0062755 Ga0495634_0062755_483_1100 205
115 3300048903 Ga0496100_0056834 Ga0496100_0056834_554_1171 205
116 3300048904 Ga0496101_0091040 Ga0496101_0091040_1107_1724 205
117 3300048905 Ga0496102_0000780 Ga0496102_0000780_17428_18045 205
118 3300048906 Ga0496103_0001409 Ga0496103_0001409_7447_8064 205
119 3300048917 Ga0496114_0196867 Ga0496114_0196867_1133_1750 205
120 3300048919 Ga0496116_0023122 Ga0496116_0023122_97_714 205
121 3300048920 Ga0496117_0001267 Ga0496117_0001267_6425_7042 205
122 3300048921 Ga0496118_0000275 Ga0496118_0000275_89349_89966 205
123 3300048923 Ga0496120_0007104 Ga0496120_0007104_4133_4750 205
124 3300048924 Ga0496121_0016981 Ga0496121_0016981_5120_5737 205
125 3300048929 Ga0496126_0009828 Ga0496126_0009828_5758_6375 205
126 3300050491 nmdc:mga00v17_25486_c1 nmdc:mga00v17_25486_c1_2523_3140 205
127 iso_pu_bacteria 2902837492 2902840099 205
128 3300005435 Ga0070714_100129578 Ga0070714_1001295782 206
129 3300005436 Ga0070713_100043765 Ga0070713_1000437651 206
130 3300005578 Ga0068854_100096492 Ga0068854_1000964923 206
131 3300006186 Ga0075369_10009039 Ga0075369_100090392 206
132 3300006186 Ga0075369_10078887 Ga0075369_100788872 206
133 3300009545 Ga0105237_10017185 Ga0105237_100171852 206
134 3300009545 Ga0105237_10501906 Ga0105237_105019062 206
135 3300010375 Ga0105239_10189273 Ga0105239_101892732 206
136 3300013105 Ga0157369_10055936 Ga0157369_100559364 206
137 3300021384 Ga0213876_10009574 Ga0213876_100095742 206
138 3300021388 Ga0213875_10033104 Ga0213875_100331043 206
139 3300025303 Ga0209051_1018172 Ga0209051_10181723 206
140 3300025914 Ga0207671_10023448 Ga0207671_100234486 206
141 3300037853 Ga0436364_1537251 Ga0436364_1537251_578_1228 206
142 3300039437 Ga0436365_0663981 Ga0436365_0663981_8411_9061 206
143 3300044694 Ga0466963_0177313 Ga0466963_0177313_217_858 206
144 3300044901 Ga0466960_0016953 Ga0466960_0016953_2375_3016 206
145 3300045836 Ga0466958_0072806 Ga0466958_0072806_421_1059 206
146 3300047472 Ga0495686_0179550 Ga0495686_0179550_275_907 206
147 3300048920 Ga0496117_0062371 Ga0496117_0062371_1563_2207 206
148 3300048921 Ga0496118_0000292 Ga0496118_0000292_69582_70226 206
149 3300049571 Ga0501034_0244457 Ga0501034_0244457_252_878 206
150 3300050516 nmdc:mga0sz30_1431_c1 nmdc:mga0sz30_1431_c1_2905_3546 206
151 3300050516 nmdc:mga0sz30_71294_c1 nmdc:mga0sz30_71294_c1_493_1116 206
152 3300061719 Ga0466962_0154849 Ga0466962_0154849_299_940 206
153 iso_pu_bacteria 2738541274 2738706053 206
154 iso_pu_bacteria 2738543028 2739333047 206
155 iso_pu_bacteria 2842134933 2842138500 206
156 iso_pu_bacteria 2902792274 2902798380 206
157 iso_pu_bacteria 2902799365 2902801647 206
158 3300005329 Ga0070683_100182357 Ga0070683_1001823572 207
159 3300005337 Ga0070682_100016495 Ga0070682_1000164952 207
160 3300005344 Ga0070661_100174589 Ga0070661_1001745891 207
161 3300005367 Ga0070667_100000063 Ga0070667_10000006399 207
162 3300005548 Ga0070665_100005170 Ga0070665_1000051706 207
163 3300005617 Ga0068859_100033321 Ga0068859_1000333212 207
164 3300005618 Ga0068864_100219695 Ga0068864_1002196952 207
165 3300005840 Ga0068870_10144949 Ga0068870_101449492 207
166 3300005841 Ga0068863_100000159 Ga0068863_10000015940 207
167 3300005842 Ga0068858_100089329 Ga0068858_1000893292 207
168 3300005843 Ga0068860_100000065 Ga0068860_10000006599 207
169 3300005844 Ga0068862_100000028 Ga0068862_100000028118 207
170 3300006048 Ga0075363_100056757 Ga0075363_1000567573 207
171 3300006931 Ga0097620_100033322 Ga0097620_1000333225 207
172 3300009098 Ga0105245_10739184 Ga0105245_107391841 207
173 3300009101 Ga0105247_10000910 Ga0105247_100009102 207
174 3300009148 Ga0105243_10060775 Ga0105243_100607751 207
175 3300009174 Ga0105241_10404668 Ga0105241_104046682 207
176 3300009177 Ga0105248_10000074 Ga0105248_1000007496 207
177 3300009551 Ga0105238_10204763 Ga0105238_102047632 207
178 3300009553 Ga0105249_10000011 Ga0105249_10000011209 207
179 3300014968 Ga0157379_10037773 Ga0157379_100377733 207
180 3300025900 Ga0207710_10000014 Ga0207710_1000001417 207
181 3300025911 Ga0207654_10245479 Ga0207654_102454792 207
182 3300025920 Ga0207649_10554221 Ga0207649_105542211 207
183 3300025923 Ga0207681_10629375 Ga0207681_106293751 207
184 3300025941 Ga0207711_10000149 Ga0207711_1000014962 207
185 3300025961 Ga0207712_10000020 Ga0207712_1000002071 207
186 3300025986 Ga0207658_10004224 Ga0207658_100042248 207
187 3300026035 Ga0207703_10080290 Ga0207703_100802902 207
188 3300026088 Ga0207641_10000156 Ga0207641_1000015653 207
189 3300028379 Ga0268266_10004901 Ga0268266_100049012 207
190 3300028380 Ga0268265_10000004 Ga0268265_10000004384 207
191 3300028381 Ga0268264_10000024 Ga0268264_10000024369 207
192 3300046524 Ga0495648_0001720 Ga0495648_0001720_9119_9745 207
193 3300046530 Ga0495654_0055666 Ga0495654_0055666_297_923 207
194 3300046616 Ga0495668_0015261 Ga0495668_0015261_1659_2285 207
195 3300047320 Ga0495672_0001112 Ga0495672_0001112_2297_2923 207
196 3300047469 Ga0495673_0000355 Ga0495673_0000355_5083_5709 207
197 3300048904 Ga0496101_0125326 Ga0496101_0125326_906_1529 207
198 3300048912 Ga0496109_0110966 Ga0496109_0110966_850_1473 207
199 3300048915 Ga0496112_0006921 Ga0496112_0006921_5097_5720 207
200 3300049569 Ga0501032_0022467 Ga0501032_0022467_1949_2575 207
201 3300049571 Ga0501034_0001642 Ga0501034_0001642_13407_14033 207
202 3300049574 Ga0501038_0001528 Ga0501038_0001528_9841_10467 207
203 3300049575 Ga0501039_0000288 Ga0501039_0000288_14954_15580 207
204 3300049579 Ga0501043_0000411 Ga0501043_0000411_7001_7627 207
205 3300049583 Ga0501067_0028742 Ga0501067_0028742_495_1121 207
206 3300049586 Ga0501070_0000614 Ga0501070_0000614_30800_31426 207
207 3300049593 Ga0501077_0184422 Ga0501077_0184422_475_1101 207
208 3300049823 Ga0501044_0023698 Ga0501044_0023698_2679_3305 207
209 3300050490 nmdc:mga03n38_250246_c1 nmdc:mga03n38_250246_c1_273_896 207
210 3300005334 Ga0068869_100667599 Ga0068869_1006675991 208
211 3300006038 Ga0075365_10273246 Ga0075365_102732462 208
212 3300021384 Ga0213876_10017444 Ga0213876_100174444 208
213 3300025294 Ga0209025_1032975 Ga0209025_10329752 208
214 3300025915 Ga0207693_10056705 Ga0207693_100567052 208
215 3300028380 Ga0268265_10096725 Ga0268265_100967252 208
216 3300044694 Ga0466963_0638556 Ga0466963_0638556_40_687 208
217 3300044842 Ga0466957_0153307 Ga0466957_0153307_842_1468 208
218 3300044842 Ga0466957_0187280 Ga0466957_0187280_82_726 208
219 3300045836 Ga0466958_0068230 Ga0466958_0068230_160_786 208
220 3300045976 Ga0466967_0011995 Ga0466967_0011995_5233_5880 208
221 3300045976 Ga0466967_0444294 Ga0466967_0444294_485_1111 208
222 3300045976 Ga0466967_0698034 Ga0466967_0698034_289_933 208
223 3300046459 Ga0495629_0003960 Ga0495629_0003960_7728_8354 208
224 3300046475 Ga0495639_0018045 Ga0495639_0018045_2023_2649 208
225 3300046533 Ga0495640_0031844 Ga0495640_0031844_651_1277 208
226 3300046663 Ga0495635_0042785 Ga0495635_0042785_1785_2411 208
227 3300047319 Ga0495674_0062957 Ga0495674_0062957_2173_2799 208
228 3300047673 Ga0495593_0011749 Ga0495593_0011749_1030_1656 208
229 3300048089 Ga0495614_0067080 Ga0495614_0067080_430_1056 208
230 3300048909 Ga0496106_0262971 Ga0496106_0262971_169_795 208
231 3300048915 Ga0496112_0067405 Ga0496112_0067405_1195_1821 208
232 3300048929 Ga0496126_0001713 Ga0496126_0001713_14281_14928 208
233 3300049568 Ga0501031_0417620 Ga0501031_0417620_20_667 208
234 3300049569 Ga0501032_0002086 Ga0501032_0002086_6426_7073 208
235 3300049570 Ga0501033_0011021 Ga0501033_0011021_4700_5347 208
236 3300049571 Ga0501034_0001139 Ga0501034_0001139_14921_15568 208
237 3300049572 Ga0501036_0037773 Ga0501036_0037773_1767_2414 208
238 3300049573 Ga0501037_0007268 Ga0501037_0007268_5938_6585 208
239 3300049580 Ga0501046_0000379 Ga0501046_0000379_10739_11386 208
240 3300049581 Ga0501047_0000372 Ga0501047_0000372_34832_35479 208
241 3300049582 Ga0501048_0001876 Ga0501048_0001876_11065_11712 208
242 3300049585 Ga0501069_0065837 Ga0501069_0065837_1133_1780 208
243 3300049586 Ga0501070_0003863 Ga0501070_0003863_4462_5109 208
244 3300049589 Ga0501073_0031355 Ga0501073_0031355_1659_2306 208
245 3300049822 Ga0501035_0002980 Ga0501035_0002980_9548_10195 208
246 3300049823 Ga0501044_0017131 Ga0501044_0017131_4425_5072 208
247 3300049823 Ga0501044_0019229 Ga0501044_0019229_5077_5721 208
248 3300050492 nmdc:mga0yw44_220031_c1 nmdc:mga0yw44_220031_c1_180_809 208
249 3300050496 nmdc:mga07m45_80960_c1 nmdc:mga07m45_80960_c1_745_1371 208
250 3300050516 nmdc:mga0sz30_38774_c1 nmdc:mga0sz30_38774_c1_1047_1673 208
251 3300053087 Ga0500643_003428 Ga0500643_003428_6869_7498 208
252 3300003792 Ga0055540_1006531 Ga0055540_10065314 209
253 3300003792 Ga0055540_1016834 Ga0055540_10168342 209
254 3300006051 Ga0075364_10321797 Ga0075364_103217972 209
255 3300025273 Ga0209673_1010888 Ga0209673_10108883 209
256 3300025303 Ga0209051_1002890 Ga0209051_10028904 209
257 3300025303 Ga0209051_1010174 Ga0209051_10101742 209
258 3300039450 Ga0436363_0232937 Ga0436363_0232937_1930_2565 209
259 3300041452 Ga0451793_1653830 Ga0451793_1653830_31_660 209
260 3300045976 Ga0466967_0081793 Ga0466967_0081793_41_676 209
261 3300048927 Ga0496124_0495407 Ga0496124_0495407_105_734 209
262 3300050516 nmdc:mga0sz30_85702_c1 nmdc:mga0sz30_85702_c1_633_1262 209
263 3300001977 JGI24746J21847_1002588 JGI24746J21847_10025882 210
264 3300001989 JGI24739J22299_10077915 JGI24739J22299_100779152 210
265 3300001991 JGI24743J22301_10007510 JGI24743J22301_100075103 210
266 3300002073 JGI24745J21846_1008156 JGI24745J21846_10081562 210
267 3300002077 JGI24744J21845_10000417 JGI24744J21845_100004173 210
268 3300002077 JGI24744J21845_10002763 JGI24744J21845_100027632 210
269 3300002244 JGI24742J22300_10001347 JGI24742J22300_100013472 210
270 3300002459 JGI24751J29686_10014159 JGI24751J29686_100141592 210
271 3300005330 Ga0070690_100085420 Ga0070690_1000854202 210
272 3300005334 Ga0068869_100036242 Ga0068869_1000362422 210
273 3300005334 Ga0068869_100066679 Ga0068869_1000666792 210
274 3300005335 Ga0070666_10117361 Ga0070666_101173612 210
275 3300005337 Ga0070682_100124311 Ga0070682_1001243112 210
276 3300005338 Ga0068868_100000294 Ga0068868_10000029413 210
277 3300005340 Ga0070689_100033159 Ga0070689_1000331592 210
278 3300005340 Ga0070689_100129329 Ga0070689_1001293293 210
279 3300005341 Ga0070691_10003749 Ga0070691_100037494 210
280 3300005345 Ga0070692_10086713 Ga0070692_100867132 210
281 3300005345 Ga0070692_10310778 Ga0070692_103107781 210
282 3300005347 Ga0070668_100013156 Ga0070668_1000131563 210
283 3300005353 Ga0070669_100066978 Ga0070669_1000669782 210
284 3300005354 Ga0070675_100165691 Ga0070675_1001656911 210
285 3300005355 Ga0070671_100001875 Ga0070671_10000187512 210
286 3300005355 Ga0070671_100048100 Ga0070671_1000481002 210
287 3300005355 Ga0070671_100111611 Ga0070671_1001116112 210
288 3300005356 Ga0070674_100003497 Ga0070674_1000034972 210
289 3300005356 Ga0070674_100023332 Ga0070674_1000233322 210
290 3300005364 Ga0070673_100047735 Ga0070673_1000477352 210
291 3300005364 Ga0070673_100327149 Ga0070673_1003271492 210
292 3300005365 Ga0070688_100007721 Ga0070688_1000077217 210
293 3300005365 Ga0070688_100131348 Ga0070688_1001313482 210
294 3300005367 Ga0070667_100002143 Ga0070667_1000021433 210
295 3300005367 Ga0070667_100284503 Ga0070667_1002845032 210
296 3300005367 Ga0070667_100450926 Ga0070667_1004509262 210
297 3300005367 Ga0070667_100620005 Ga0070667_1006200052 210
298 3300005434 Ga0070709_10011544 Ga0070709_100115442 210
299 3300005435 Ga0070714_100956396 Ga0070714_1009563961 210
300 3300005437 Ga0070710_10000220 Ga0070710_1000022023 210
301 3300005438 Ga0070701_10008181 Ga0070701_100081813 210
302 3300005439 Ga0070711_100000969 Ga0070711_1000009692 210
303 3300005439 Ga0070711_100003252 Ga0070711_1000032525 210
304 3300005440 Ga0070705_100026022 Ga0070705_1000260222 210
305 3300005440 Ga0070705_100062434 Ga0070705_1000624342 210
306 3300005441 Ga0070700_100000463 Ga0070700_1000004638 210
307 3300005441 Ga0070700_100084647 Ga0070700_1000846472 210
308 3300005455 Ga0070663_100131424 Ga0070663_1001314241 210
309 3300005455 Ga0070663_100356904 Ga0070663_1003569041 210
310 3300005456 Ga0070678_100000347 Ga0070678_10000034714 210
311 3300005457 Ga0070662_100025409 Ga0070662_1000254093 210
312 3300005457 Ga0070662_100076347 Ga0070662_1000763472 210
313 3300005459 Ga0068867_100001344 Ga0068867_10000134413 210
314 3300005466 Ga0070685_10032504 Ga0070685_100325042 210
315 3300005539 Ga0068853_100019567 Ga0068853_1000195672 210
316 3300005539 Ga0068853_100860947 Ga0068853_1008609471 210
317 3300005543 Ga0070672_100067460 Ga0070672_1000674602 210
318 3300005543 Ga0070672_100910950 Ga0070672_1009109501 210
319 3300005544 Ga0070686_100171429 Ga0070686_1001714292 210
320 3300005546 Ga0070696_100006998 Ga0070696_1000069983 210
321 3300005546 Ga0070696_100112297 Ga0070696_1001122972 210
322 3300005547 Ga0070693_100009863 Ga0070693_1000098632 210
323 3300005548 Ga0070665_100018371 Ga0070665_1000183712 210
324 3300005549 Ga0070704_100000118 Ga0070704_10000011810 210
325 3300005563 Ga0068855_100048751 Ga0068855_1000487512 210
326 3300005563 Ga0068855_100271557 Ga0068855_1002715572 210
327 3300005577 Ga0068857_100909141 Ga0068857_1009091412 210
328 3300005578 Ga0068854_100000777 Ga0068854_1000007779 210
329 3300005614 Ga0068856_100223850 Ga0068856_1002238503 210
330 3300005615 Ga0070702_100000798 Ga0070702_1000007982 210
331 3300005615 Ga0070702_100259662 Ga0070702_1002596622 210
332 3300005617 Ga0068859_100004969 Ga0068859_1000049693 210
333 3300005617 Ga0068859_100621609 Ga0068859_1006216092 210
334 3300005618 Ga0068864_100254813 Ga0068864_1002548132 210
335 3300005618 Ga0068864_100535731 Ga0068864_1005357312 210
336 3300005718 Ga0068866_10000197 Ga0068866_1000019717 210
337 3300005719 Ga0068861_100000102 Ga0068861_10000010218 210
338 3300005719 Ga0068861_100101593 Ga0068861_1001015932 210
339 3300005834 Ga0068851_10250174 Ga0068851_102501742 210
340 3300005841 Ga0068863_100002339 Ga0068863_1000023394 210
341 3300005842 Ga0068858_100001068 Ga0068858_10000106826 210
342 3300005843 Ga0068860_100000663 Ga0068860_1000006632 210
343 3300005844 Ga0068862_100009162 Ga0068862_1000091622 210
344 3300005844 Ga0068862_100049464 Ga0068862_1000494642 210
345 3300005844 Ga0068862_100884730 Ga0068862_1008847302 210
346 3300005937 Ga0081455_10126738 Ga0081455_101267382 210
347 3300006038 Ga0075365_10005499 Ga0075365_100054998 210
348 3300006038 Ga0075365_10018637 Ga0075365_100186372 210
349 3300006038 Ga0075365_10036912 Ga0075365_100369122 210
350 3300006038 Ga0075365_10074962 Ga0075365_100749622 210
351 3300006042 Ga0075368_10100214 Ga0075368_101002142 210
352 3300006048 Ga0075363_100000310 Ga0075363_10000031015 210
353 3300006048 Ga0075363_100005680 Ga0075363_1000056802 210
354 3300006048 Ga0075363_100065187 Ga0075363_1000651873 210
355 3300006048 Ga0075363_100283530 Ga0075363_1002835301 210
356 3300006051 Ga0075364_10001023 Ga0075364_1000102312 210
357 3300006051 Ga0075364_10004805 Ga0075364_100048053 210
358 3300006051 Ga0075364_10015287 Ga0075364_100152875 210
359 3300006051 Ga0075364_10035758 Ga0075364_100357582 210
360 3300006051 Ga0075364_10053477 Ga0075364_100534772 210
361 3300006051 Ga0075364_10059770 Ga0075364_100597702 210
362 3300006051 Ga0075364_10120429 Ga0075364_101204292 210
363 3300006163 Ga0070715_10002672 Ga0070715_100026722 210
364 3300006163 Ga0070715_10030598 Ga0070715_100305982 210
365 3300006173 Ga0070716_100000479 Ga0070716_1000004799 210
366 3300006173 Ga0070716_100002564 Ga0070716_1000025642 210
367 3300006175 Ga0070712_100000901 Ga0070712_10000090114 210
368 3300006175 Ga0070712_100041807 Ga0070712_1000418072 210
369 3300006177 Ga0075362_10021169 Ga0075362_100211692 210
370 3300006177 Ga0075362_10055389 Ga0075362_100553893 210
371 3300006178 Ga0075367_10139194 Ga0075367_101391942 210
372 3300006186 Ga0075369_10001003 Ga0075369_100010036 210
373 3300006186 Ga0075369_10003320 Ga0075369_100033207 210
374 3300006186 Ga0075369_10042117 Ga0075369_100421172 210
375 3300006186 Ga0075369_10049955 Ga0075369_100499551 210
376 3300006186 Ga0075369_10052159 Ga0075369_100521592 210
377 3300006353 Ga0075370_10011914 Ga0075370_100119142 210
378 3300006353 Ga0075370_10026349 Ga0075370_100263492 210
379 3300006844 Ga0075428_100005745 Ga0075428_10000574513 210
380 3300006846 Ga0075430_100014131 Ga0075430_1000141312 210
381 3300006881 Ga0068865_100000554 Ga0068865_1000005548 210
382 3300006931 Ga0097620_100004970 Ga0097620_1000049703 210
383 3300006931 Ga0097620_100621711 Ga0097620_1006217112 210
384 3300009092 Ga0105250_10022796 Ga0105250_100227962 210
385 3300009092 Ga0105250_10097473 Ga0105250_100974732 210
386 3300009098 Ga0105245_10000172 Ga0105245_1000017261 210
387 3300009101 Ga0105247_10002035 Ga0105247_1000203512 210
388 3300009101 Ga0105247_10013582 Ga0105247_100135822 210
389 3300009147 Ga0114129_10062195 Ga0114129_100621954 210
390 3300009174 Ga0105241_10056757 Ga0105241_100567572 210
391 3300009174 Ga0105241_10164353 Ga0105241_101643533 210
392 3300009176 Ga0105242_10001106 Ga0105242_100011066 210
393 3300009176 Ga0105242_10080594 Ga0105242_100805943 210
394 3300009177 Ga0105248_10002067 Ga0105248_100020673 210
395 3300009177 Ga0105248_10240389 Ga0105248_102403893 210
396 3300009177 Ga0105248_10368436 Ga0105248_103684362 210
397 3300009545 Ga0105237_10126811 Ga0105237_101268112 210
398 3300009545 Ga0105237_10399246 Ga0105237_103992462 210
399 3300009553 Ga0105249_10000817 Ga0105249_1000081723 210
400 3300009553 Ga0105249_10181471 Ga0105249_101814711 210
401 3300009553 Ga0105249_10948394 Ga0105249_109483942 210
402 3300010375 Ga0105239_10061339 Ga0105239_100613394 210
403 3300010375 Ga0105239_10115788 Ga0105239_101157882 210
404 3300011119 Ga0105246_10040128 Ga0105246_100401282 210
405 3300013102 Ga0157371_10091246 Ga0157371_100912462 210
406 3300013297 Ga0157378_10017478 Ga0157378_100174783 210
407 3300013306 Ga0163162_10002629 Ga0163162_100026296 210
408 3300014326 Ga0157380_10000237 Ga0157380_1000023716 210
409 3300014326 Ga0157380_10263651 Ga0157380_102636512 210
410 3300014745 Ga0157377_10097343 Ga0157377_100973432 210
411 3300014968 Ga0157379_10003146 Ga0157379_1000314611 210
412 3300014968 Ga0157379_10104072 Ga0157379_101040723 210
413 3300014969 Ga0157376_10061156 Ga0157376_100611564 210
414 3300017792 Ga0163161_10001434 Ga0163161_100014343 210
415 3300021384 Ga0213876_10127377 Ga0213876_101273772 210
416 3300025898 Ga0207692_10000823 Ga0207692_100008233 210
417 3300025898 Ga0207692_10036131 Ga0207692_100361312 210
418 3300025899 Ga0207642_10004093 Ga0207642_100040935 210
419 3300025899 Ga0207642_10189145 Ga0207642_101891452 210
420 3300025900 Ga0207710_10018541 Ga0207710_100185412 210
421 3300025900 Ga0207710_10158015 Ga0207710_101580152 210
422 3300025901 Ga0207688_10004880 Ga0207688_100048803 210
423 3300025901 Ga0207688_10006959 Ga0207688_100069596 210
424 3300025904 Ga0207647_10026240 Ga0207647_100262402 210
425 3300025905 Ga0207685_10002092 Ga0207685_100020922 210
426 3300025905 Ga0207685_10024419 Ga0207685_100244193 210
427 3300025906 Ga0207699_10021462 Ga0207699_100214622 210
428 3300025908 Ga0207643_10067096 Ga0207643_100670962 210
429 3300025911 Ga0207654_10264409 Ga0207654_102644092 210
430 3300025912 Ga0207707_10598349 Ga0207707_105983492 210
431 3300025914 Ga0207671_10373050 Ga0207671_103730502 210
432 3300025915 Ga0207693_10000049 Ga0207693_1000004981 210
433 3300025915 Ga0207693_10000258 Ga0207693_100002582 210
434 3300025916 Ga0207663_10025829 Ga0207663_100258293 210
435 3300025919 Ga0207657_10054879 Ga0207657_100548794 210
436 3300025923 Ga0207681_10165726 Ga0207681_101657262 210
437 3300025927 Ga0207687_10011764 Ga0207687_100117642 210
438 3300025927 Ga0207687_10501963 Ga0207687_105019632 210
439 3300025928 Ga0207700_10495787 Ga0207700_104957871 210
440 3300025931 Ga0207644_10006697 Ga0207644_100066972 210
441 3300025931 Ga0207644_10477060 Ga0207644_104770602 210
442 3300025933 Ga0207706_10012474 Ga0207706_1001247410 210
443 3300025933 Ga0207706_10013178 Ga0207706_100131786 210
444 3300025934 Ga0207686_10021782 Ga0207686_100217822 210
445 3300025934 Ga0207686_10356022 Ga0207686_103560222 210
446 3300025935 Ga0207709_10009668 Ga0207709_100096682 210
447 3300025936 Ga0207670_10125308 Ga0207670_101253081 210
448 3300025937 Ga0207669_10004112 Ga0207669_100041123 210
449 3300025938 Ga0207704_10008654 Ga0207704_100086542 210
450 3300025939 Ga0207665_10003396 Ga0207665_100033964 210
451 3300025941 Ga0207711_10043146 Ga0207711_100431464 210
452 3300025941 Ga0207711_10674530 Ga0207711_106745302 210
453 3300025942 Ga0207689_10010339 Ga0207689_100103395 210
454 3300025949 Ga0207667_10605637 Ga0207667_106056372 210
455 3300025960 Ga0207651_10119787 Ga0207651_101197872 210
456 3300025960 Ga0207651_10301798 Ga0207651_103017982 210
457 3300025961 Ga0207712_10001309 Ga0207712_1000130912 210
458 3300025961 Ga0207712_10217453 Ga0207712_102174532 210
459 3300025972 Ga0207668_10004346 Ga0207668_100043463 210
460 3300025972 Ga0207668_10072025 Ga0207668_100720252 210
461 3300025972 Ga0207668_10372958 Ga0207668_103729582 210
462 3300025981 Ga0207640_10027713 Ga0207640_100277133 210
463 3300025981 Ga0207640_10481791 Ga0207640_104817911 210
464 3300025986 Ga0207658_10012013 Ga0207658_100120132 210
465 3300025986 Ga0207658_10110321 Ga0207658_101103212 210
466 3300025986 Ga0207658_10239894 Ga0207658_102398942 210
467 3300025986 Ga0207658_10584000 Ga0207658_105840001 210
468 3300026023 Ga0207677_10002239 Ga0207677_100022393 210
469 3300026023 Ga0207677_10089710 Ga0207677_100897102 210
470 3300026041 Ga0207639_10005576 Ga0207639_100055766 210
471 3300026067 Ga0207678_10006306 Ga0207678_100063066 210
472 3300026067 Ga0207678_10358792 Ga0207678_103587922 210
473 3300026075 Ga0207708_10000411 Ga0207708_1000041115 210
474 3300026075 Ga0207708_10033920 Ga0207708_100339201 210
475 3300026078 Ga0207702_10118088 Ga0207702_101180882 210
476 3300026088 Ga0207641_10007452 Ga0207641_100074524 210
477 3300026088 Ga0207641_10272550 Ga0207641_102725502 210
478 3300026089 Ga0207648_10000187 Ga0207648_1000018749 210
479 3300026089 Ga0207648_10009745 Ga0207648_100097456 210
480 3300026095 Ga0207676_10116369 Ga0207676_101163692 210
481 3300026095 Ga0207676_10482481 Ga0207676_104824812 210
482 3300026118 Ga0207675_100000220 Ga0207675_10000022042 210
483 3300026118 Ga0207675_100016473 Ga0207675_1000164732 210
484 3300026121 Ga0207683_10000197 Ga0207683_1000019723 210
485 3300026121 Ga0207683_10002676 Ga0207683_1000267612 210
486 3300026142 Ga0207698_10080095 Ga0207698_100800951 210
487 3300026142 Ga0207698_10206503 Ga0207698_102065032 210
488 3300028379 Ga0268266_10637130 Ga0268266_106371302 210
489 3300028380 Ga0268265_10200168 Ga0268265_102001682 210
490 3300028380 Ga0268265_10220989 Ga0268265_102209892 210
491 3300028381 Ga0268264_10012371 Ga0268264_100123715 210
492 3300028381 Ga0268264_10222512 Ga0268264_102225122 210
493 3300031548 Ga0307408_100824006 Ga0307408_1008240062 210
494 3300031824 Ga0307413_10010632 Ga0307413_100106322 210
495 3300031901 Ga0307406_10132015 Ga0307406_101320152 210
496 3300032002 Ga0307416_100019016 Ga0307416_1000190162 210
497 3300032126 Ga0307415_100078432 Ga0307415_1000784322 210
498 3300035121 Ga0373960_0038294 Ga0373960_0038294_336_968 210
499 3300035241 Ga0373961_0037370 Ga0373961_0037370_490_1122 210
500 3300035242 Ga0373962_0066401 Ga0373962_0066401_95_727 210
501 3300035691 Ga0373931_0014544 Ga0373931_0014544_1335_1967 210
502 3300035691 Ga0373931_0015526 Ga0373931_0015526_2444_3076 210
503 3300036712 Ga0316584_0030529 Ga0316584_0030529_2995_3630 210
504 3300037471 Ga0395905_0724660 Ga0395905_0724660_217_849 210
505 3300039437 Ga0436365_0117277 Ga0436365_0117277_101_754 210
506 3300041411 Ga0439466_0001598 Ga0439466_0001598_8135_8767 210
507 3300041411 Ga0439466_0007060 Ga0439466_0007060_2546_3178 210
508 3300041411 Ga0439466_0059303 Ga0439466_0059303_391_1023 210
509 3300041413 Ga0439465_0002454 Ga0439465_0002454_2380_3012 210
510 3300041413 Ga0439465_0005477 Ga0439465_0005477_1454_2086 210
511 3300041413 Ga0439465_0085086 Ga0439465_0085086_62_694 210
512 3300042002 Ga0439442_001306 Ga0439442_001306_77_709 210
513 3300044658 Ga0466972_0005939 Ga0466972_0005939_3792_4424 210
514 3300044658 Ga0466972_0066425 Ga0466972_0066425_868_1500 210
515 3300044683 Ga0466965_0035075 Ga0466965_0035075_1682_2314 210
516 3300044684 Ga0466966_0034127 Ga0466966_0034127_658_1290 210
517 3300044684 Ga0466966_0055207 Ga0466966_0055207_417_1112 210
518 3300044735 Ga0466968_0008274 Ga0466968_0008274_829_1461 210
519 3300044765 Ga0466970_0028028 Ga0466970_0028028_180_812 210
520 3300044842 Ga0466957_0062419 Ga0466957_0062419_332_964 210
521 3300044901 Ga0466960_0013309 Ga0466960_0013309_1103_1735 210
522 3300045049 Ga0466959_0008665 Ga0466959_0008665_2462_3094 210
523 3300045836 Ga0466958_0031537 Ga0466958_0031537_1233_1865 210
524 3300046460 Ga0495638_0027389 Ga0495638_0027389_2687_3325 210
525 3300047320 Ga0495672_0010749 Ga0495672_0010749_2550_3188 210
526 3300047320 Ga0495672_0120719 Ga0495672_0120719_481_1131 210
527 3300048903 Ga0496100_0000938 Ga0496100_0000938_12958_13590 210
528 3300048903 Ga0496100_0071630 Ga0496100_0071630_553_1185 210
529 3300048903 Ga0496100_0199310 Ga0496100_0199310_481_1113 210
530 3300048904 Ga0496101_0035644 Ga0496101_0035644_2644_3276 210
531 3300048905 Ga0496102_0001336 Ga0496102_0001336_21252_21884 210
532 3300048905 Ga0496102_0013725 Ga0496102_0013725_3689_4321 210
533 3300048905 Ga0496102_0123289 Ga0496102_0123289_913_1545 210
534 3300048905 Ga0496102_0515634 Ga0496102_0515634_143_781 210
535 3300048905 Ga0496102_0540873 Ga0496102_0540873_124_756 210
536 3300048906 Ga0496103_0001995 Ga0496103_0001995_8313_8945 210
537 3300048906 Ga0496103_0226499 Ga0496103_0226499_552_1184 210
538 3300048907 Ga0496104_0013758 Ga0496104_0013758_4638_5270 210
539 3300048908 Ga0496105_0037734 Ga0496105_0037734_2799_3431 210
540 3300048908 Ga0496105_0635796 Ga0496105_0635796_137_772 210
541 3300048909 Ga0496106_0004574 Ga0496106_0004574_1300_1932 210
542 3300048911 Ga0496108_0002904 Ga0496108_0002904_7337_7969 210
543 3300048911 Ga0496108_0129510 Ga0496108_0129510_1194_1826 210
544 3300048911 Ga0496108_0267611 Ga0496108_0267611_477_1112 210
545 3300048911 Ga0496108_0375112 Ga0496108_0375112_303_938 210
546 3300048912 Ga0496109_0006914 Ga0496109_0006914_1877_2509 210
547 3300048912 Ga0496109_0030836 Ga0496109_0030836_345_977 210
548 3300048913 Ga0496110_0012200 Ga0496110_0012200_254_886 210
549 3300048914 Ga0496111_0078537 Ga0496111_0078537_42_674 210
550 3300048915 Ga0496112_0038413 Ga0496112_0038413_1749_2381 210
551 3300048915 Ga0496112_0062490 Ga0496112_0062490_15_647 210
552 3300048915 Ga0496112_0109776 Ga0496112_0109776_1862_2494 210
553 3300048916 Ga0496113_0206579 Ga0496113_0206579_423_1055 210
554 3300048917 Ga0496114_0000108 Ga0496114_0000108_30150_30782 210
555 3300048917 Ga0496114_0504992 Ga0496114_0504992_149_781 210
556 3300048918 Ga0496115_0003184 Ga0496115_0003184_7980_8612 210
557 3300048924 Ga0496121_0163363 Ga0496121_0163363_90_728 210
558 3300048928 Ga0496125_0289024 Ga0496125_0289024_21_659 210
559 3300048929 Ga0496126_0052964 Ga0496126_0052964_509_1147 210
560 3300050490 nmdc:mga03n38_25562_c1 nmdc:mga03n38_25562_c1_884_1516 210
561 3300050490 nmdc:mga03n38_56339_c1 nmdc:mga03n38_56339_c1_859_1491 210
562 3300050490 nmdc:mga03n38_57938_c1 nmdc:mga03n38_57938_c1_968_1600 210
563 3300050490 nmdc:mga03n38_99674_c1 nmdc:mga03n38_99674_c1_161_793 210
564 3300050491 nmdc:mga00v17_10899_c1 nmdc:mga00v17_10899_c1_2305_2937 210
565 3300050491 nmdc:mga00v17_145410_c1 nmdc:mga00v17_145410_c1_466_1104 210
566 3300050491 nmdc:mga00v17_14640_c1 nmdc:mga00v17_14640_c1_3690_4322 210
567 3300050491 nmdc:mga00v17_35209_c1 nmdc:mga00v17_35209_c1_1564_2196 210
568 3300050491 nmdc:mga00v17_87758_c2 nmdc:mga00v17_87758_c2_309_944 210
569 3300050492 nmdc:mga0yw44_33553_c1 nmdc:mga0yw44_33553_c1_916_1548 210
570 3300050492 nmdc:mga0yw44_46269_c1 nmdc:mga0yw44_46269_c1_1541_2173 210
571 3300050492 nmdc:mga0yw44_81985_c1 nmdc:mga0yw44_81985_c1_1270_1902 210
572 3300050495 nmdc:mga04h51_121500_c1 nmdc:mga04h51_121500_c1_30_662 210
573 3300050495 nmdc:mga04h51_29663_c1 nmdc:mga04h51_29663_c1_847_1479 210
574 3300050496 nmdc:mga07m45_50288_c1 nmdc:mga07m45_50288_c1_11_643 210
575 3300050496 nmdc:mga07m45_57845_c1 nmdc:mga07m45_57845_c1_1103_1735 210
576 3300050507 nmdc:mga05p37_27189_c1 nmdc:mga05p37_27189_c1_6018_6650 210
577 3300050509 nmdc:mga0qj67_7908_c1 nmdc:mga0qj67_7908_c1_1800_2432 210
578 3300050510 nmdc:mga06r32_16370_c1 nmdc:mga06r32_16370_c1_1683_2315 210
579 3300050516 nmdc:mga0sz30_23826_c1 nmdc:mga0sz30_23826_c1_634_1266 210
580 3300050516 nmdc:mga0sz30_673_c1 nmdc:mga0sz30_673_c1_9698_10330 210
581 3300053086 Ga0500578_0124242 Ga0500578_0124242_455_1093 210
582 3300053119 Ga0500595_107567 Ga0500595_107567_141_779 210
583 3300053130 Ga0500642_0167494 Ga0500642_0167494_183_821 210
584 3300053131 Ga0500652_184953 Ga0500652_184953_150_788 210
585 3300053139 Ga0500568_0060508 Ga0500568_0060508_778_1416 210
586 3300053730 Ga0500645_000075 Ga0500645_000075_66435_67073 210
587 3300061719 Ga0466962_0021450 Ga0466962_0021450_1008_1640 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07884

VKOR

Vitamin K epoxide reductase family

30

163

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wv8-assembly1.cif.gz_A takifugu rubripes vkor-like c138s mutant with vitamin k1 0.7976 28 164
6wvb-assembly1.cif.gz_A takifugu rubripes vkor-like with warfarin 0.789 20 172
4nv5-assembly2.cif.gz_B c50a mutant of synechococcus vkor, c2 crystal form (dehydrated) 0.7567 28 163
6wvh-assembly1.cif.gz_A human vkor with brodifacoum 0.7436 21 166
4nv2-assembly1.cif.gz_A c50a mutant of synechococcus vkor, c2221 crystal form 0.69 32 162
ID Description Score Start End Superfamily
af_I6X5W1_15_164_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.9238 22 169 1.20.1440.130
af_I6X5W1_15_164_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.9071 22 169 1.20.1440.130
af_A1ZAJ5_3_151_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8327 25 168 1.20.1440.130
af_A1ZAJ5_3_151_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8013 25 168 1.20.1440.130
af_Q9BQB6_5_161_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.7813 32 166 1.20.1440.130
ID Description Score Start End GO Terms
AF-A0A7I8A2P0-F1-model_v4 deleted 0.9433 20 210
AF-A0A809GZ87-F1-model_v4 deleted 0.9396 24 210
AF-A0A6H0SF72-F1-model_v4 Vitamin K epoxide reductase family protein 0.9355 24 210 GO:0016020
GO:0016491
GO:0048038
AF-A0A1E7Y8L0-F1-model_v4 deleted 0.9345 24 210
AF-A0A433ALH1-F1-model_v4 deleted 0.9307 20 210

Feature Viewer

pLDDT pTM Quality
83.53 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map