F466740

General Info

Members Datasets Scaffolds Average Seq Length
588 280 1177 224

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100017309|Ga0070690_1000173092
Length 247
Sequence LSGQDGDANNAPGATPAPAIASDELPRSVAPELPAQRYIVVEGPIGVGKTSLAKRLATTLDAEMVLEQDAQNPFLERFYKNPKSGALPAQLFFLFQRAQQLGSLKQQDLFAPRRVADYLFEKDRLFAGLTLDPAEMALYDQVASRLEVDPPRPDLVLYLQAPVETLLARIAKRGISYESGIDAAYLSRLNDAYARFFHAYERAPLLIVNASNIDPVQNQADYDELVGAIRRMKKGRMYYNPLRHGTI

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
135 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
136 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
137 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
141 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
156 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
160 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
171 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
172 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
173 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
188 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
189 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
190 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
193 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
194 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
195 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
227 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
262 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
263 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
264 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
265 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
266 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
267 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
268 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
269 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
270 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
271 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
272 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
273 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
274 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
275 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
276 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
277 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 1.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.91
Nodule 0
Rhizoplane 2.89
Rhizosphere 84.69
Stem 0
Stem Tuber 0
Unclassified 3.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100017309 3300005330 Bacteria 4332
2 rootH1_10078733 3300003316 Bacteria 1995
3 rootH1_10078733 3300003323 Bacteria 3046
4 rootL2_10077005 3300003322 Bacteria 2481
5 rootL2_10158346 3300003322 Unclassified 2716
6 Ga0065707_10097348 3300005295 Bacteria 3182
7 Ga0070676_10109369 3300005328 Bacteria 1719
8 Ga0070683_100051536 3300005329 Bacteria 3811
9 Ga0070690_100016853 3300005330 Bacteria 4386
10 Ga0070670_100065183 3300005331 Bacteria 3125
11 Ga0070670_100072820 3300005331 Bacteria 2951
12 Ga0070670_100307134 3300005331 Bacteria 1388
13 Ga0068869_100185029 3300005334 Bacteria 1635
14 Ga0068869_100257341 3300005334 Bacteria 1396
15 Ga0068869_100379619 3300005334 Bacteria 1158
16 Ga0068869_100442591 3300005334 Bacteria 1076
17 Ga0070666_10001535 3300005335 Bacteria 14031
18 Ga0070666_10026183 3300005335 Bacteria 3807
19 Ga0070666_10136564 3300005335 Bacteria 1706
20 Ga0070666_10309938 3300005335 Bacteria 1125
21 Ga0070680_100059064 3300005336 Bacteria 3137
22 Ga0070680_100060253 3300005336 Bacteria 3106
23 Ga0070680_100157549 3300005336 Bacteria 1908
24 Ga0070680_100578799 3300005336 Bacteria 963
25 Ga0070682_100007974 3300005337 Bacteria 5961
26 Ga0070682_100048111 3300005337 Bacteria 2654
27 Ga0070682_100068239 3300005337 Bacteria 2267
28 Ga0070682_100120263 3300005337 Bacteria 1762
29 Ga0070682_100177590 3300005337 Bacteria 1485
30 Ga0070682_100357576 3300005337 Bacteria 1091
31 Ga0068868_100697599 3300005338 Bacteria 908
32 Ga0070689_100000970 3300005340 Bacteria 17916
33 Ga0070668_100272253 3300005347 Bacteria 1412
34 Ga0070668_100406247 3300005347 Bacteria 1164
35 Ga0070669_100176575 3300005353 Bacteria 1668
36 Ga0070675_100005809 3300005354 Bacteria 9446
37 Ga0070675_100040137 3300005354 Bacteria 3820
38 Ga0070675_100419768 3300005354 Bacteria 1196
39 Ga0070671_100012533 3300005355 Bacteria 6827
40 Ga0070671_100081583 3300005355 Bacteria 2704
41 Ga0070671_100127140 3300005355 Bacteria 2146
42 Ga0070671_100204750 3300005355 Bacteria 1674
43 Ga0070674_100008440 3300005356 Bacteria 6134
44 Ga0070674_100080904 3300005356 Bacteria 2320
45 Ga0070673_100004432 3300005364 Bacteria 8883
46 Ga0070673_100141624 3300005364 Bacteria 2029
47 Ga0070688_100215021 3300005365 Bacteria 1352
48 Ga0070667_100000046 3300005367 Bacteria 162942
49 Ga0070667_100004298 3300005367 Bacteria 12030
50 Ga0070667_100025518 3300005367 Bacteria 4913
51 Ga0070667_100346317 3300005367 Bacteria 1344
52 Ga0070667_100397595 3300005367 Unclassified 1254
53 Ga0070701_10029495 3300005438 Bacteria 2707
54 Ga0070700_100276465 3300005441 Bacteria 1216
55 Ga0070663_100134940 3300005455 Bacteria 1878
56 Ga0070678_100015240 3300005456 Bacteria 4880
57 Ga0070662_100401758 3300005457 Bacteria 1131
58 Ga0070681_10006034 3300005458 Bacteria 11742
59 Ga0070681_10014961 3300005458 Bacteria 7715
60 Ga0070681_10023874 3300005458 Bacteria 6156
61 Ga0070681_10050294 3300005458 Bacteria 4159
62 Ga0070681_10059069 3300005458 Bacteria 3814
63 Ga0068867_100044834 3300005459 Bacteria 3241
64 Ga0068867_100089304 3300005459 Bacteria 2337
65 Ga0070685_10154297 3300005466 Bacteria 1458
66 Ga0070685_10246340 3300005466 Bacteria 1182
67 Ga0070698_100111479 3300005471 Bacteria 2701
68 Ga0070699_100135192 3300005518 Bacteria 2175
69 Ga0070679_100002834 3300005530 Bacteria 15763
70 Ga0070679_100007945 3300005530 Bacteria 9955
71 Ga0070679_100008323 3300005530 Bacteria 9756
72 Ga0070679_100092590 3300005530 Bacteria 3010
73 Ga0070679_100105239 3300005530 Bacteria 2808
74 Ga0070679_100453429 3300005530 Bacteria 1227
75 Ga0070684_100065387 3300005535 Bacteria 3192
76 Ga0068853_100011042 3300005539 Bacteria 7326
77 Ga0068853_100043473 3300005539 Bacteria 3843
78 Ga0070672_100309004 3300005543 Bacteria 1342
79 Ga0070672_100337880 3300005543 Bacteria 1282
80 Ga0070686_100037822 3300005544 Bacteria 2996
81 Ga0070686_100040894 3300005544 Bacteria 2894
82 Ga0070686_100208622 3300005544 Bacteria 1405
83 Ga0070696_100129510 3300005546 Bacteria 1835
84 Ga0070693_100302908 3300005547 Bacteria 1078
85 Ga0070665_100010271 3300005548 Bacteria 9472
86 Ga0070665_100013262 3300005548 Bacteria 8300
87 Ga0070665_100127118 3300005548 Bacteria 2551
88 Ga0070665_100132283 3300005548 Bacteria 2497
89 Ga0070665_100158512 3300005548 Bacteria 2265
90 Ga0070665_100248194 3300005548 Bacteria 1780
91 Ga0070704_100077580 3300005549 Bacteria 2434
92 Ga0068855_100021143 3300005563 Bacteria 7801
93 Ga0068855_100034920 3300005563 Bacteria 5992
94 Ga0068855_100062063 3300005563 Bacteria 4364
95 Ga0070664_100021672 3300005564 Bacteria 5298
96 Ga0068856_100435082 3300005614 Bacteria 1332
97 Ga0068856_100688778 3300005614 Bacteria 1042
98 Ga0070702_100242369 3300005615 Bacteria 1217
99 Ga0068859_100001036 3300005617 Bacteria 28486
100 Ga0068859_100082933 3300005617 Bacteria 3248
101 Ga0068859_100112658 3300005617 Bacteria 2784
102 Ga0068859_100368533 3300005617 Bacteria 1532
103 Ga0068864_100036217 3300005618 Bacteria 4205
104 Ga0068864_100126239 3300005618 Bacteria 2293
105 Ga0068864_100318821 3300005618 Unclassified 1459
106 Ga0068864_100445407 3300005618 Bacteria 1238
107 Ga0068866_10072175 3300005718 Bacteria 1828
108 Ga0068866_10073160 3300005718 Bacteria 1818
109 Ga0068861_100006173 3300005719 Bacteria 8152
110 Ga0068861_100101031 3300005719 Bacteria 2294
111 Ga0068851_10078802 3300005834 Bacteria 1717
112 Ga0068870_10005807 3300005840 Bacteria 5412
113 Ga0068863_100053625 3300005841 Bacteria 3823
114 Ga0068863_100126084 3300005841 Bacteria 2442
115 Ga0068863_100160687 3300005841 Bacteria 2152
116 Ga0068863_100268339 3300005841 Bacteria 1651
117 Ga0068858_100001941 3300005842 Bacteria 21094
118 Ga0068858_100003834 3300005842 Bacteria 14870
119 Ga0068858_100055281 3300005842 Bacteria 3669
120 Ga0068858_100180559 3300005842 Bacteria 1993
121 Ga0068858_100529697 3300005842 Bacteria 1140
122 Ga0068860_100001634 3300005843 Bacteria 24021
123 Ga0068860_100014745 3300005843 Bacteria 7642
124 Ga0068860_100033703 3300005843 Bacteria 4913
125 Ga0068860_100042274 3300005843 Bacteria 4354
126 Ga0068860_101076044 3300005843 Bacteria 823
127 Ga0068862_100029580 3300005844 Bacteria 4616
128 Ga0068862_100073518 3300005844 Bacteria 2955
129 Ga0068862_100607717 3300005844 Bacteria 1051
130 Ga0081455_10000066 3300005937 Bacteria 115221
131 Ga0081539_10000865 3300005985 Bacteria 57960
132 Ga0097621_100006436 3300006237 Bacteria 8337
133 Ga0097621_100084547 3300006237 Bacteria 2645
134 Ga0097621_100154481 3300006237 Bacteria 1969
135 Ga0097621_100490619 3300006237 Bacteria 1111
136 Ga0068871_100004121 3300006358 Bacteria 10052
137 Ga0068871_100162969 3300006358 Bacteria 1908
138 Ga0068871_100418249 3300006358 Bacteria 1196
139 Ga0068871_100766159 3300006358 Unclassified 888
140 Ga0068865_100080570 3300006881 Bacteria 2335
141 Ga0068865_100312753 3300006881 Bacteria 1261
142 Ga0097620_100001036 3300006931 Bacteria 28486
143 Ga0097620_100082935 3300006931 Bacteria 3248
144 Ga0097620_100112654 3300006931 Bacteria 2784
145 Ga0097620_100368548 3300006931 Bacteria 1532
146 Ga0105240_10009095 3300009093 Bacteria 14103
147 Ga0105240_10010581 3300009093 Bacteria 12960
148 Ga0105240_10013379 3300009093 Bacteria 11267
149 Ga0105240_10013388 3300009093 Bacteria 11265
150 Ga0105240_10032995 3300009093 Bacteria 6694
151 Ga0105240_10081383 3300009093 Bacteria 3980
152 Ga0105240_10096603 3300009093 Bacteria 3601
153 Ga0105240_10227026 3300009093 Bacteria 2172
154 Ga0105240_10301653 3300009093 Unclassified 1832
155 Ga0105240_10904540 3300009093 Bacteria 949
156 Ga0111539_10050878 3300009094 Bacteria 4936
157 Ga0111539_10261896 3300009094 Bacteria 2013
158 Ga0111539_11135651 3300009094 Bacteria 908
159 Ga0111539_11151023 3300009094 Unclassified 901
160 Ga0105245_10005344 3300009098 Bacteria 11282
161 Ga0105245_10434728 3300009098 Bacteria 1318
162 Ga0105247_10000405 3300009101 Bacteria 36600
163 Ga0105247_10005625 3300009101 Bacteria 7865
164 Ga0105243_10488056 3300009148 Bacteria 1164
165 Ga0105241_10245966 3300009174 Bacteria 1514
166 Ga0105241_10369152 3300009174 Unclassified 1251
167 Ga0105241_10632406 3300009174 Bacteria 970
168 Ga0105242_10227655 3300009176 Bacteria 1669
169 Ga0105242_10804957 3300009176 Bacteria 931
170 Ga0105248_10010798 3300009177 Bacteria 10083
171 Ga0105248_10016197 3300009177 Bacteria 8205
172 Ga0105248_10128766 3300009177 Bacteria 2856
173 Ga0105248_10189275 3300009177 Bacteria 2319
174 Ga0105237_10041233 3300009545 Bacteria 4657
175 Ga0105237_10083231 3300009545 Bacteria 3191
176 Ga0105237_10264587 3300009545 Bacteria 1723
177 Ga0105237_10289181 3300009545 Bacteria 1642
178 Ga0105237_10292799 3300009545 Bacteria 1631
179 Ga0105237_10612446 3300009545 Unclassified 1096
180 Ga0105238_10003358 3300009551 Bacteria 15967
181 Ga0105238_10016635 3300009551 Bacteria 7449
182 Ga0105238_10113918 3300009551 Bacteria 2684
183 Ga0105238_10552086 3300009551 Bacteria 1156
184 Ga0105238_11288263 3300009551 Bacteria 756
185 Ga0105249_10005407 3300009553 Bacteria 11025
186 Ga0099796_10000033 3300010159 Bacteria 31267
187 Ga0105239_10057598 3300010375 Bacteria 4263
188 Ga0105239_10942525 3300010375 Bacteria 991
189 Ga0157370_10010976 3300013104 Bacteria 9503
190 Ga0157369_10012297 3300013105 Bacteria 9722
191 Ga0157369_10016055 3300013105 Bacteria 8425
192 Ga0157369_10099416 3300013105 Bacteria 3102
193 Ga0157374_10008253 3300013296 Bacteria 8893
194 Ga0157374_10115784 3300013296 Bacteria 2583
195 Ga0157374_10307555 3300013296 Bacteria 1569
196 Ga0157378_10561993 3300013297 Bacteria 1148
197 Ga0163162_10027380 3300013306 Bacteria 5637
198 Ga0163162_10078295 3300013306 Bacteria 3371
199 Ga0163162_10328419 3300013306 Bacteria 1662
200 Ga0157372_10089555 3300013307 Bacteria 3496
201 Ga0157372_10154214 3300013307 Bacteria 2653
202 Ga0157375_10013869 3300013308 Bacteria 7185
203 Ga0157375_10146715 3300013308 Bacteria 2490
204 Ga0157375_10172471 3300013308 Bacteria 2311
205 Ga0163163_10006183 3300014325 Bacteria 10440
206 Ga0163163_10028973 3300014325 Bacteria 5323
207 Ga0163163_10094816 3300014325 Bacteria 3003
208 Ga0163163_10102699 3300014325 Bacteria 2883
209 Ga0163163_10243819 3300014325 Bacteria 1847
210 Ga0163163_10275068 3300014325 Bacteria 1735
211 Ga0163163_10427829 3300014325 Bacteria 1383
212 Ga0163163_10715331 3300014325 Bacteria 1065
213 Ga0157380_10042498 3300014326 Bacteria 3553
214 Ga0157380_10153032 3300014326 Bacteria 1996
215 Ga0157380_10418717 3300014326 Bacteria 1277
216 Ga0157380_10540020 3300014326 Bacteria 1141
217 Ga0157380_10649665 3300014326 Bacteria 1052
218 Ga0157379_10001269 3300014968 Bacteria 20517
219 Ga0157379_10032970 3300014968 Bacteria 4619
220 Ga0157379_10035014 3300014968 Bacteria 4475
221 Ga0157379_10244053 3300014968 Bacteria 1629
222 Ga0157379_10858087 3300014968 Bacteria 859
223 Ga0157376_10007642 3300014969 Bacteria 7740
224 Ga0157376_10135272 3300014969 Bacteria 2205
225 Ga0157376_10385307 3300014969 Bacteria 1351
226 Ga0163161_10032868 3300017792 Bacteria 3706
227 Ga0207426_1056944 3300025302 Bacteria 1140
228 Ga0207682_10001100 3300025893 Bacteria 12497
229 Ga0207682_10014024 3300025893 Bacteria 3122
230 Ga0207710_10006371 3300025900 Bacteria 5044
231 Ga0207710_10016599 3300025900 Bacteria 3117
232 Ga0207688_10195379 3300025901 Bacteria 1212
233 Ga0207680_10023913 3300025903 Bacteria 3345
234 Ga0207680_10098721 3300025903 Bacteria 1872
235 Ga0207647_10007093 3300025904 Bacteria 8128
236 Ga0207647_10168813 3300025904 Bacteria 1274
237 Ga0207707_10000202 3300025912 Bacteria 63576
238 Ga0207707_10024926 3300025912 Bacteria 5233
239 Ga0207707_10027802 3300025912 Bacteria 4945
240 Ga0207707_10029872 3300025912 Bacteria 4766
241 Ga0207707_10051928 3300025912 Bacteria 3570
242 Ga0207695_10013342 3300025913 Bacteria 9805
243 Ga0207695_10018457 3300025913 Bacteria 8069
244 Ga0207695_10058846 3300025913 Bacteria 3988
245 Ga0207695_10182664 3300025913 Bacteria 2018
246 Ga0207671_10026404 3300025914 Bacteria 4352
247 Ga0207671_10083971 3300025914 Bacteria 2391
248 Ga0207671_10143168 3300025914 Bacteria 1843
249 Ga0207671_10153349 3300025914 Bacteria 1781
250 Ga0207671_10205977 3300025914 Bacteria 1537
251 Ga0207671_10397106 3300025914 Unclassified 1096
252 Ga0207671_10703808 3300025914 Bacteria 803
253 Ga0207660_10001921 3300025917 Bacteria 13857
254 Ga0207660_10016606 3300025917 Bacteria 4876
255 Ga0207660_10147156 3300025917 Bacteria 1806
256 Ga0207660_10174608 3300025917 Bacteria 1665
257 Ga0207660_10183773 3300025917 Bacteria 1625
258 Ga0207660_10335379 3300025917 Bacteria 1210
259 Ga0207660_10410726 3300025917 Bacteria 1091
260 Ga0207662_10518773 3300025918 Bacteria 822
261 Ga0207652_10002554 3300025921 Bacteria 15274
262 Ga0207652_10014305 3300025921 Bacteria 6426
263 Ga0207652_10084025 3300025921 Bacteria 2788
264 Ga0207652_10537791 3300025921 Bacteria 1051
265 Ga0207694_10001276 3300025924 Bacteria 21700
266 Ga0207694_10062777 3300025924 Bacteria 2893
267 Ga0207650_10083396 3300025925 Bacteria 2428
268 Ga0207659_10148558 3300025926 Bacteria 1828
269 Ga0207659_10348992 3300025926 Bacteria 1227
270 Ga0207687_10031241 3300025927 Bacteria 3598
271 Ga0207644_10003260 3300025931 Bacteria 10479
272 Ga0207644_10123137 3300025931 Bacteria 1977
273 Ga0207690_10411943 3300025932 Bacteria 1080
274 Ga0207686_10074724 3300025934 Bacteria 2191
275 Ga0207686_10236207 3300025934 Bacteria 1328
276 Ga0207686_10341897 3300025934 Bacteria 1124
277 Ga0207670_10003841 3300025936 Bacteria 8004
278 Ga0207669_10025535 3300025937 Bacteria 3195
279 Ga0207669_10126033 3300025937 Bacteria 1749
280 Ga0207669_10362876 3300025937 Bacteria 1123
281 Ga0207669_10397106 3300025937 Bacteria 1079
282 Ga0207704_10040529 3300025938 Bacteria 2723
283 Ga0207665_10774252 3300025939 Bacteria 757
284 Ga0207691_10008381 3300025940 Bacteria 9932
285 Ga0207691_10077038 3300025940 Bacteria 3005
286 Ga0207691_10096010 3300025940 Bacteria 2651
287 Ga0207691_10137224 3300025940 Bacteria 2157
288 Ga0207711_10007514 3300025941 Bacteria 9116
289 Ga0207711_10106062 3300025941 Bacteria 2493
290 Ga0207711_10401807 3300025941 Bacteria 1273
291 Ga0207689_10011716 3300025942 Bacteria 7515
292 Ga0207689_10042489 3300025942 Bacteria 3760
293 Ga0207689_10066683 3300025942 Bacteria 2958
294 Ga0207689_10152579 3300025942 Bacteria 1904
295 Ga0207661_10097037 3300025944 Bacteria 2467
296 Ga0207661_10532340 3300025944 Bacteria 1075
297 Ga0207679_10016327 3300025945 Bacteria 4929
298 Ga0207667_10008662 3300025949 Bacteria 12062
299 Ga0207667_10031520 3300025949 Bacteria 5722
300 Ga0207667_10041440 3300025949 Bacteria 4897
301 Ga0207667_10231346 3300025949 Bacteria 1893
302 Ga0207651_10113526 3300025960 Bacteria 2039
303 Ga0207668_10432291 3300025972 Bacteria 1120
304 Ga0207640_10176228 3300025981 Bacteria 1598
305 Ga0207640_10373391 3300025981 Bacteria 1153
306 Ga0207658_10000058 3300025986 Bacteria 122331
307 Ga0207658_10013810 3300025986 Bacteria 5524
308 Ga0207658_10027095 3300025986 Bacteria 4024
309 Ga0207677_10102163 3300026023 Bacteria 2113
310 Ga0207677_10409298 3300026023 Bacteria 1152
311 Ga0207703_10001252 3300026035 Bacteria 23795
312 Ga0207703_10004755 3300026035 Bacteria 11072
313 Ga0207703_10066600 3300026035 Bacteria 2963
314 Ga0207703_10462033 3300026035 Bacteria 1187
315 Ga0207703_10468573 3300026035 Bacteria 1179
316 Ga0207703_10697174 3300026035 Bacteria 965
317 Ga0207639_10225082 3300026041 Bacteria 1622
318 Ga0207639_10247252 3300026041 Bacteria 1554
319 Ga0207708_10140890 3300026075 Bacteria 1891
320 Ga0207702_10280119 3300026078 Bacteria 1576
321 Ga0207702_10380273 3300026078 Bacteria 1358
322 Ga0207641_10000686 3300026088 Bacteria 36529
323 Ga0207641_10035019 3300026088 Bacteria 4180
324 Ga0207641_10218140 3300026088 Bacteria 1767
325 Ga0207641_10241166 3300026088 Bacteria 1684
326 Ga0207641_10931125 3300026088 Bacteria 864
327 Ga0207648_10023611 3300026089 Bacteria 5505
328 Ga0207648_10239402 3300026089 Bacteria 1615
329 Ga0207676_10039485 3300026095 Bacteria 3611
330 Ga0207676_10639436 3300026095 Bacteria 1025
331 Ga0207675_100003297 3300026118 Bacteria 15798
332 Ga0207675_100010948 3300026118 Bacteria 8497
333 Ga0207675_100066380 3300026118 Bacteria 3372
334 Ga0207675_100066588 3300026118 Bacteria 3367
335 Ga0207675_100231274 3300026118 Bacteria 1784
336 Ga0207675_100273287 3300026118 Bacteria 1640
337 Ga0207675_100314110 3300026118 Bacteria 1529
338 Ga0207675_100640192 3300026118 Bacteria 1069
339 Ga0207683_10011701 3300026121 Bacteria 7490
340 Ga0207698_10093881 3300026142 Bacteria 2465
341 Ga0209179_1000074 3300027512 Bacteria 16239
342 Ga0268266_10001499 3300028379 Bacteria 27597
343 Ga0268266_10013069 3300028379 Bacteria 7159
344 Ga0268266_10023102 3300028379 Bacteria 5292
345 Ga0268266_10028365 3300028379 Bacteria 4759
346 Ga0268266_10072671 3300028379 Bacteria 2983
347 Ga0268266_10101267 3300028379 Bacteria 2539
348 Ga0268266_10319179 3300028379 Bacteria 1453
349 Ga0268265_10009908 3300028380 Bacteria 6439
350 Ga0268265_10407167 3300028380 Bacteria 1259
351 Ga0268264_10000952 3300028381 Bacteria 29848
352 Ga0268264_10016360 3300028381 Bacteria 6072
353 Ga0268264_10127777 3300028381 Bacteria 2249
354 Ga0268264_10626046 3300028381 Bacteria 1063
355 Ga0265326_10051174 3300028558 Bacteria 1170
356 Ga0265319_1014340 3300028563 Bacteria 3113
357 Ga0265334_10011770 3300028573 Bacteria 3676
358 Ga0265318_10002601 3300028577 Bacteria 9553
359 Ga0307515_10042097 3300028794 Bacteria 7158
360 Ga0307515_10122612 3300028794 Bacteria 2930
361 Ga0307515_10428182 3300028794 Bacteria 942
362 Ga0265338_10020393 3300028800 Bacteria 6973
363 Ga0265338_10031255 3300028800 Bacteria 5222
364 Ga0265338_10034135 3300028800 Bacteria 4922
365 Ga0307511_10000008 3300030521 Bacteria 159928
366 Ga0307511_10003812 3300030521 Bacteria 15441
367 Ga0265760_10130870 3300031090 Bacteria 811
368 Ga0265330_10030296 3300031235 Bacteria 2430
369 Ga0265330_10040106 3300031235 Bacteria 2080
370 Ga0265332_10009412 3300031238 Bacteria 4360
371 Ga0265328_10000034 3300031239 Bacteria 99505
372 Ga0265328_10004462 3300031239 Bacteria 6081
373 Ga0265320_10020266 3300031240 Bacteria 3608
374 Ga0265325_10004811 3300031241 Bacteria 8453
375 Ga0265329_10010509 3300031242 Bacteria 3392
376 Ga0265340_10008875 3300031247 Bacteria 5418
377 Ga0265340_10051432 3300031247 Bacteria 1995
378 Ga0265331_10007733 3300031250 Bacteria 6181
379 Ga0265331_10022101 3300031250 Bacteria 3249
380 Ga0265316_10008185 3300031344 Bacteria 9729
381 Ga0307513_10006228 3300031456 Bacteria 15632
382 Ga0307513_10015141 3300031456 Bacteria 9362
383 Ga0307513_10046818 3300031456 Bacteria 4711
384 Ga0307513_10105842 3300031456 Bacteria 2821
385 Ga0307513_10149528 3300031456 Bacteria 2247
386 Ga0307509_10000099 3300031507 Bacteria 121307
387 Ga0307509_10032265 3300031507 Bacteria 5772
388 Ga0307509_10437374 3300031507 Bacteria 1005
389 Ga0307408_100272358 3300031548 Bacteria 1406
390 Ga0265313_10004747 3300031595 Bacteria 10245
391 Ga0316575_10001612 3300031665 Bacteria 7349
392 Ga0316575_10100764 3300031665 Bacteria 1174
393 Ga0316579_10027273 3300031691 Bacteria 2592
394 Ga0316579_10034654 3300031691 Bacteria 2323
395 Ga0316579_10044322 3300031691 Bacteria 2071
396 Ga0265314_10004021 3300031711 Bacteria 13902
397 Ga0265342_10007718 3300031712 Bacteria 7831
398 Ga0316576_10002904 3300031727 Bacteria 9902
399 Ga0316578_10027739 3300031728 Bacteria 3202
400 Ga0307405_10269100 3300031731 Bacteria 1277
401 Ga0307405_10309579 3300031731 Bacteria 1202
402 Ga0316577_10004317 3300031733 Bacteria 7325
403 Ga0316577_10018749 3300031733 Bacteria 3828
404 Ga0316577_10101801 3300031733 Bacteria 1610
405 Ga0307410_10008054 3300031852 Bacteria 5818
406 Ga0307410_10217438 3300031852 Bacteria 1468
407 Ga0307406_10018961 3300031901 Bacteria 4030
408 Ga0307407_10012548 3300031903 Bacteria 4077
409 Ga0307409_100000358 3300031995 Bacteria 19037
410 Ga0307409_100099583 3300031995 Bacteria 2407
411 Ga0307409_100139872 3300031995 Bacteria 2084
412 Ga0307416_100037261 3300032002 Bacteria 3740
413 Ga0307411_10003381 3300032005 Bacteria 7388
414 Ga0307411_10138442 3300032005 Bacteria 1791
415 Ga0307415_100059783 3300032126 Bacteria 2630
416 Ga0307415_100297677 3300032126 Bacteria 1335
417 Ga0316583_10018691 3300032133 Bacteria 2489
418 Ga0316585_10000034 3300032137 Bacteria 20549
419 Ga0316580_10028994 3300032139 Bacteria 1711
420 Ga0316593_10001282 3300032168 Bacteria 5456
421 Ga0316593_10001298 3300032168 Bacteria 5438
422 Ga0316593_10008210 3300032168 Bacteria 2902
423 Ga0316593_10008934 3300032168 Bacteria 2814
424 Ga0307510_10000003 3300033180 Bacteria 756654
425 Ga0307510_10011040 3300033180 Bacteria 10736
426 Ga0316587_1017138 3300033529 Bacteria 1212
427 Ga0373936_0008474 3300035113 Bacteria 3872
428 Ga0373936_0018843 3300035113 Bacteria 2669
429 Ga0316574_0007603 3300035398 Bacteria 5953
430 Ga0316574_0038678 3300035398 Bacteria 2930
431 Ga0316574_0068008 3300035398 Bacteria 2246
432 Ga0316574_0084380 3300035398 Bacteria 2020
433 Ga0316574_0113527 3300035398 Bacteria 1737
434 Ga0373927_0233225 3300035695 Bacteria 1209
435 Ga0373937_0264291 3300036401 Bacteria 1623
436 Ga0316582_0000628 3300036647 Bacteria 13752
437 Ga0316582_0018108 3300036647 Bacteria 4092
438 Ga0316582_0033786 3300036647 Bacteria 3144
439 Ga0316582_0095986 3300036647 Bacteria 1957
440 Ga0316582_0152685 3300036647 Bacteria 1561
441 Ga0316584_0004504 3300036712 Bacteria 9221
442 Ga0316584_0009953 3300036712 Bacteria 6624
443 Ga0316584_0030276 3300036712 Bacteria 3998
444 Ga0316584_0037446 3300036712 Bacteria 3604
445 Ga0316584_0108731 3300036712 Bacteria 2075
446 Ga0316584_0192178 3300036712 Unclassified 1508
447 Ga0316584_0328355 3300036712 Bacteria 1102
448 Ga0395900_0211377 3300037418 Bacteria 1959
449 Ga0395898_0002854 3300037466 Bacteria 19754
450 Ga0395898_0010233 3300037466 Bacteria 9820
451 Ga0395905_0033134 3300037471 Bacteria 4855
452 Ga0316581_0013974 3300037588 Bacteria 2282
453 Ga0316581_0036056 3300037588 Bacteria 1500
454 Ga0395901_0666321 3300038443 Unclassified 1042
455 Ga0400490_12526 3300038726 Bacteria 1814
456 Ga0400490_43093 3300038726 Bacteria 1798
457 Ga0400488_63301 3300038741 Bacteria 2440
458 Ga0400483_018001 3300039062 Bacteria 14185
459 Ga0400483_020451 3300039062 Bacteria 3298
460 Ga0400483_043371 3300039062 Bacteria 3559
461 Ga0400483_107284 3300039062 Bacteria 12003
462 Ga0400487_33759 3300039110 Bacteria 1801
463 Ga0436363_0208433 3300039450 Bacteria 824
464 Ga0436363_0558399 3300039450 Bacteria 2174
465 Ga0436363_0636239 3300039450 Bacteria 4716
466 Ga0436363_0662047 3300039450 Unclassified 777
467 Ga0451791_0535150 3300041451 Bacteria 2857
468 Ga0451793_1741406 3300041452 Bacteria 1273
469 Ga0451797_0193299 3300041453 Bacteria 1000
470 Ga0451800_0074724 3300041459 Bacteria 2013
471 Ga0451807_1759770 3300041486 Bacteria 1854
472 Ga0451807_2694916 3300041486 Bacteria 1571
473 Ga0451837_1111894 3300041494 Bacteria 1293
474 Ga0439435_0042816 3300042436 Unclassified 1272
475 Ga0466969_0003281 3300044656 Bacteria 8597
476 Ga0466969_0023068 3300044656 Bacteria 3209
477 Ga0466969_0132329 3300044656 Bacteria 1156
478 Ga0466969_0136838 3300044656 Unclassified 1134
479 Ga0466972_0149688 3300044658 Bacteria 1097
480 Ga0466965_0163160 3300044683 Bacteria 1169
481 Ga0466966_0003884 3300044684 Bacteria 9873
482 Ga0466961_0004155 3300044693 Bacteria 9042
483 Ga0466961_0111711 3300044693 Bacteria 1719
484 Ga0466964_0000322 3300044706 Bacteria 14250
485 Ga0453684_0006330 3300044712 Bacteria 22598
486 Ga0453684_0636626 3300044712 Bacteria 1165
487 Ga0466971_0000163 3300044719 Bacteria 24784
488 Ga0466968_0004465 3300044735 Bacteria 5234
489 Ga0466968_0240961 3300044735 Bacteria 856
490 Ga0466970_0001458 3300044765 Bacteria 11437
491 Ga0466957_0008627 3300044842 Bacteria 5801
492 Ga0466959_0009780 3300045049 Bacteria 6831
493 Ga0466959_0028527 3300045049 Bacteria 4139
494 Ga0466959_0029893 3300045049 Bacteria 4035
495 Ga0466959_0038017 3300045049 Bacteria 3557
496 Ga0466959_0038682 3300045049 Bacteria 3525
497 Ga0466959_0058507 3300045049 Bacteria 2807
498 Ga0466959_0250614 3300045049 Bacteria 1221
499 Ga0466958_0158266 3300045836 Bacteria 1430
500 Ga0466958_0188584 3300045836 Bacteria 1310
501 Ga0466967_0528286 3300045976 Bacteria 1160
502 Ga0495638_0018016 3300046460 Bacteria 4699
503 Ga0495638_0159991 3300046460 Bacteria 1300
504 Ga0495638_0279327 3300046460 Bacteria 908
505 Ga0495650_0092130 3300046471 Bacteria 1151
506 Ga0495616_0000934 3300046513 Bacteria 21031
507 Ga0495620_0173989 3300046515 Bacteria 834
508 Ga0495620_0180196 3300046515 Bacteria 817
509 Ga0495632_0048448 3300046519 Bacteria 2104
510 Ga0495632_0125291 3300046519 Bacteria 1198
511 Ga0495643_0095837 3300046522 Bacteria 1526
512 Ga0495586_0429866 3300046535 Bacteria 761
513 Ga0495656_0189073 3300046615 Bacteria 1016
514 Ga0495668_0070955 3300046616 Bacteria 1915
515 Ga0495611_0115422 3300046648 Bacteria 1251
516 Ga0495625_0190491 3300046660 Bacteria 1359
517 Ga0495671_0388859 3300046692 Bacteria 668
518 Ga0495649_0010587 3300046694 Bacteria 5436
519 Ga0495649_0068914 3300046694 Bacteria 1898
520 Ga0495687_066734 3300047443 Bacteria 1459
521 Ga0495673_0134782 3300047469 Bacteria 968
522 Ga0495686_0120392 3300047472 Bacteria 1565
523 Ga0496100_0119985 3300048903 Bacteria 1838
524 Ga0496103_0056170 3300048906 Bacteria 2443
525 Ga0496104_0036688 3300048907 Bacteria 4583
526 Ga0496105_0027838 3300048908 Bacteria 4621
527 Ga0496106_0533590 3300048909 Unclassified 942
528 Ga0496108_0207084 3300048911 Bacteria 1702
529 Ga0496109_0078879 3300048912 Bacteria 3032
530 Ga0496110_0006513 3300048913 Bacteria 9263
531 Ga0496113_0472251 3300048916 Bacteria 1008
532 Ga0496114_0365691 3300048917 Bacteria 1276
533 Ga0496115_0211974 3300048918 Unclassified 1600
534 Ga0496116_0009411 3300048919 Bacteria 8330
535 Ga0496117_0000095 3300048920 Bacteria 198731
536 Ga0496118_0000003 3300048921 Bacteria 773148
537 Ga0496118_0043134 3300048921 Bacteria 3550
538 Ga0496119_0004503 3300048922 Bacteria 13836
539 Ga0496119_0029878 3300048922 Bacteria 3684
540 Ga0496120_0001668 3300048923 Bacteria 25562
541 Ga0496120_0081013 3300048923 Bacteria 1757
542 Ga0496121_0012447 3300048924 Bacteria 9272
543 Ga0496121_0056370 3300048924 Bacteria 3264
544 Ga0496121_0495731 3300048924 Bacteria 777
545 Ga0496124_0014724 3300048927 Bacteria 7548
546 Ga0496125_0001184 3300048928 Bacteria 39422
547 Ga0496125_0008082 3300048928 Bacteria 11087
548 Ga0496125_0017500 3300048928 Bacteria 6829
549 Ga0496126_0004803 3300048929 Bacteria 15878
550 Ga0496126_0013294 3300048929 Bacteria 8388
551 Ga0496126_0075578 3300048929 Bacteria 2989
552 Ga0496126_0502854 3300048929 Bacteria 968
553 Ga0501037_0328269 3300049573 Bacteria 1058
554 Ga0501067_0061700 3300049583 Bacteria 2075
555 Ga0501068_0001248 3300049584 Bacteria 13516
556 Ga0501070_0503365 3300049586 Bacteria 973
557 Ga0501073_0001455 3300049589 Bacteria 17528
558 Ga0501074_0003600 3300049590 Bacteria 11001
559 Ga0501076_0013600 3300049592 Bacteria 6105
560 Ga0501077_0006792 3300049593 Bacteria 7040
561 Ga0501080_0063768 3300049742 Bacteria 3428
562 Ga0501083_0006145 3300049744 Bacteria 8520
563 Ga0501045_0233028 3300049824 Bacteria 1371
564 nmdc:mga08y16_71831_c1 3300050511 Bacteria 3606
565 Ga0500583_0022188 3300053092 Bacteria 2656
566 Ga0500583_0041236 3300053092 Bacteria 2095
567 Ga0500583_0050839 3300053092 Unclassified 1924
568 Ga0500641_0013857 3300053096 Bacteria 2967
569 Ga0500641_0074306 3300053096 Bacteria 1435
570 Ga0500557_123231 3300053105 Bacteria 860
571 Ga0500572_008055 3300053111 Bacteria 2454
572 Ga0500591_066119 3300053115 Unclassified 1652
573 Ga0500593_066477 3300053117 Bacteria 1574
574 Ga0500614_021210 3300053123 Bacteria 1506
575 Ga0500642_0197465 3300053130 Bacteria 937
576 Ga0500652_151198 3300053131 Unclassified 963
577 Ga0500559_0156425 3300053136 Unclassified 1071
578 Ga0500588_0002731 3300053146 Bacteria 3633
579 Ga0500616_0000030 3300053153 Bacteria 415224
580 Ga0500616_0025301 3300053153 Bacteria 3293
581 Ga0500622_0001888 3300053156 Bacteria 15826
582 Ga0500624_055076 3300053157 Unclassified 748
583 Ga0500639_080785 3300053163 Unclassified 1638
584 Ga0500637_0077310 3300053178 Bacteria 1920
585 Ga0500637_0324263 3300053178 Bacteria 831
586 Ga0500611_028011 3300053727 Bacteria 1140
587 Ga0501084_0004813 3300054114 Bacteria 11032
588 Ga0501082_0012582 3300060353 Bacteria 7272
589 Ga0466962_0000730 3300061719 Bacteria 14723
590 Ga0070690_100017309
591 rootH1_10078733
592 rootL2_10077005
593 rootL2_10158346
594 Ga0065707_10097348
595 Ga0070676_10109369
596 Ga0070683_100051536
597 Ga0070690_100016853
598 Ga0070670_100065183
599 Ga0070670_100072820
600 Ga0070670_100307134
601 Ga0068869_100185029
602 Ga0068869_100257341
603 Ga0068869_100379619
604 Ga0068869_100442591
605 Ga0070666_10001535
606 Ga0070666_10026183
607 Ga0070666_10136564
608 Ga0070666_10309938
609 Ga0070680_100059064
610 Ga0070680_100060253
611 Ga0070680_100157549
612 Ga0070680_100578799
613 Ga0070682_100007974
614 Ga0070682_100048111
615 Ga0070682_100068239
616 Ga0070682_100120263
617 Ga0070682_100177590
618 Ga0070682_100357576
619 Ga0068868_100697599
620 Ga0070689_100000970
621 Ga0070668_100272253
622 Ga0070668_100406247
623 Ga0070669_100176575
624 Ga0070675_100005809
625 Ga0070675_100040137
626 Ga0070675_100419768
627 Ga0070671_100012533
628 Ga0070671_100081583
629 Ga0070671_100127140
630 Ga0070671_100204750
631 Ga0070674_100008440
632 Ga0070674_100080904
633 Ga0070673_100004432
634 Ga0070673_100141624
635 Ga0070688_100215021
636 Ga0070667_100000046
637 Ga0070667_100004298
638 Ga0070667_100025518
639 Ga0070667_100346317
640 Ga0070667_100397595
641 Ga0070701_10029495
642 Ga0070700_100276465
643 Ga0070663_100134940
644 Ga0070678_100015240
645 Ga0070662_100401758
646 Ga0070681_10006034
647 Ga0070681_10014961
648 Ga0070681_10023874
649 Ga0070681_10050294
650 Ga0070681_10059069
651 Ga0068867_100044834
652 Ga0068867_100089304
653 Ga0070685_10154297
654 Ga0070685_10246340
655 Ga0070698_100111479
656 Ga0070699_100135192
657 Ga0070679_100002834
658 Ga0070679_100007945
659 Ga0070679_100008323
660 Ga0070679_100092590
661 Ga0070679_100105239
662 Ga0070679_100453429
663 Ga0070684_100065387
664 Ga0068853_100011042
665 Ga0068853_100043473
666 Ga0070672_100309004
667 Ga0070672_100337880
668 Ga0070686_100037822
669 Ga0070686_100040894
670 Ga0070686_100208622
671 Ga0070696_100129510
672 Ga0070693_100302908
673 Ga0070665_100010271
674 Ga0070665_100013262
675 Ga0070665_100127118
676 Ga0070665_100132283
677 Ga0070665_100158512
678 Ga0070665_100248194
679 Ga0070704_100077580
680 Ga0068855_100021143
681 Ga0068855_100034920
682 Ga0068855_100062063
683 Ga0070664_100021672
684 Ga0068856_100435082
685 Ga0068856_100688778
686 Ga0070702_100242369
687 Ga0068859_100001036
688 Ga0068859_100082933
689 Ga0068859_100112658
690 Ga0068859_100368533
691 Ga0068864_100036217
692 Ga0068864_100126239
693 Ga0068864_100318821
694 Ga0068864_100445407
695 Ga0068866_10072175
696 Ga0068866_10073160
697 Ga0068861_100006173
698 Ga0068861_100101031
699 Ga0068851_10078802
700 Ga0068870_10005807
701 Ga0068863_100053625
702 Ga0068863_100126084
703 Ga0068863_100160687
704 Ga0068863_100268339
705 Ga0068858_100001941
706 Ga0068858_100003834
707 Ga0068858_100055281
708 Ga0068858_100180559
709 Ga0068858_100529697
710 Ga0068860_100001634
711 Ga0068860_100014745
712 Ga0068860_100033703
713 Ga0068860_100042274
714 Ga0068860_101076044
715 Ga0068862_100029580
716 Ga0068862_100073518
717 Ga0068862_100607717
718 Ga0081455_10000066
719 Ga0081539_10000865
720 Ga0097621_100006436
721 Ga0097621_100084547
722 Ga0097621_100154481
723 Ga0097621_100490619
724 Ga0068871_100004121
725 Ga0068871_100162969
726 Ga0068871_100418249
727 Ga0068871_100766159
728 Ga0068865_100080570
729 Ga0068865_100312753
730 Ga0097620_100001036
731 Ga0097620_100082935
732 Ga0097620_100112654
733 Ga0097620_100368548
734 Ga0105240_10009095
735 Ga0105240_10010581
736 Ga0105240_10013379
737 Ga0105240_10013388
738 Ga0105240_10032995
739 Ga0105240_10081383
740 Ga0105240_10096603
741 Ga0105240_10227026
742 Ga0105240_10301653
743 Ga0105240_10904540
744 Ga0111539_10050878
745 Ga0111539_10261896
746 Ga0111539_11135651
747 Ga0111539_11151023
748 Ga0105245_10005344
749 Ga0105245_10434728
750 Ga0105247_10000405
751 Ga0105247_10005625
752 Ga0105243_10488056
753 Ga0105241_10245966
754 Ga0105241_10369152
755 Ga0105241_10632406
756 Ga0105242_10227655
757 Ga0105242_10804957
758 Ga0105248_10010798
759 Ga0105248_10016197
760 Ga0105248_10128766
761 Ga0105248_10189275
762 Ga0105237_10041233
763 Ga0105237_10083231
764 Ga0105237_10264587
765 Ga0105237_10289181
766 Ga0105237_10292799
767 Ga0105237_10612446
768 Ga0105238_10003358
769 Ga0105238_10016635
770 Ga0105238_10113918
771 Ga0105238_10552086
772 Ga0105238_11288263
773 Ga0105249_10005407
774 Ga0099796_10000033
775 Ga0105239_10057598
776 Ga0105239_10942525
777 Ga0157370_10010976
778 Ga0157369_10012297
779 Ga0157369_10016055
780 Ga0157369_10099416
781 Ga0157374_10008253
782 Ga0157374_10115784
783 Ga0157374_10307555
784 Ga0157378_10561993
785 Ga0163162_10027380
786 Ga0163162_10078295
787 Ga0163162_10328419
788 Ga0157372_10089555
789 Ga0157372_10154214
790 Ga0157375_10013869
791 Ga0157375_10146715
792 Ga0157375_10172471
793 Ga0163163_10006183
794 Ga0163163_10028973
795 Ga0163163_10094816
796 Ga0163163_10102699
797 Ga0163163_10243819
798 Ga0163163_10275068
799 Ga0163163_10427829
800 Ga0163163_10715331
801 Ga0157380_10042498
802 Ga0157380_10153032
803 Ga0157380_10418717
804 Ga0157380_10540020
805 Ga0157380_10649665
806 Ga0157379_10001269
807 Ga0157379_10032970
808 Ga0157379_10035014
809 Ga0157379_10244053
810 Ga0157379_10858087
811 Ga0157376_10007642
812 Ga0157376_10135272
813 Ga0157376_10385307
814 Ga0163161_10032868
815 Ga0207426_1056944
816 Ga0207682_10001100
817 Ga0207682_10014024
818 Ga0207710_10006371
819 Ga0207710_10016599
820 Ga0207688_10195379
821 Ga0207680_10023913
822 Ga0207680_10098721
823 Ga0207647_10007093
824 Ga0207647_10168813
825 Ga0207707_10000202
826 Ga0207707_10024926
827 Ga0207707_10027802
828 Ga0207707_10029872
829 Ga0207707_10051928
830 Ga0207695_10013342
831 Ga0207695_10018457
832 Ga0207695_10058846
833 Ga0207695_10182664
834 Ga0207671_10026404
835 Ga0207671_10083971
836 Ga0207671_10143168
837 Ga0207671_10153349
838 Ga0207671_10205977
839 Ga0207671_10397106
840 Ga0207671_10703808
841 Ga0207660_10001921
842 Ga0207660_10016606
843 Ga0207660_10147156
844 Ga0207660_10174608
845 Ga0207660_10183773
846 Ga0207660_10335379
847 Ga0207660_10410726
848 Ga0207662_10518773
849 Ga0207652_10002554
850 Ga0207652_10014305
851 Ga0207652_10084025
852 Ga0207652_10537791
853 Ga0207694_10001276
854 Ga0207694_10062777
855 Ga0207650_10083396
856 Ga0207659_10148558
857 Ga0207659_10348992
858 Ga0207687_10031241
859 Ga0207644_10003260
860 Ga0207644_10123137
861 Ga0207690_10411943
862 Ga0207686_10074724
863 Ga0207686_10236207
864 Ga0207686_10341897
865 Ga0207670_10003841
866 Ga0207669_10025535
867 Ga0207669_10126033
868 Ga0207669_10362876
869 Ga0207669_10397106
870 Ga0207704_10040529
871 Ga0207665_10774252
872 Ga0207691_10008381
873 Ga0207691_10077038
874 Ga0207691_10096010
875 Ga0207691_10137224
876 Ga0207711_10007514
877 Ga0207711_10106062
878 Ga0207711_10401807
879 Ga0207689_10011716
880 Ga0207689_10042489
881 Ga0207689_10066683
882 Ga0207689_10152579
883 Ga0207661_10097037
884 Ga0207661_10532340
885 Ga0207679_10016327
886 Ga0207667_10008662
887 Ga0207667_10031520
888 Ga0207667_10041440
889 Ga0207667_10231346
890 Ga0207651_10113526
891 Ga0207668_10432291
892 Ga0207640_10176228
893 Ga0207640_10373391
894 Ga0207658_10000058
895 Ga0207658_10013810
896 Ga0207658_10027095
897 Ga0207677_10102163
898 Ga0207677_10409298
899 Ga0207703_10001252
900 Ga0207703_10004755
901 Ga0207703_10066600
902 Ga0207703_10462033
903 Ga0207703_10468573
904 Ga0207703_10697174
905 Ga0207639_10225082
906 Ga0207639_10247252
907 Ga0207708_10140890
908 Ga0207702_10280119
909 Ga0207702_10380273
910 Ga0207641_10000686
911 Ga0207641_10035019
912 Ga0207641_10218140
913 Ga0207641_10241166
914 Ga0207641_10931125
915 Ga0207648_10023611
916 Ga0207648_10239402
917 Ga0207676_10039485
918 Ga0207676_10639436
919 Ga0207675_100003297
920 Ga0207675_100010948
921 Ga0207675_100066380
922 Ga0207675_100066588
923 Ga0207675_100231274
924 Ga0207675_100273287
925 Ga0207675_100314110
926 Ga0207675_100640192
927 Ga0207683_10011701
928 Ga0207698_10093881
929 Ga0209179_1000074
930 Ga0268266_10001499
931 Ga0268266_10013069
932 Ga0268266_10023102
933 Ga0268266_10028365
934 Ga0268266_10072671
935 Ga0268266_10101267
936 Ga0268266_10319179
937 Ga0268265_10009908
938 Ga0268265_10407167
939 Ga0268264_10000952
940 Ga0268264_10016360
941 Ga0268264_10127777
942 Ga0268264_10626046
943 Ga0265326_10051174
944 Ga0265319_1014340
945 Ga0265334_10011770
946 Ga0265318_10002601
947 Ga0307515_10042097
948 Ga0307515_10122612
949 Ga0307515_10428182
950 Ga0265338_10020393
951 Ga0265338_10031255
952 Ga0265338_10034135
953 Ga0307511_10000008
954 Ga0307511_10003812
955 Ga0265760_10130870
956 Ga0265330_10030296
957 Ga0265330_10040106
958 Ga0265332_10009412
959 Ga0265328_10000034
960 Ga0265328_10004462
961 Ga0265320_10020266
962 Ga0265325_10004811
963 Ga0265329_10010509
964 Ga0265340_10008875
965 Ga0265340_10051432
966 Ga0265331_10007733
967 Ga0265331_10022101
968 Ga0265316_10008185
969 Ga0307513_10006228
970 Ga0307513_10015141
971 Ga0307513_10046818
972 Ga0307513_10105842
973 Ga0307513_10149528
974 Ga0307509_10000099
975 Ga0307509_10032265
976 Ga0307509_10437374
977 Ga0307408_100272358
978 Ga0265313_10004747
979 Ga0316575_10001612
980 Ga0316575_10100764
981 Ga0316579_10027273
982 Ga0316579_10034654
983 Ga0316579_10044322
984 Ga0265314_10004021
985 Ga0265342_10007718
986 Ga0316576_10002904
987 Ga0316578_10027739
988 Ga0307405_10269100
989 Ga0307405_10309579
990 Ga0316577_10004317
991 Ga0316577_10018749
992 Ga0316577_10101801
993 Ga0307410_10008054
994 Ga0307410_10217438
995 Ga0307406_10018961
996 Ga0307407_10012548
997 Ga0307409_100000358
998 Ga0307409_100099583
999 Ga0307409_100139872
1000 Ga0307416_100037261
1001 Ga0307411_10003381
1002 Ga0307411_10138442
1003 Ga0307415_100059783
1004 Ga0307415_100297677
1005 Ga0316583_10018691
1006 Ga0316585_10000034
1007 Ga0316580_10028994
1008 Ga0316593_10001282
1009 Ga0316593_10001298
1010 Ga0316593_10008210
1011 Ga0316593_10008934
1012 Ga0307510_10000003
1013 Ga0307510_10011040
1014 Ga0316587_1017138
1015 Ga0373936_0008474
1016 Ga0373936_0018843
1017 Ga0316574_0007603
1018 Ga0316574_0038678
1019 Ga0316574_0068008
1020 Ga0316574_0084380
1021 Ga0316574_0113527
1022 Ga0373927_0233225
1023 Ga0373937_0264291
1024 Ga0316582_0000628
1025 Ga0316582_0018108
1026 Ga0316582_0033786
1027 Ga0316582_0095986
1028 Ga0316582_0152685
1029 Ga0316584_0004504
1030 Ga0316584_0009953
1031 Ga0316584_0030276
1032 Ga0316584_0037446
1033 Ga0316584_0108731
1034 Ga0316584_0192178
1035 Ga0316584_0328355
1036 Ga0395900_0211377
1037 Ga0395898_0002854
1038 Ga0395898_0010233
1039 Ga0395905_0033134
1040 Ga0316581_0013974
1041 Ga0316581_0036056
1042 Ga0395901_0666321
1043 Ga0400490_12526
1044 Ga0400490_43093
1045 Ga0400488_63301
1046 Ga0400483_018001
1047 Ga0400483_020451
1048 Ga0400483_043371
1049 Ga0400483_107284
1050 Ga0400487_33759
1051 Ga0436363_0208433
1052 Ga0436363_0558399
1053 Ga0436363_0636239
1054 Ga0436363_0662047
1055 Ga0451791_0535150
1056 Ga0451793_1741406
1057 Ga0451797_0193299
1058 Ga0451800_0074724
1059 Ga0451807_1759770
1060 Ga0451807_2694916
1061 Ga0451837_1111894
1062 Ga0439435_0042816
1063 Ga0466969_0003281
1064 Ga0466969_0023068
1065 Ga0466969_0132329
1066 Ga0466969_0136838
1067 Ga0466972_0149688
1068 Ga0466965_0163160
1069 Ga0466966_0003884
1070 Ga0466961_0004155
1071 Ga0466961_0111711
1072 Ga0466964_0000322
1073 Ga0453684_0006330
1074 Ga0453684_0636626
1075 Ga0466971_0000163
1076 Ga0466968_0004465
1077 Ga0466968_0240961
1078 Ga0466970_0001458
1079 Ga0466957_0008627
1080 Ga0466959_0009780
1081 Ga0466959_0028527
1082 Ga0466959_0029893
1083 Ga0466959_0038017
1084 Ga0466959_0038682
1085 Ga0466959_0058507
1086 Ga0466959_0250614
1087 Ga0466958_0158266
1088 Ga0466958_0188584
1089 Ga0466967_0528286
1090 Ga0495638_0018016
1091 Ga0495638_0159991
1092 Ga0495638_0279327
1093 Ga0495650_0092130
1094 Ga0495616_0000934
1095 Ga0495620_0173989
1096 Ga0495620_0180196
1097 Ga0495632_0048448
1098 Ga0495632_0125291
1099 Ga0495643_0095837
1100 Ga0495586_0429866
1101 Ga0495656_0189073
1102 Ga0495668_0070955
1103 Ga0495611_0115422
1104 Ga0495625_0190491
1105 Ga0495671_0388859
1106 Ga0495649_0010587
1107 Ga0495649_0068914
1108 Ga0495687_066734
1109 Ga0495673_0134782
1110 Ga0495686_0120392
1111 Ga0496100_0119985
1112 Ga0496103_0056170
1113 Ga0496104_0036688
1114 Ga0496105_0027838
1115 Ga0496106_0533590
1116 Ga0496108_0207084
1117 Ga0496109_0078879
1118 Ga0496110_0006513
1119 Ga0496113_0472251
1120 Ga0496114_0365691
1121 Ga0496115_0211974
1122 Ga0496116_0009411
1123 Ga0496117_0000095
1124 Ga0496118_0000003
1125 Ga0496118_0043134
1126 Ga0496119_0004503
1127 Ga0496119_0029878
1128 Ga0496120_0001668
1129 Ga0496120_0081013
1130 Ga0496121_0012447
1131 Ga0496121_0056370
1132 Ga0496121_0495731
1133 Ga0496124_0014724
1134 Ga0496125_0001184
1135 Ga0496125_0008082
1136 Ga0496125_0017500
1137 Ga0496126_0004803
1138 Ga0496126_0013294
1139 Ga0496126_0075578
1140 Ga0496126_0502854
1141 Ga0501037_0328269
1142 Ga0501067_0061700
1143 Ga0501068_0001248
1144 Ga0501070_0503365
1145 Ga0501073_0001455
1146 Ga0501074_0003600
1147 Ga0501076_0013600
1148 Ga0501077_0006792
1149 Ga0501080_0063768
1150 Ga0501083_0006145
1151 Ga0501045_0233028
1152 nmdc:mga08y16_71831_c1
1153 Ga0500583_0022188
1154 Ga0500583_0041236
1155 Ga0500583_0050839
1156 Ga0500641_0013857
1157 Ga0500641_0074306
1158 Ga0500557_123231
1159 Ga0500572_008055
1160 Ga0500591_066119
1161 Ga0500593_066477
1162 Ga0500614_021210
1163 Ga0500642_0197465
1164 Ga0500652_151198
1165 Ga0500559_0156425
1166 Ga0500588_0002731
1167 Ga0500616_0000030
1168 Ga0500616_0025301
1169 Ga0500622_0001888
1170 Ga0500624_055076
1171 Ga0500639_080785
1172 Ga0500637_0077310
1173 Ga0500637_0324263
1174 Ga0500611_028011
1175 Ga0501084_0004813
1176 Ga0501082_0012582
1177 Ga0466962_0000730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01712

dNK

Deoxynucleoside kinase

39

233

0.92

PF13671

AAA_33

AAA domain

39

198

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hp1-assembly1.cif.gz_A-2 crystal structure of human dck r104m/d133a in complex with l-dt and adp 0.8513 8 202
2zi7-assembly1.cif.gz_A c4s dck variant of dck in complex with d-dg+udp 0.8484 8 202
1p60-assembly1.cif.gz_B structure of human dck complexed with 2'-deoxycytidine and adp, space group c 2 2 21 0.8449 8 201
4kcg-assembly1.cif.gz_A human dck c4s-s74e mutant in complex with udp and the di-39 inhibitor 0.8437 8 203
3kfx-assembly1.cif.gz_A human dck complex with 5-me dc and adp 0.8431 8 201
ID Description Score Start End Superfamily
af_Q2G0M1_9_214_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8797 8 202 3.40.50.300
af_Q2G0M0_4_200_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8674 9 202 3.40.50.300
af_Q54YL2_23_219_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8604 10 201 3.40.50.300
af_Q54UT2_32_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.853 8 201 3.40.50.300
af_Q2G0M0_4_200_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8387 9 202 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2E5FIY6-F1-model_v4 Deoxynucleoside kinase 0.9638 4 216 GO:0005524
GO:0005737
GO:0019136
AF-A0A3P0XCC2-F1-model_v4 Deoxynucleoside kinase 0.9618 4 212 GO:0005737
GO:0019136
AF-A0A7C2V9F0-F1-model_v4 Deoxynucleoside kinase 0.9572 4 216 GO:0005524
GO:0005737
GO:0019136
AF-A0A4Q1SKK6-F1-model_v4 Deoxynucleoside kinase 0.9569 1 215 GO:0005524
GO:0005737
GO:0019136
AF-A0A2E5FIY6-F1-model_v4 Deoxynucleoside kinase 0.9548 4 216 GO:0005524
GO:0005737
GO:0019136

Map