F466747

General Info

Members Datasets Scaffolds Average Seq Length
588 231 588 180

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10391420|Ga0070685_103914201
Length 203
Sequence MAIVAAPFRAKGGPRLTMRDAKRVAVLISGRGSNMRALVEQAIGYEVVLVASNKPFAPGLEWARARGIPTWTWDSKGVAKEAFDRMISAALDDHLVGTIALAGFMRVLSPWFISEWQGRVLNIHPSLLPKYRGLDTHQRALDAGDRVHGCSVHLVTEELDAGEVLGSREVPIVSGDDAGALEKRVLEAEHALYPKILSEFVTR

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
170 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
171 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
180 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
197 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
198 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
199 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
200 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
201 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
229 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 4.42
Rhizosphere 93.2
Stem 0
Stem Tuber 0
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1028926 3300001915 Bacteria 834
2 JGI24740J21852_10018730 3300001979 Bacteria 2448
3 JGI24739J22299_10004359 3300001989 Bacteria 5421
4 JGI24737J22298_10068017 3300001990 Bacteria 1065
5 JGI24735J21928_10040136 3300002067 Bacteria 1367
6 JGI24735J21928_10051821 3300002067 Bacteria 1184
7 JGI24738J21930_10007357 3300002075 Bacteria 2544
8 JGI24738J21930_10032763 3300002075 Bacteria 1059
9 JGI24742J22300_10010005 3300002244 Bacteria 1566
10 Ga0065165_1045447 3300005262 Bacteria 1279
11 Ga0065715_10220665 3300005293 Bacteria 1193
12 Ga0070658_10018933 3300005327 Bacteria 5515
13 Ga0070658_10088163 3300005327 Bacteria 2555
14 Ga0070658_10112268 3300005327 Bacteria 2259
15 Ga0070676_10016308 3300005328 Bacteria 4106
16 Ga0070676_10408872 3300005328 Unclassified 946
17 Ga0070676_10645265 3300005328 Bacteria 768
18 Ga0070683_100005295 3300005329 Bacteria 10747
19 Ga0070683_100011024 3300005329 Bacteria 7791
20 Ga0070683_100035063 3300005329 Bacteria 4587
21 Ga0070670_100010847 3300005331 Bacteria 7785
22 Ga0070670_100025540 3300005331 Bacteria 5081
23 Ga0070670_100079017 3300005331 Bacteria 2826
24 Ga0070670_100322804 3300005331 Bacteria 1353
25 Ga0070677_10000997 3300005333 Bacteria 9161
26 Ga0070677_10029415 3300005333 Bacteria 2083
27 Ga0068869_100494127 3300005334 Bacteria 1020
28 Ga0070666_10011770 3300005335 Bacteria 5501
29 Ga0070666_10114242 3300005335 Bacteria 1869
30 Ga0070680_100000834 3300005336 Bacteria 21786
31 Ga0070680_100022301 3300005336 Bacteria 5041
32 Ga0070680_100131475 3300005336 Bacteria 2094
33 Ga0070680_100207836 3300005336 Bacteria 1651
34 Ga0070680_100247758 3300005336 Bacteria 1506
35 Ga0070680_100742509 3300005336 Bacteria 845
36 Ga0068868_100046121 3300005338 Bacteria 3411
37 Ga0068868_100175176 3300005338 Bacteria 1777
38 Ga0070660_100015476 3300005339 Bacteria 5510
39 Ga0070660_100032087 3300005339 Bacteria 3950
40 Ga0070660_100039524 3300005339 Bacteria 3586
41 Ga0070660_100053691 3300005339 Bacteria 3109
42 Ga0070660_100226815 3300005339 Bacteria 1519
43 Ga0070660_100279879 3300005339 Bacteria 1365
44 Ga0070660_100306173 3300005339 Bacteria 1303
45 Ga0070691_10001109 3300005341 Bacteria 11174
46 Ga0070661_100011683 3300005344 Bacteria 6123
47 Ga0070661_100014547 3300005344 Bacteria 5545
48 Ga0070661_100047096 3300005344 Bacteria 3155
49 Ga0070661_100161052 3300005344 Bacteria 1699
50 Ga0070661_100218714 3300005344 Bacteria 1460
51 Ga0070661_100301206 3300005344 Bacteria 1248
52 Ga0070692_10028373 3300005345 Bacteria 2781
53 Ga0070692_10153035 3300005345 Bacteria 1315
54 Ga0070692_10329499 3300005345 Bacteria 942
55 Ga0070668_100001813 3300005347 Bacteria 15545
56 Ga0070668_100035677 3300005347 Bacteria 3793
57 Ga0070668_100277327 3300005347 Bacteria 1399
58 Ga0070669_100102673 3300005353 Bacteria 2159
59 Ga0070669_100123241 3300005353 Bacteria 1980
60 Ga0070669_100454093 3300005353 Bacteria 1057
61 Ga0070675_100000637 3300005354 Bacteria 24178
62 Ga0070671_100002819 3300005355 Bacteria 13513
63 Ga0070674_100005968 3300005356 Bacteria 7080
64 Ga0070674_100023740 3300005356 Bacteria 3974
65 Ga0070674_100138906 3300005356 Bacteria 1821
66 Ga0070674_100288284 3300005356 Bacteria 1304
67 Ga0070673_100049443 3300005364 Bacteria 3283
68 Ga0070673_100121521 3300005364 Bacteria 2179
69 Ga0070673_100726059 3300005364 Bacteria 914
70 Ga0070659_100003111 3300005366 Bacteria 11806
71 Ga0070659_100017538 3300005366 Bacteria 5392
72 Ga0070659_100029313 3300005366 Bacteria 4253
73 Ga0070659_100042779 3300005366 Bacteria 3542
74 Ga0070659_100070971 3300005366 Bacteria 2768
75 Ga0070659_100171871 3300005366 Bacteria 1775
76 Ga0070659_100869509 3300005366 Bacteria 787
77 Ga0070667_100006814 3300005367 Bacteria 9490
78 Ga0070667_100023784 3300005367 Bacteria 5086
79 Ga0070667_100249253 3300005367 Bacteria 1587
80 Ga0070714_100030925 3300005435 Bacteria 4461
81 Ga0070694_100208093 3300005444 Bacteria 1462
82 Ga0070663_100071647 3300005455 Bacteria 2522
83 Ga0070663_100108066 3300005455 Bacteria 2086
84 Ga0070663_100247134 3300005455 Bacteria 1411
85 Ga0070663_100485479 3300005455 Bacteria 1023
86 Ga0070678_100001260 3300005456 Bacteria 13428
87 Ga0070678_100032705 3300005456 Bacteria 3603
88 Ga0070678_100153082 3300005456 Bacteria 1860
89 Ga0070662_100020005 3300005457 Bacteria 4555
90 Ga0070662_100031091 3300005457 Bacteria 3744
91 Ga0070662_100806300 3300005457 Bacteria 798
92 Ga0070681_10022750 3300005458 Bacteria 6299
93 Ga0070681_10065216 3300005458 Bacteria 3611
94 Ga0068867_100004445 3300005459 Bacteria 9860
95 Ga0068867_100102582 3300005459 Bacteria 2187
96 Ga0070685_10391420 3300005466 Bacteria 960
97 Ga0070679_100089757 3300005530 Bacteria 3060
98 Ga0070679_100101762 3300005530 Bacteria 2859
99 Ga0070679_100701867 3300005530 Bacteria 954
100 Ga0070679_100795660 3300005530 Bacteria 889
101 Ga0070684_100069704 3300005535 Bacteria 3092
102 Ga0070684_100332872 3300005535 Bacteria 1395
103 Ga0068853_100026812 3300005539 Bacteria 4841
104 Ga0068853_100066591 3300005539 Bacteria 3128
105 Ga0068853_100373461 3300005539 Bacteria 1331
106 Ga0070672_100073961 3300005543 Bacteria 2717
107 Ga0070672_100097523 3300005543 Bacteria 2380
108 Ga0070672_100147708 3300005543 Bacteria 1943
109 Ga0070672_100373523 3300005543 Bacteria 1219
110 Ga0070695_100641718 3300005545 Bacteria 838
111 Ga0070696_101007390 3300005546 Bacteria 696
112 Ga0070693_100195393 3300005547 Bacteria 1311
113 Ga0070665_100116436 3300005548 Bacteria 2675
114 Ga0068855_100006737 3300005563 Bacteria 13931
115 Ga0068855_100052252 3300005563 Bacteria 4811
116 Ga0068855_100128146 3300005563 Bacteria 2900
117 Ga0068855_100207989 3300005563 Bacteria 2200
118 Ga0068855_100448893 3300005563 Bacteria 1407
119 Ga0068855_100672022 3300005563 Bacteria 1111
120 Ga0068855_101054834 3300005563 Bacteria 852
121 Ga0070664_100000207 3300005564 Bacteria 42082
122 Ga0070664_100018669 3300005564 Bacteria 5702
123 Ga0070664_100042636 3300005564 Bacteria 3830
124 Ga0070664_100054798 3300005564 Bacteria 3385
125 Ga0070664_100056725 3300005564 Bacteria 3328
126 Ga0070664_100063862 3300005564 Bacteria 3139
127 Ga0070664_100383643 3300005564 Bacteria 1283
128 Ga0068857_100024467 3300005577 Bacteria 5316
129 Ga0068857_100051464 3300005577 Bacteria 3654
130 Ga0068857_100183121 3300005577 Bacteria 1906
131 Ga0068857_100350540 3300005577 Bacteria 1367
132 Ga0068857_100368516 3300005577 Bacteria 1332
133 Ga0068857_101250398 3300005577 Bacteria 720
134 Ga0068854_100001469 3300005578 Bacteria 14276
135 Ga0068854_100104612 3300005578 Bacteria 2127
136 Ga0068856_100002757 3300005614 Bacteria 17993
137 Ga0068856_100043027 3300005614 Bacteria 4443
138 Ga0068856_100047272 3300005614 Bacteria 4240
139 Ga0068856_100268078 3300005614 Bacteria 1723
140 Ga0068852_100003532 3300005616 Bacteria 10941
141 Ga0068852_100115790 3300005616 Bacteria 2444
142 Ga0068852_100159300 3300005616 Bacteria 2106
143 Ga0068852_100236326 3300005616 Bacteria 1744
144 Ga0068852_100256822 3300005616 Bacteria 1676
145 Ga0068852_100355751 3300005616 Bacteria 1431
146 Ga0068859_100115387 3300005617 Bacteria 2750
147 Ga0068859_100270674 3300005617 Bacteria 1791
148 Ga0068859_100701158 3300005617 Bacteria 1103
149 Ga0068864_100007304 3300005618 Bacteria 9088
150 Ga0068864_100166433 3300005618 Bacteria 2007
151 Ga0068864_100521929 3300005618 Bacteria 1145
152 Ga0068864_100809918 3300005618 Bacteria 921
153 Ga0068864_101003272 3300005618 Bacteria 828
154 Ga0068861_100245577 3300005719 Bacteria 1525
155 Ga0068851_10018818 3300005834 Bacteria 3332
156 Ga0068851_10040393 3300005834 Bacteria 2344
157 Ga0068863_100043886 3300005841 Bacteria 4244
158 Ga0068863_100134878 3300005841 Bacteria 2358
159 Ga0068863_100147312 3300005841 Bacteria 2252
160 Ga0068863_100629474 3300005841 Bacteria 1063
161 Ga0068858_100018773 3300005842 Bacteria 6469
162 Ga0068858_100305712 3300005842 Bacteria 1518
163 Ga0068860_100009940 3300005843 Bacteria 9428
164 Ga0068860_100721240 3300005843 Bacteria 1007
165 Ga0068862_100031315 3300005844 Bacteria 4489
166 Ga0068862_100038220 3300005844 Bacteria 4070
167 Ga0068862_100239079 3300005844 Bacteria 1650
168 Ga0075362_10043562 3300006177 Bacteria 1987
169 Ga0097621_100032254 3300006237 Bacteria 4163
170 Ga0068871_100097389 3300006358 Bacteria 2459
171 Ga0075428_100233026 3300006844 Bacteria 1987
172 Ga0075431_100833483 3300006847 Bacteria 894
173 Ga0075433_10011495 3300006852 Bacteria 7129
174 Ga0075434_100624084 3300006871 Bacteria 1097
175 Ga0068865_100090684 3300006881 Bacteria 2217
176 Ga0068865_100188905 3300006881 Bacteria 1592
177 Ga0068865_100217270 3300006881 Bacteria 1493
178 Ga0068865_100378595 3300006881 Bacteria 1154
179 Ga0097620_100115385 3300006931 Bacteria 2750
180 Ga0097620_100270684 3300006931 Bacteria 1791
181 Ga0097620_100701166 3300006931 Bacteria 1103
182 Ga0075435_100220745 3300007076 Bacteria 1610
183 Ga0105240_11403729 3300009093 Bacteria 734
184 Ga0105245_10948433 3300009098 Bacteria 903
185 Ga0105247_10133470 3300009101 Bacteria 1620
186 Ga0105247_10164050 3300009101 Bacteria 1473
187 Ga0105243_10000251 3300009148 Bacteria 61790
188 Ga0105243_10131287 3300009148 Bacteria 2125
189 Ga0105241_10004809 3300009174 Bacteria 9950
190 Ga0105241_10826672 3300009174 Unclassified 855
191 Ga0105241_10864804 3300009174 Bacteria 837
192 Ga0105242_10371000 3300009176 Bacteria 1327
193 Ga0105242_10762226 3300009176 Bacteria 954
194 Ga0105248_10009598 3300009177 Bacteria 10653
195 Ga0105248_10026178 3300009177 Bacteria 6490
196 Ga0105238_10229405 3300009551 Bacteria 1834
197 Ga0105249_10502974 3300009553 Bacteria 1257
198 Ga0105239_10290300 3300010375 Bacteria 1842
199 Ga0105239_11391203 3300010375 Bacteria 810
200 Ga0105246_10033781 3300011119 Bacteria 3402
201 Ga0105246_10081041 3300011119 Bacteria 2312
202 Ga0105246_10303148 3300011119 Bacteria 1291
203 Ga0157327_1036871 3300012512 Bacteria 639
204 Ga0157373_10007014 3300013100 Bacteria 8395
205 Ga0157373_10019837 3300013100 Bacteria 4891
206 Ga0157373_10029482 3300013100 Bacteria 3952
207 Ga0157373_10113962 3300013100 Bacteria 1900
208 Ga0157373_10138425 3300013100 Bacteria 1712
209 Ga0157373_10206230 3300013100 Bacteria 1386
210 Ga0157373_10371188 3300013100 Bacteria 1022
211 Ga0157373_10908481 3300013100 Bacteria 654
212 Ga0157371_10000097 3300013102 Bacteria 134150
213 Ga0157371_10000672 3300013102 Bacteria 40585
214 Ga0157371_10007261 3300013102 Bacteria 8999
215 Ga0157371_10139008 3300013102 Bacteria 1730
216 Ga0157371_10154532 3300013102 Bacteria 1637
217 Ga0157371_10288889 3300013102 Bacteria 1185
218 Ga0157371_10690415 3300013102 Bacteria 764
219 Ga0157370_10083604 3300013104 Bacteria 3001
220 Ga0157370_10105484 3300013104 Bacteria 2638
221 Ga0157370_10111263 3300013104 Bacteria 2560
222 Ga0157370_10162936 3300013104 Bacteria 2074
223 Ga0157370_10226088 3300013104 Bacteria 1732
224 Ga0157369_10015160 3300013105 Bacteria 8700
225 Ga0157369_10074758 3300013105 Bacteria 3634
226 Ga0157369_10181774 3300013105 Bacteria 2212
227 Ga0157369_10189669 3300013105 Bacteria 2160
228 Ga0157369_10764383 3300013105 Bacteria 994
229 Ga0157374_10056966 3300013296 Bacteria 3650
230 Ga0157374_10475619 3300013296 Bacteria 1252
231 Ga0157378_11165935 3300013297 Bacteria 809
232 Ga0157372_10294126 3300013307 Bacteria 1888
233 Ga0157372_10387889 3300013307 Bacteria 1627
234 Ga0157372_10469415 3300013307 Bacteria 1467
235 Ga0157372_10550021 3300013307 Bacteria 1345
236 Ga0157372_10640106 3300013307 Bacteria 1238
237 Ga0157372_11118273 3300013307 Bacteria 911
238 Ga0157375_10244020 3300013308 Bacteria 1956
239 Ga0157375_10844955 3300013308 Bacteria 1062
240 Ga0163163_10592187 3300014325 Bacteria 1172
241 Ga0157380_10007468 3300014326 Bacteria 7762
242 Ga0182008_10127822 3300014497 Bacteria 1266
243 Ga0157377_10032875 3300014745 Bacteria 2828
244 Ga0157379_10066864 3300014968 Bacteria 3214
245 Ga0207697_10041568 3300025315 Bacteria 1888
246 Ga0207656_10104770 3300025321 Bacteria 1301
247 Ga0207682_10002413 3300025893 Bacteria 8412
248 Ga0207682_10030830 3300025893 Bacteria 2149
249 Ga0207710_10258327 3300025900 Bacteria 872
250 Ga0207688_10023320 3300025901 Bacteria 3388
251 Ga0207688_10037924 3300025901 Bacteria 2674
252 Ga0207680_10159193 3300025903 Bacteria 1512
253 Ga0207647_10000870 3300025904 Bacteria 23366
254 Ga0207647_10028810 3300025904 Bacteria 3602
255 Ga0207647_10039999 3300025904 Bacteria 2955
256 Ga0207647_10072738 3300025904 Bacteria 2073
257 Ga0207645_10001588 3300025907 Bacteria 18529
258 Ga0207645_10019240 3300025907 Bacteria 4478
259 Ga0207645_10039122 3300025907 Bacteria 3039
260 Ga0207643_10488766 3300025908 Bacteria 786
261 Ga0207705_10000169 3300025909 Bacteria 69941
262 Ga0207705_10003070 3300025909 Bacteria 12729
263 Ga0207705_10025962 3300025909 Bacteria 4180
264 Ga0207705_10027747 3300025909 Bacteria 4038
265 Ga0207705_10055255 3300025909 Bacteria 2862
266 Ga0207705_10057598 3300025909 Bacteria 2803
267 Ga0207705_10128814 3300025909 Bacteria 1882
268 Ga0207705_10268918 3300025909 Bacteria 1303
269 Ga0207705_10394267 3300025909 Bacteria 1070
270 Ga0207705_10812569 3300025909 Bacteria 725
271 Ga0207654_10000606 3300025911 Bacteria 20229
272 Ga0207707_10041327 3300025912 Bacteria 4027
273 Ga0207707_10120770 3300025912 Bacteria 2291
274 Ga0207695_10002617 3300025913 Bacteria 26348
275 Ga0207671_10044589 3300025914 Bacteria 3280
276 Ga0207660_10014640 3300025917 Bacteria 5165
277 Ga0207660_10021280 3300025917 Bacteria 4360
278 Ga0207660_10027210 3300025917 Bacteria 3899
279 Ga0207660_10185535 3300025917 Bacteria 1617
280 Ga0207660_10190956 3300025917 Bacteria 1595
281 Ga0207660_10324485 3300025917 Bacteria 1230
282 Ga0207657_10000128 3300025919 Bacteria 76013
283 Ga0207657_10000948 3300025919 Bacteria 30737
284 Ga0207657_10002684 3300025919 Bacteria 19173
285 Ga0207657_10009585 3300025919 Bacteria 9721
286 Ga0207657_10034086 3300025919 Bacteria 4583
287 Ga0207657_10053685 3300025919 Bacteria 3490
288 Ga0207657_10232018 3300025919 Bacteria 1476
289 Ga0207657_10300388 3300025919 Bacteria 1272
290 Ga0207649_10000874 3300025920 Bacteria 19101
291 Ga0207649_10003715 3300025920 Bacteria 8323
292 Ga0207649_10010568 3300025920 Bacteria 5076
293 Ga0207649_10241783 3300025920 Bacteria 1296
294 Ga0207649_10397154 3300025920 Unclassified 1031
295 Ga0207652_10011548 3300025921 Bacteria 7122
296 Ga0207652_10022628 3300025921 Bacteria 5202
297 Ga0207652_10117113 3300025921 Bacteria 2367
298 Ga0207652_10215672 3300025921 Bacteria 1729
299 Ga0207652_10893488 3300025921 Bacteria 785
300 Ga0207681_10012905 3300025923 Bacteria 5166
301 Ga0207681_10015565 3300025923 Bacteria 4745
302 Ga0207681_10222713 3300025923 Bacteria 1460
303 Ga0207694_10061289 3300025924 Bacteria 2928
304 Ga0207694_10245834 3300025924 Bacteria 1463
305 Ga0207650_10043697 3300025925 Bacteria 3290
306 Ga0207650_10063528 3300025925 Bacteria 2760
307 Ga0207650_10103608 3300025925 Bacteria 2194
308 Ga0207650_10106915 3300025925 Bacteria 2161
309 Ga0207659_10044012 3300025926 Bacteria 3139
310 Ga0207700_10284304 3300025928 Bacteria 1424
311 Ga0207664_10055353 3300025929 Bacteria 3147
312 Ga0207664_10528200 3300025929 Bacteria 1058
313 Ga0207644_10034028 3300025931 Bacteria 3565
314 Ga0207644_10045797 3300025931 Bacteria 3113
315 Ga0207644_10248132 3300025931 Bacteria 1419
316 Ga0207690_10027810 3300025932 Bacteria 3577
317 Ga0207690_10054203 3300025932 Bacteria 2695
318 Ga0207690_10084138 3300025932 Bacteria 2229
319 Ga0207690_10158777 3300025932 Bacteria 1683
320 Ga0207706_10004513 3300025933 Bacteria 13073
321 Ga0207706_10014483 3300025933 Bacteria 7149
322 Ga0207706_10057754 3300025933 Bacteria 3418
323 Ga0207706_10078756 3300025933 Bacteria 2898
324 Ga0207706_10392296 3300025933 Bacteria 1204
325 Ga0207706_10658606 3300025933 Bacteria 896
326 Ga0207686_10020399 3300025934 Bacteria 3786
327 Ga0207709_10000188 3300025935 Bacteria 82582
328 Ga0207669_10000185 3300025937 Bacteria 28588
329 Ga0207669_10003885 3300025937 Bacteria 6520
330 Ga0207669_10049240 3300025937 Bacteria 2510
331 Ga0207704_10065698 3300025938 Bacteria 2273
332 Ga0207704_10094069 3300025938 Bacteria 1978
333 Ga0207691_10090793 3300025940 Bacteria 2738
334 Ga0207691_10142461 3300025940 Bacteria 2111
335 Ga0207691_10227254 3300025940 Bacteria 1617
336 Ga0207691_10333358 3300025940 Bacteria 1300
337 Ga0207711_10001624 3300025941 Bacteria 20742
338 Ga0207711_10032914 3300025941 Bacteria 4384
339 Ga0207711_10487104 3300025941 Bacteria 1149
340 Ga0207689_10022619 3300025942 Bacteria 5282
341 Ga0207661_10036009 3300025944 Bacteria 3860
342 Ga0207661_10044750 3300025944 Bacteria 3500
343 Ga0207679_10000286 3300025945 Bacteria 38353
344 Ga0207679_10021911 3300025945 Bacteria 4341
345 Ga0207679_10037440 3300025945 Bacteria 3448
346 Ga0207679_10111785 3300025945 Bacteria 2158
347 Ga0207679_10780592 3300025945 Bacteria 870
348 Ga0207667_10000010 3300025949 Bacteria 477432
349 Ga0207667_10003642 3300025949 Bacteria 18988
350 Ga0207667_10009700 3300025949 Bacteria 11323
351 Ga0207667_10075833 3300025949 Bacteria 3490
352 Ga0207667_10080702 3300025949 Bacteria 3370
353 Ga0207667_10117229 3300025949 Bacteria 2744
354 Ga0207651_10050975 3300025960 Bacteria 2814
355 Ga0207651_10057965 3300025960 Bacteria 2674
356 Ga0207651_10588564 3300025960 Bacteria 971
357 Ga0207712_10231247 3300025961 Bacteria 1484
358 Ga0207668_10000074 3300025972 Bacteria 75726
359 Ga0207668_10149534 3300025972 Bacteria 1806
360 Ga0207668_10207331 3300025972 Bacteria 1565
361 Ga0207640_10002376 3300025981 Bacteria 10074
362 Ga0207640_10106571 3300025981 Unclassified 1977
363 Ga0207640_10258194 3300025981 Bacteria 1356
364 Ga0207658_10014644 3300025986 Bacteria 5372
365 Ga0207658_10146498 3300025986 Bacteria 1918
366 Ga0207658_10313736 3300025986 Bacteria 1355
367 Ga0207677_10240333 3300026023 Bacteria 1465
368 Ga0207677_10368086 3300026023 Bacteria 1209
369 Ga0207677_10911173 3300026023 Bacteria 793
370 Ga0207703_10112867 3300026035 Bacteria 2322
371 Ga0207703_10247089 3300026035 Bacteria 1606
372 Ga0207639_10002715 3300026041 Bacteria 11869
373 Ga0207639_10004552 3300026041 Bacteria 9338
374 Ga0207639_10219000 3300026041 Bacteria 1643
375 Ga0207639_10757382 3300026041 Bacteria 903
376 Ga0207678_10004608 3300026067 Bacteria 12388
377 Ga0207678_10014926 3300026067 Bacteria 6834
378 Ga0207678_10031686 3300026067 Bacteria 4610
379 Ga0207678_10039479 3300026067 Bacteria 4097
380 Ga0207678_10046457 3300026067 Bacteria 3754
381 Ga0207678_10306539 3300026067 Bacteria 1365
382 Ga0207678_10703679 3300026067 Bacteria 889
383 Ga0207702_10003658 3300026078 Bacteria 13926
384 Ga0207702_10036604 3300026078 Bacteria 4106
385 Ga0207702_10074727 3300026078 Unclassified 2926
386 Ga0207702_10125149 3300026078 Bacteria 2306
387 Ga0207702_10193656 3300026078 Bacteria 1880
388 Ga0207702_10229909 3300026078 Bacteria 1733
389 Ga0207641_10020421 3300026088 Bacteria 5440
390 Ga0207641_10108754 3300026088 Bacteria 2454
391 Ga0207641_10142766 3300026088 Bacteria 2162
392 Ga0207641_10430910 3300026088 Bacteria 1271
393 Ga0207648_10029760 3300026089 Bacteria 4842
394 Ga0207648_10131957 3300026089 Bacteria 2199
395 Ga0207676_10054841 3300026095 Bacteria 3125
396 Ga0207676_10114491 3300026095 Bacteria 2262
397 Ga0207676_10164538 3300026095 Bacteria 1926
398 Ga0207676_10594755 3300026095 Bacteria 1062
399 Ga0207674_10001488 3300026116 Bacteria 30251
400 Ga0207674_10003633 3300026116 Bacteria 18804
401 Ga0207674_10013043 3300026116 Bacteria 9256
402 Ga0207674_10023350 3300026116 Bacteria 6627
403 Ga0207674_10027916 3300026116 Bacteria 5964
404 Ga0207674_10081229 3300026116 Bacteria 3244
405 Ga0207674_10173190 3300026116 Bacteria 2111
406 Ga0207674_10955956 3300026116 Bacteria 825
407 Ga0207675_100097639 3300026118 Bacteria 2766
408 Ga0207675_100582498 3300026118 Bacteria 1120
409 Ga0207683_10003535 3300026121 Bacteria 13628
410 Ga0207683_10009767 3300026121 Bacteria 8180
411 Ga0207683_10021536 3300026121 Bacteria 5521
412 Ga0207683_10113052 3300026121 Bacteria 2432
413 Ga0207698_10000647 3300026142 Bacteria 20147
414 Ga0207698_10001368 3300026142 Bacteria 14189
415 Ga0207698_10001981 3300026142 Bacteria 12049
416 Ga0207698_10017848 3300026142 Bacteria 4823
417 Ga0207698_10061580 3300026142 Bacteria 2925
418 Ga0207698_10352694 3300026142 Bacteria 1390
419 Ga0207698_10431288 3300026142 Bacteria 1267
420 Ga0207698_10610233 3300026142 Bacteria 1077
421 Ga0268266_10037925 3300028379 Bacteria 4103
422 Ga0268266_10149400 3300028379 Bacteria 2104
423 Ga0268265_10021590 3300028380 Bacteria 4513
424 Ga0268265_10039594 3300028380 Bacteria 3475
425 Ga0268264_10015490 3300028381 Bacteria 6250
426 Ga0307405_10357725 3300031731 Unclassified 1128
427 Ga0307405_10383106 3300031731 Bacteria 1095
428 Ga0307413_10720858 3300031824 Unclassified 830
429 Ga0307410_10040574 3300031852 Bacteria 3064
430 Ga0307410_10102640 3300031852 Bacteria 2052
431 Ga0307410_10393753 3300031852 Unclassified 1117
432 Ga0307410_10461284 3300031852 Bacteria 1038
433 Ga0307406_10251734 3300031901 Bacteria 1331
434 Ga0307406_10458286 3300031901 Bacteria 1024
435 Ga0307407_10188739 3300031903 Bacteria 1372
436 Ga0307407_10202694 3300031903 Bacteria 1330
437 Ga0307412_10120735 3300031911 Bacteria 1886
438 Ga0307412_10182150 3300031911 Bacteria 1581
439 Ga0307412_10699954 3300031911 Unclassified 869
440 Ga0307412_11008827 3300031911 Bacteria 736
441 Ga0307409_100141735 3300031995 Bacteria 2072
442 Ga0307409_100945421 3300031995 Unclassified 877
443 Ga0307416_100158982 3300032002 Bacteria 2085
444 Ga0307416_100282916 3300032002 Bacteria 1636
445 Ga0307414_10230900 3300032004 Bacteria 1525
446 Ga0307414_10839561 3300032004 Unclassified 839
447 Ga0307411_10029570 3300032005 Bacteria 3348
448 Ga0307411_10126730 3300032005 Bacteria 1858
449 Ga0307411_10165785 3300032005 Bacteria 1660
450 Ga0307411_10386629 3300032005 Bacteria 1152
451 Ga0307411_11170056 3300032005 Bacteria 696
452 Ga0307415_100027261 3300032126 Bacteria 3617
453 Ga0307415_100032440 3300032126 Bacteria 3377
454 Ga0307415_100079553 3300032126 Bacteria 2335
455 Ga0307415_100164933 3300032126 Bacteria 1721
456 Ga0395899_0000514 3300037312 Bacteria 42939
457 Ga0395899_0005372 3300037312 Bacteria 9947
458 Ga0395899_0010033 3300037312 Bacteria 7260
459 Ga0395899_0123410 3300037312 Unclassified 1854
460 Ga0395900_0001018 3300037418 Bacteria 36138
461 Ga0395900_0018394 3300037418 Bacteria 7125
462 Ga0395900_0128422 3300037418 Bacteria 2598
463 Ga0395900_0160265 3300037418 Bacteria 2295
464 Ga0395900_0437293 3300037418 Bacteria 1266
465 Ga0395900_0537866 3300037418 Bacteria 1114
466 Ga0395900_0610404 3300037418 Unclassified 1030
467 Ga0395898_0000021 3300037466 Bacteria 393971
468 Ga0395898_0015950 3300037466 Bacteria 7698
469 Ga0395898_0037082 3300037466 Bacteria 4837
470 Ga0395898_0056425 3300037466 Bacteria 3828
471 Ga0395898_0126966 3300037466 Bacteria 2443
472 Ga0395905_0000006 3300037471 Bacteria 549428
473 Ga0395905_0028578 3300037471 Bacteria 5256
474 Ga0395905_0067276 3300037471 Bacteria 3355
475 Ga0395905_0082716 3300037471 Bacteria 3008
476 Ga0395905_0132523 3300037471 Bacteria 2344
477 Ga0395905_0164671 3300037471 Bacteria 2083
478 Ga0395905_0404359 3300037471 Bacteria 1260
479 Ga0395905_0501176 3300037471 Bacteria 1114
480 Ga0395905_1077793 3300037471 Bacteria 707
481 Ga0395905_1083138 3300037471 Bacteria 704
482 Ga0395901_0000696 3300038443 Bacteria 38377
483 Ga0395901_0004314 3300038443 Bacteria 14354
484 Ga0395901_0007679 3300038443 Bacteria 10879
485 Ga0395901_0039783 3300038443 Bacteria 4866
486 Ga0395901_0136795 3300038443 Bacteria 2575
487 Ga0395901_0165446 3300038443 Bacteria 2322
488 Ga0395901_0644387 3300038443 Bacteria 1063
489 Ga0395901_1055061 3300038443 Bacteria 785
490 Ga0439448_0017830 3300042005 Bacteria 2171
491 Ga0439455_0013618 3300042012 Bacteria 1845
492 Ga0439458_0010029 3300042157 Bacteria 2110
493 Ga0466972_0291955 3300044658 Bacteria 762
494 Ga0466966_0293298 3300044684 Bacteria 978
495 Ga0466963_0040632 3300044694 Bacteria 3049
496 Ga0466963_0620157 3300044694 Unclassified 764
497 Ga0466963_0689365 3300044694 Bacteria 721
498 Ga0466963_0826531 3300044694 Bacteria 653
499 Ga0466957_0514707 3300044842 Bacteria 831
500 Ga0466957_0803918 3300044842 Bacteria 668
501 Ga0466958_0377207 3300045836 Bacteria 914
502 Ga0466967_0088337 3300045976 Bacteria 2813
503 Ga0466967_0212012 3300045976 Bacteria 1837
504 Ga0466967_0239982 3300045976 Bacteria 1729
505 Ga0466967_0335726 3300045976 Bacteria 1460
506 Ga0466967_0505194 3300045976 Bacteria 1187
507 Ga0495584_0042709 3300046491 Bacteria 2288
508 Ga0495584_0246912 3300046491 Bacteria 907
509 Ga0495596_0020199 3300046500 Bacteria 2728
510 Ga0495583_0011689 3300046506 Bacteria 5027
511 Ga0495583_0020161 3300046506 Bacteria 3462
512 Ga0495583_0129837 3300046506 Bacteria 1055
513 Ga0495606_0001113 3300046507 Bacteria 38409
514 Ga0495606_0086499 3300046507 Bacteria 1937
515 Ga0495620_0167027 3300046515 Bacteria 854
516 Ga0495631_0083945 3300046518 Bacteria 1373
517 Ga0495637_0172738 3300046520 Bacteria 805
518 Ga0495643_0002421 3300046522 Bacteria 14836
519 Ga0495643_0052259 3300046522 Bacteria 2194
520 Ga0495663_0003389 3300046525 Bacteria 4606
521 Ga0495663_0223007 3300046525 Bacteria 663
522 Ga0495598_0017135 3300046537 Bacteria 1863
523 Ga0495597_0081536 3300046542 Bacteria 1383
524 Ga0495633_0002185 3300046558 Bacteria 14022
525 Ga0495668_0000163 3300046616 Bacteria 99607
526 Ga0495668_0014585 3300046616 Bacteria 4602
527 Ga0495668_0040080 3300046616 Bacteria 2613
528 Ga0495611_0008523 3300046648 Bacteria 4335
529 Ga0495611_0184834 3300046648 Bacteria 973
530 Ga0495625_0070681 3300046660 Bacteria 2451
531 Ga0495625_0110311 3300046660 Bacteria 1881
532 Ga0495625_0114008 3300046660 Bacteria 1845
533 Ga0495669_0000437 3300046684 Bacteria 19820
534 Ga0495669_0008002 3300046684 Bacteria 4436
535 Ga0495669_0061422 3300046684 Bacteria 1700
536 Ga0495670_0170399 3300046691 Bacteria 1146
537 Ga0495670_0555184 3300046691 Bacteria 625
538 Ga0495649_0025567 3300046694 Bacteria 3289
539 Ga0495660_0031632 3300046810 Bacteria 2975
540 Ga0495660_0046350 3300046810 Bacteria 2384
541 Ga0495636_0324824 3300047318 Bacteria 723
542 Ga0495683_0006658 3300047323 Bacteria 6297
543 Ga0495687_000447 3300047443 Bacteria 50911
544 Ga0495677_0005358 3300047445 Bacteria 4867
545 Ga0495677_0346047 3300047445 Bacteria 586
546 Ga0495681_0017561 3300047470 Bacteria 3968
547 Ga0496101_0671723 3300048904 Bacteria 818
548 Ga0496102_0000828 3300048905 Bacteria 29896
549 Ga0496102_0172834 3300048905 Bacteria 2034
550 Ga0496103_0000636 3300048906 Bacteria 26810
551 Ga0496103_0309792 3300048906 Bacteria 1016
552 Ga0496104_0009187 3300048907 Bacteria 8790
553 Ga0496104_0375787 3300048907 Bacteria 1334
554 Ga0496105_0006991 3300048908 Bacteria 8693
555 Ga0496106_0137100 3300048909 Bacteria 1923
556 Ga0496108_0010521 3300048911 Bacteria 7515
557 Ga0496108_0027908 3300048911 Bacteria 4667
558 Ga0496109_0019198 3300048912 Bacteria 6021
559 Ga0496109_0046023 3300048912 Bacteria 3961
560 Ga0496109_1290452 3300048912 Bacteria 666
561 Ga0496110_0122741 3300048913 Bacteria 2341
562 Ga0496110_0178827 3300048913 Bacteria 1926
563 Ga0496110_0319951 3300048913 Bacteria 1413
564 Ga0496110_0998829 3300048913 Bacteria 744
565 Ga0496111_0005767 3300048914 Bacteria 7991
566 Ga0496111_0438581 3300048914 Bacteria 964
567 Ga0496112_0727475 3300048915 Bacteria 919
568 Ga0496113_0308602 3300048916 Bacteria 1267
569 Ga0496114_0000021 3300048917 Bacteria 227038
570 Ga0496114_0020403 3300048917 Bacteria 5379
571 Ga0496115_0000624 3300048918 Bacteria 26823
572 Ga0496115_0001985 3300048918 Bacteria 14608
573 Ga0496116_0003361 3300048919 Bacteria 15887
574 Ga0496117_0001766 3300048920 Bacteria 29764
575 Ga0496118_0001902 3300048921 Bacteria 29748
576 Ga0496119_0003460 3300048922 Bacteria 16379
577 Ga0496120_0023070 3300048923 Bacteria 3900
578 Ga0496121_0002786 3300048924 Bacteria 25928
579 Ga0496124_0001562 3300048927 Bacteria 33102
580 Ga0496126_0001925 3300048929 Bacteria 29687
581 nmdc:mga00v17_117133_c1 3300050491 Bacteria 1694
582 nmdc:mga06r32_986063_c1 3300050510 Bacteria 796
583 nmdc:mga0rr50_294928_c1 3300050513 Bacteria 1355
584 nmdc:mga0a205_6082_c1 3300050515 Bacteria 10886
585 Ga0500610_0000114 3300053079 Bacteria 24378
586 Ga0500642_0028960 3300053130 Bacteria 2290
587 Ga0500645_000170 3300053730 Bacteria 51134
588 Ga0590071_004629 3300059421 Bacteria 3329

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300012512 Ga0157327_1036871 Ga0157327_10368711 168
2 3300001915 JGI24741J21665_1028926 JGI24741J21665_10289262 169
3 3300001979 JGI24740J21852_10018730 JGI24740J21852_100187302 169
4 3300001989 JGI24739J22299_10004359 JGI24739J22299_100043595 169
5 3300001990 JGI24737J22298_10068017 JGI24737J22298_100680172 169
6 3300002067 JGI24735J21928_10040136 JGI24735J21928_100401362 169
7 3300002067 JGI24735J21928_10051821 JGI24735J21928_100518212 169
8 3300002075 JGI24738J21930_10007357 JGI24738J21930_100073574 169
9 3300002075 JGI24738J21930_10032763 JGI24738J21930_100327632 169
10 3300002244 JGI24742J22300_10010005 JGI24742J22300_100100052 169
11 3300005262 Ga0065165_1045447 Ga0065165_10454472 169
12 3300005293 Ga0065715_10220665 Ga0065715_102206652 169
13 3300005327 Ga0070658_10018933 Ga0070658_100189335 169
14 3300005327 Ga0070658_10088163 Ga0070658_100881633 169
15 3300005327 Ga0070658_10112268 Ga0070658_101122682 169
16 3300005328 Ga0070676_10016308 Ga0070676_100163081 169
17 3300005328 Ga0070676_10408872 Ga0070676_104088721 169
18 3300005328 Ga0070676_10645265 Ga0070676_106452651 169
19 3300005329 Ga0070683_100005295 Ga0070683_1000052956 169
20 3300005329 Ga0070683_100011024 Ga0070683_1000110244 169
21 3300005329 Ga0070683_100035063 Ga0070683_1000350633 169
22 3300005331 Ga0070670_100010847 Ga0070670_1000108474 169
23 3300005331 Ga0070670_100025540 Ga0070670_1000255403 169
24 3300005331 Ga0070670_100079017 Ga0070670_1000790175 169
25 3300005331 Ga0070670_100322804 Ga0070670_1003228042 169
26 3300005333 Ga0070677_10000997 Ga0070677_100009976 169
27 3300005333 Ga0070677_10029415 Ga0070677_100294152 169
28 3300005334 Ga0068869_100494127 Ga0068869_1004941272 169
29 3300005335 Ga0070666_10011770 Ga0070666_100117704 169
30 3300005335 Ga0070666_10114242 Ga0070666_101142421 169
31 3300005336 Ga0070680_100000834 Ga0070680_10000083411 169
32 3300005336 Ga0070680_100022301 Ga0070680_1000223013 169
33 3300005336 Ga0070680_100131475 Ga0070680_1001314753 169
34 3300005336 Ga0070680_100207836 Ga0070680_1002078363 169
35 3300005336 Ga0070680_100247758 Ga0070680_1002477581 169
36 3300005336 Ga0070680_100742509 Ga0070680_1007425092 169
37 3300005338 Ga0068868_100046121 Ga0068868_1000461212 169
38 3300005338 Ga0068868_100175176 Ga0068868_1001751762 169
39 3300005339 Ga0070660_100015476 Ga0070660_1000154764 169
40 3300005339 Ga0070660_100032087 Ga0070660_1000320873 169
41 3300005339 Ga0070660_100039524 Ga0070660_1000395244 169
42 3300005339 Ga0070660_100053691 Ga0070660_1000536912 169
43 3300005339 Ga0070660_100226815 Ga0070660_1002268152 169
44 3300005339 Ga0070660_100279879 Ga0070660_1002798792 169
45 3300005339 Ga0070660_100306173 Ga0070660_1003061733 169
46 3300005341 Ga0070691_10001109 Ga0070691_100011096 169
47 3300005344 Ga0070661_100011683 Ga0070661_1000116834 169
48 3300005344 Ga0070661_100014547 Ga0070661_1000145472 169
49 3300005344 Ga0070661_100047096 Ga0070661_1000470964 169
50 3300005344 Ga0070661_100161052 Ga0070661_1001610522 169
51 3300005344 Ga0070661_100218714 Ga0070661_1002187142 169
52 3300005344 Ga0070661_100301206 Ga0070661_1003012062 169
53 3300005345 Ga0070692_10028373 Ga0070692_100283732 169
54 3300005345 Ga0070692_10153035 Ga0070692_101530352 169
55 3300005345 Ga0070692_10329499 Ga0070692_103294992 169
56 3300005347 Ga0070668_100001813 Ga0070668_1000018137 169
57 3300005347 Ga0070668_100035677 Ga0070668_1000356774 169
58 3300005347 Ga0070668_100277327 Ga0070668_1002773272 169
59 3300005353 Ga0070669_100102673 Ga0070669_1001026733 169
60 3300005353 Ga0070669_100123241 Ga0070669_1001232412 169
61 3300005353 Ga0070669_100454093 Ga0070669_1004540932 169
62 3300005354 Ga0070675_100000637 Ga0070675_10000063719 169
63 3300005355 Ga0070671_100002819 Ga0070671_1000028192 169
64 3300005356 Ga0070674_100005968 Ga0070674_1000059687 169
65 3300005356 Ga0070674_100023740 Ga0070674_1000237402 169
66 3300005356 Ga0070674_100138906 Ga0070674_1001389062 169
67 3300005356 Ga0070674_100288284 Ga0070674_1002882842 169
68 3300005364 Ga0070673_100049443 Ga0070673_1000494432 169
69 3300005364 Ga0070673_100121521 Ga0070673_1001215213 169
70 3300005364 Ga0070673_100726059 Ga0070673_1007260592 169
71 3300005366 Ga0070659_100003111 Ga0070659_1000031114 169
72 3300005366 Ga0070659_100017538 Ga0070659_1000175382 169
73 3300005366 Ga0070659_100029313 Ga0070659_1000293133 169
74 3300005366 Ga0070659_100042779 Ga0070659_1000427792 169
75 3300005366 Ga0070659_100070971 Ga0070659_1000709712 169
76 3300005366 Ga0070659_100171871 Ga0070659_1001718712 169
77 3300005366 Ga0070659_100869509 Ga0070659_1008695091 169
78 3300005367 Ga0070667_100006814 Ga0070667_1000068148 169
79 3300005367 Ga0070667_100023784 Ga0070667_1000237846 169
80 3300005367 Ga0070667_100249253 Ga0070667_1002492532 169
81 3300005435 Ga0070714_100030925 Ga0070714_1000309254 169
82 3300005444 Ga0070694_100208093 Ga0070694_1002080933 169
83 3300005455 Ga0070663_100071647 Ga0070663_1000716473 169
84 3300005455 Ga0070663_100108066 Ga0070663_1001080664 169
85 3300005455 Ga0070663_100247134 Ga0070663_1002471343 169
86 3300005455 Ga0070663_100485479 Ga0070663_1004854792 169
87 3300005456 Ga0070678_100001260 Ga0070678_10000126011 169
88 3300005456 Ga0070678_100032705 Ga0070678_1000327052 169
89 3300005456 Ga0070678_100153082 Ga0070678_1001530822 169
90 3300005457 Ga0070662_100020005 Ga0070662_1000200054 169
91 3300005457 Ga0070662_100031091 Ga0070662_1000310913 169
92 3300005457 Ga0070662_100806300 Ga0070662_1008063001 169
93 3300005458 Ga0070681_10022750 Ga0070681_100227506 169
94 3300005458 Ga0070681_10065216 Ga0070681_100652162 169
95 3300005459 Ga0068867_100004445 Ga0068867_1000044455 169
96 3300005459 Ga0068867_100102582 Ga0068867_1001025824 169
97 3300005466 Ga0070685_10391420 Ga0070685_103914201 169
98 3300005530 Ga0070679_100089757 Ga0070679_1000897573 169
99 3300005530 Ga0070679_100101762 Ga0070679_1001017623 169
100 3300005530 Ga0070679_100701867 Ga0070679_1007018671 169
101 3300005530 Ga0070679_100795660 Ga0070679_1007956602 169
102 3300005535 Ga0070684_100069704 Ga0070684_1000697042 169
103 3300005535 Ga0070684_100332872 Ga0070684_1003328723 169
104 3300005539 Ga0068853_100026812 Ga0068853_1000268126 169
105 3300005539 Ga0068853_100066591 Ga0068853_1000665913 169
106 3300005539 Ga0068853_100373461 Ga0068853_1003734612 169
107 3300005543 Ga0070672_100073961 Ga0070672_1000739613 169
108 3300005543 Ga0070672_100097523 Ga0070672_1000975232 169
109 3300005543 Ga0070672_100147708 Ga0070672_1001477082 169
110 3300005543 Ga0070672_100373523 Ga0070672_1003735232 169
111 3300005545 Ga0070695_100641718 Ga0070695_1006417182 169
112 3300005546 Ga0070696_101007390 Ga0070696_1010073901 169
113 3300005547 Ga0070693_100195393 Ga0070693_1001953933 169
114 3300005548 Ga0070665_100116436 Ga0070665_1001164362 169
115 3300005563 Ga0068855_100006737 Ga0068855_1000067373 169
116 3300005563 Ga0068855_100052252 Ga0068855_1000522523 169
117 3300005563 Ga0068855_100128146 Ga0068855_1001281462 169
118 3300005563 Ga0068855_100207989 Ga0068855_1002079892 169
119 3300005563 Ga0068855_100448893 Ga0068855_1004488933 169
120 3300005563 Ga0068855_100672022 Ga0068855_1006720222 169
121 3300005563 Ga0068855_101054834 Ga0068855_1010548342 169
122 3300005564 Ga0070664_100000207 Ga0070664_10000020735 169
123 3300005564 Ga0070664_100018669 Ga0070664_1000186695 169
124 3300005564 Ga0070664_100042636 Ga0070664_1000426363 169
125 3300005564 Ga0070664_100054798 Ga0070664_1000547984 169
126 3300005564 Ga0070664_100056725 Ga0070664_1000567253 169
127 3300005564 Ga0070664_100063862 Ga0070664_1000638622 169
128 3300005564 Ga0070664_100383643 Ga0070664_1003836433 169
129 3300005577 Ga0068857_100024467 Ga0068857_1000244677 169
130 3300005577 Ga0068857_100051464 Ga0068857_1000514645 169
131 3300005577 Ga0068857_100183121 Ga0068857_1001831212 169
132 3300005577 Ga0068857_100350540 Ga0068857_1003505402 169
133 3300005577 Ga0068857_100368516 Ga0068857_1003685163 169
134 3300005577 Ga0068857_101250398 Ga0068857_1012503982 169
135 3300005578 Ga0068854_100001469 Ga0068854_1000014699 169
136 3300005578 Ga0068854_100104612 Ga0068854_1001046122 169
137 3300005614 Ga0068856_100002757 Ga0068856_10000275712 169
138 3300005614 Ga0068856_100043027 Ga0068856_1000430272 169
139 3300005614 Ga0068856_100047272 Ga0068856_1000472724 169
140 3300005614 Ga0068856_100268078 Ga0068856_1002680782 169
141 3300005616 Ga0068852_100003532 Ga0068852_1000035328 169
142 3300005616 Ga0068852_100115790 Ga0068852_1001157902 169
143 3300005616 Ga0068852_100159300 Ga0068852_1001593002 169
144 3300005616 Ga0068852_100236326 Ga0068852_1002363263 169
145 3300005616 Ga0068852_100256822 Ga0068852_1002568222 169
146 3300005616 Ga0068852_100355751 Ga0068852_1003557512 169
147 3300005617 Ga0068859_100115387 Ga0068859_1001153872 169
148 3300005617 Ga0068859_100270674 Ga0068859_1002706744 169
149 3300005617 Ga0068859_100701158 Ga0068859_1007011581 169
150 3300005618 Ga0068864_100007304 Ga0068864_1000073049 169
151 3300005618 Ga0068864_100166433 Ga0068864_1001664332 169
152 3300005618 Ga0068864_100521929 Ga0068864_1005219291 169
153 3300005618 Ga0068864_100809918 Ga0068864_1008099182 169
154 3300005618 Ga0068864_101003272 Ga0068864_1010032722 169
155 3300005719 Ga0068861_100245577 Ga0068861_1002455772 169
156 3300005834 Ga0068851_10018818 Ga0068851_100188185 169
157 3300005834 Ga0068851_10040393 Ga0068851_100403933 169
158 3300005841 Ga0068863_100043886 Ga0068863_1000438866 169
159 3300005841 Ga0068863_100134878 Ga0068863_1001348784 169
160 3300005841 Ga0068863_100147312 Ga0068863_1001473123 169
161 3300005841 Ga0068863_100629474 Ga0068863_1006294742 169
162 3300005842 Ga0068858_100018773 Ga0068858_1000187733 169
163 3300005842 Ga0068858_100305712 Ga0068858_1003057124 169
164 3300005843 Ga0068860_100009940 Ga0068860_1000099409 169
165 3300005843 Ga0068860_100721240 Ga0068860_1007212401 169
166 3300005844 Ga0068862_100031315 Ga0068862_1000313157 169
167 3300005844 Ga0068862_100038220 Ga0068862_1000382202 169
168 3300005844 Ga0068862_100239079 Ga0068862_1002390792 169
169 3300006177 Ga0075362_10043562 Ga0075362_100435623 169
170 3300006237 Ga0097621_100032254 Ga0097621_1000322544 169
171 3300006358 Ga0068871_100097389 Ga0068871_1000973893 169
172 3300006844 Ga0075428_100233026 Ga0075428_1002330262 169
173 3300006847 Ga0075431_100833483 Ga0075431_1008334832 169
174 3300006852 Ga0075433_10011495 Ga0075433_100114957 169
175 3300006871 Ga0075434_100624084 Ga0075434_1006240841 169
176 3300006881 Ga0068865_100090684 Ga0068865_1000906843 169
177 3300006881 Ga0068865_100188905 Ga0068865_1001889052 169
178 3300006881 Ga0068865_100217270 Ga0068865_1002172702 169
179 3300006881 Ga0068865_100378595 Ga0068865_1003785953 169
180 3300006931 Ga0097620_100115385 Ga0097620_1001153852 169
181 3300006931 Ga0097620_100270684 Ga0097620_1002706844 169
182 3300006931 Ga0097620_100701166 Ga0097620_1007011661 169
183 3300007076 Ga0075435_100220745 Ga0075435_1002207452 169
184 3300009093 Ga0105240_11403729 Ga0105240_114037291 169
185 3300009098 Ga0105245_10948433 Ga0105245_109484332 169
186 3300009101 Ga0105247_10133470 Ga0105247_101334702 169
187 3300009101 Ga0105247_10164050 Ga0105247_101640502 169
188 3300009148 Ga0105243_10000251 Ga0105243_100002518 169
189 3300009148 Ga0105243_10131287 Ga0105243_101312873 169
190 3300009174 Ga0105241_10004809 Ga0105241_100048092 169
191 3300009174 Ga0105241_10826672 Ga0105241_108266722 169
192 3300009174 Ga0105241_10864804 Ga0105241_108648042 169
193 3300009176 Ga0105242_10371000 Ga0105242_103710002 169
194 3300009176 Ga0105242_10762226 Ga0105242_107622262 169
195 3300009177 Ga0105248_10009598 Ga0105248_100095987 169
196 3300009177 Ga0105248_10026178 Ga0105248_100261787 169
197 3300009551 Ga0105238_10229405 Ga0105238_102294052 169
198 3300009553 Ga0105249_10502974 Ga0105249_105029743 169
199 3300010375 Ga0105239_10290300 Ga0105239_102903002 169
200 3300010375 Ga0105239_11391203 Ga0105239_113912032 169
201 3300011119 Ga0105246_10033781 Ga0105246_100337815 169
202 3300011119 Ga0105246_10081041 Ga0105246_100810414 169
203 3300011119 Ga0105246_10303148 Ga0105246_103031481 169
204 3300013100 Ga0157373_10007014 Ga0157373_100070149 169
205 3300013100 Ga0157373_10019837 Ga0157373_100198375 169
206 3300013100 Ga0157373_10029482 Ga0157373_100294823 169
207 3300013100 Ga0157373_10113962 Ga0157373_101139622 169
208 3300013100 Ga0157373_10138425 Ga0157373_101384252 169
209 3300013100 Ga0157373_10206230 Ga0157373_102062302 169
210 3300013100 Ga0157373_10371188 Ga0157373_103711882 169
211 3300013100 Ga0157373_10908481 Ga0157373_109084811 169
212 3300013102 Ga0157371_10000097 Ga0157371_1000009732 169
213 3300013102 Ga0157371_10000672 Ga0157371_1000067242 169
214 3300013102 Ga0157371_10007261 Ga0157371_100072617 169
215 3300013102 Ga0157371_10139008 Ga0157371_101390083 169
216 3300013102 Ga0157371_10154532 Ga0157371_101545322 169
217 3300013102 Ga0157371_10288889 Ga0157371_102888892 169
218 3300013102 Ga0157371_10690415 Ga0157371_106904152 169
219 3300013104 Ga0157370_10083604 Ga0157370_100836042 169
220 3300013104 Ga0157370_10105484 Ga0157370_101054843 169
221 3300013104 Ga0157370_10111263 Ga0157370_101112634 169
222 3300013104 Ga0157370_10162936 Ga0157370_101629362 169
223 3300013104 Ga0157370_10226088 Ga0157370_102260882 169
224 3300013105 Ga0157369_10015160 Ga0157369_100151606 169
225 3300013105 Ga0157369_10074758 Ga0157369_100747582 169
226 3300013105 Ga0157369_10181774 Ga0157369_101817743 169
227 3300013105 Ga0157369_10189669 Ga0157369_101896693 169
228 3300013105 Ga0157369_10764383 Ga0157369_107643832 169
229 3300013296 Ga0157374_10056966 Ga0157374_100569663 169
230 3300013296 Ga0157374_10475619 Ga0157374_104756192 169
231 3300013297 Ga0157378_11165935 Ga0157378_111659352 169
232 3300013307 Ga0157372_10294126 Ga0157372_102941262 169
233 3300013307 Ga0157372_10387889 Ga0157372_103878892 169
234 3300013307 Ga0157372_10469415 Ga0157372_104694152 169
235 3300013307 Ga0157372_10550021 Ga0157372_105500213 169
236 3300013307 Ga0157372_10640106 Ga0157372_106401063 169
237 3300013307 Ga0157372_11118273 Ga0157372_111182731 169
238 3300013308 Ga0157375_10244020 Ga0157375_102440202 169
239 3300013308 Ga0157375_10844955 Ga0157375_108449552 169
240 3300014325 Ga0163163_10592187 Ga0163163_105921871 169
241 3300014326 Ga0157380_10007468 Ga0157380_100074686 169
242 3300014497 Ga0182008_10127822 Ga0182008_101278222 169
243 3300014745 Ga0157377_10032875 Ga0157377_100328752 169
244 3300014968 Ga0157379_10066864 Ga0157379_100668643 169
245 3300025315 Ga0207697_10041568 Ga0207697_100415682 169
246 3300025321 Ga0207656_10104770 Ga0207656_101047701 169
247 3300025893 Ga0207682_10002413 Ga0207682_100024136 169
248 3300025893 Ga0207682_10030830 Ga0207682_100308302 169
249 3300025900 Ga0207710_10258327 Ga0207710_102583272 169
250 3300025901 Ga0207688_10023320 Ga0207688_100233203 169
251 3300025901 Ga0207688_10037924 Ga0207688_100379242 169
252 3300025903 Ga0207680_10159193 Ga0207680_101591932 169
253 3300025904 Ga0207647_10000870 Ga0207647_100008707 169
254 3300025904 Ga0207647_10028810 Ga0207647_100288105 169
255 3300025904 Ga0207647_10039999 Ga0207647_100399994 169
256 3300025904 Ga0207647_10072738 Ga0207647_100727383 169
257 3300025907 Ga0207645_10001588 Ga0207645_100015887 169
258 3300025907 Ga0207645_10019240 Ga0207645_100192402 169
259 3300025907 Ga0207645_10039122 Ga0207645_100391222 169
260 3300025908 Ga0207643_10488766 Ga0207643_104887662 169
261 3300025909 Ga0207705_10000169 Ga0207705_100001697 169
262 3300025909 Ga0207705_10003070 Ga0207705_100030705 169
263 3300025909 Ga0207705_10025962 Ga0207705_100259623 169
264 3300025909 Ga0207705_10027747 Ga0207705_100277474 169
265 3300025909 Ga0207705_10055255 Ga0207705_100552552 169
266 3300025909 Ga0207705_10057598 Ga0207705_100575984 169
267 3300025909 Ga0207705_10128814 Ga0207705_101288142 169
268 3300025909 Ga0207705_10268918 Ga0207705_102689182 169
269 3300025909 Ga0207705_10394267 Ga0207705_103942672 169
270 3300025909 Ga0207705_10812569 Ga0207705_108125692 169
271 3300025911 Ga0207654_10000606 Ga0207654_1000060613 169
272 3300025912 Ga0207707_10041327 Ga0207707_100413274 169
273 3300025912 Ga0207707_10120770 Ga0207707_101207704 169
274 3300025913 Ga0207695_10002617 Ga0207695_1000261718 169
275 3300025914 Ga0207671_10044589 Ga0207671_100445892 169
276 3300025917 Ga0207660_10014640 Ga0207660_100146402 169
277 3300025917 Ga0207660_10021280 Ga0207660_100212804 169
278 3300025917 Ga0207660_10027210 Ga0207660_100272103 169
279 3300025917 Ga0207660_10185535 Ga0207660_101855352 169
280 3300025917 Ga0207660_10190956 Ga0207660_101909562 169
281 3300025917 Ga0207660_10324485 Ga0207660_103244852 169
282 3300025919 Ga0207657_10000128 Ga0207657_1000012838 169
283 3300025919 Ga0207657_10000948 Ga0207657_1000094818 169
284 3300025919 Ga0207657_10002684 Ga0207657_100026844 169
285 3300025919 Ga0207657_10009585 Ga0207657_100095854 169
286 3300025919 Ga0207657_10034086 Ga0207657_100340867 169
287 3300025919 Ga0207657_10053685 Ga0207657_100536852 169
288 3300025919 Ga0207657_10232018 Ga0207657_102320182 169
289 3300025919 Ga0207657_10300388 Ga0207657_103003882 169
290 3300025920 Ga0207649_10000874 Ga0207649_1000087416 169
291 3300025920 Ga0207649_10003715 Ga0207649_100037159 169
292 3300025920 Ga0207649_10010568 Ga0207649_100105684 169
293 3300025920 Ga0207649_10241783 Ga0207649_102417832 169
294 3300025920 Ga0207649_10397154 Ga0207649_103971542 169
295 3300025921 Ga0207652_10011548 Ga0207652_100115482 169
296 3300025921 Ga0207652_10022628 Ga0207652_100226284 169
297 3300025921 Ga0207652_10117113 Ga0207652_101171133 169
298 3300025921 Ga0207652_10215672 Ga0207652_102156722 169
299 3300025921 Ga0207652_10893488 Ga0207652_108934881 169
300 3300025923 Ga0207681_10012905 Ga0207681_100129053 169
301 3300025923 Ga0207681_10015565 Ga0207681_100155653 169
302 3300025923 Ga0207681_10222713 Ga0207681_102227132 169
303 3300025924 Ga0207694_10061289 Ga0207694_100612892 169
304 3300025924 Ga0207694_10245834 Ga0207694_102458342 169
305 3300025925 Ga0207650_10043697 Ga0207650_100436974 169
306 3300025925 Ga0207650_10063528 Ga0207650_100635285 169
307 3300025925 Ga0207650_10103608 Ga0207650_101036082 169
308 3300025925 Ga0207650_10106915 Ga0207650_101069152 169
309 3300025926 Ga0207659_10044012 Ga0207659_100440123 169
310 3300025928 Ga0207700_10284304 Ga0207700_102843043 169
311 3300025929 Ga0207664_10055353 Ga0207664_100553532 169
312 3300025929 Ga0207664_10528200 Ga0207664_105282002 169
313 3300025931 Ga0207644_10034028 Ga0207644_100340282 169
314 3300025931 Ga0207644_10045797 Ga0207644_100457973 169
315 3300025931 Ga0207644_10248132 Ga0207644_102481322 169
316 3300025932 Ga0207690_10027810 Ga0207690_100278104 169
317 3300025932 Ga0207690_10054203 Ga0207690_100542032 169
318 3300025932 Ga0207690_10084138 Ga0207690_100841383 169
319 3300025932 Ga0207690_10158777 Ga0207690_101587771 169
320 3300025933 Ga0207706_10004513 Ga0207706_100045132 169
321 3300025933 Ga0207706_10014483 Ga0207706_100144833 169
322 3300025933 Ga0207706_10057754 Ga0207706_100577545 169
323 3300025933 Ga0207706_10078756 Ga0207706_100787563 169
324 3300025933 Ga0207706_10392296 Ga0207706_103922963 169
325 3300025933 Ga0207706_10658606 Ga0207706_106586061 169
326 3300025934 Ga0207686_10020399 Ga0207686_100203992 169
327 3300025935 Ga0207709_10000188 Ga0207709_1000018822 169
328 3300025937 Ga0207669_10000185 Ga0207669_1000018523 169
329 3300025937 Ga0207669_10003885 Ga0207669_100038857 169
330 3300025937 Ga0207669_10049240 Ga0207669_100492404 169
331 3300025938 Ga0207704_10065698 Ga0207704_100656982 169
332 3300025938 Ga0207704_10094069 Ga0207704_100940693 169
333 3300025940 Ga0207691_10090793 Ga0207691_100907933 169
334 3300025940 Ga0207691_10142461 Ga0207691_101424612 169
335 3300025940 Ga0207691_10227254 Ga0207691_102272542 169
336 3300025940 Ga0207691_10333358 Ga0207691_103333582 169
337 3300025941 Ga0207711_10001624 Ga0207711_1000162415 169
338 3300025941 Ga0207711_10032914 Ga0207711_100329144 169
339 3300025941 Ga0207711_10487104 Ga0207711_104871041 169
340 3300025942 Ga0207689_10022619 Ga0207689_100226197 169
341 3300025944 Ga0207661_10036009 Ga0207661_100360094 169
342 3300025944 Ga0207661_10044750 Ga0207661_100447503 169
343 3300025945 Ga0207679_10000286 Ga0207679_1000028635 169
344 3300025945 Ga0207679_10021911 Ga0207679_100219114 169
345 3300025945 Ga0207679_10037440 Ga0207679_100374404 169
346 3300025945 Ga0207679_10111785 Ga0207679_101117852 169
347 3300025945 Ga0207679_10780592 Ga0207679_107805921 169
348 3300025949 Ga0207667_10000010 Ga0207667_10000010279 169
349 3300025949 Ga0207667_10003642 Ga0207667_1000364217 169
350 3300025949 Ga0207667_10009700 Ga0207667_100097008 169
351 3300025949 Ga0207667_10075833 Ga0207667_100758332 169
352 3300025949 Ga0207667_10080702 Ga0207667_100807023 169
353 3300025949 Ga0207667_10117229 Ga0207667_101172292 169
354 3300025960 Ga0207651_10050975 Ga0207651_100509755 169
355 3300025960 Ga0207651_10057965 Ga0207651_100579653 169
356 3300025960 Ga0207651_10588564 Ga0207651_105885642 169
357 3300025961 Ga0207712_10231247 Ga0207712_102312473 169
358 3300025972 Ga0207668_10000074 Ga0207668_1000007459 169
359 3300025972 Ga0207668_10149534 Ga0207668_101495342 169
360 3300025972 Ga0207668_10207331 Ga0207668_102073312 169
361 3300025981 Ga0207640_10002376 Ga0207640_100023768 169
362 3300025981 Ga0207640_10106571 Ga0207640_101065713 169
363 3300025981 Ga0207640_10258194 Ga0207640_102581942 169
364 3300025986 Ga0207658_10014644 Ga0207658_100146447 169
365 3300025986 Ga0207658_10146498 Ga0207658_101464983 169
366 3300025986 Ga0207658_10313736 Ga0207658_103137361 169
367 3300026023 Ga0207677_10240333 Ga0207677_102403332 169
368 3300026023 Ga0207677_10368086 Ga0207677_103680862 169
369 3300026023 Ga0207677_10911173 Ga0207677_109111732 169
370 3300026035 Ga0207703_10112867 Ga0207703_101128672 169
371 3300026035 Ga0207703_10247089 Ga0207703_102470894 169
372 3300026041 Ga0207639_10002715 Ga0207639_100027155 169
373 3300026041 Ga0207639_10004552 Ga0207639_100045522 169
374 3300026041 Ga0207639_10219000 Ga0207639_102190002 169
375 3300026041 Ga0207639_10757382 Ga0207639_107573822 169
376 3300026067 Ga0207678_10004608 Ga0207678_100046083 169
377 3300026067 Ga0207678_10014926 Ga0207678_100149263 169
378 3300026067 Ga0207678_10031686 Ga0207678_100316866 169
379 3300026067 Ga0207678_10039479 Ga0207678_100394794 169
380 3300026067 Ga0207678_10046457 Ga0207678_100464574 169
381 3300026067 Ga0207678_10306539 Ga0207678_103065392 169
382 3300026067 Ga0207678_10703679 Ga0207678_107036792 169
383 3300026078 Ga0207702_10003658 Ga0207702_100036585 169
384 3300026078 Ga0207702_10036604 Ga0207702_100366043 169
385 3300026078 Ga0207702_10074727 Ga0207702_100747272 169
386 3300026078 Ga0207702_10125149 Ga0207702_101251494 169
387 3300026078 Ga0207702_10193656 Ga0207702_101936562 169
388 3300026078 Ga0207702_10229909 Ga0207702_102299092 169
389 3300026088 Ga0207641_10020421 Ga0207641_100204216 169
390 3300026088 Ga0207641_10108754 Ga0207641_101087543 169
391 3300026088 Ga0207641_10142766 Ga0207641_101427662 169
392 3300026088 Ga0207641_10430910 Ga0207641_104309102 169
393 3300026089 Ga0207648_10029760 Ga0207648_100297605 169
394 3300026089 Ga0207648_10131957 Ga0207648_101319575 169
395 3300026095 Ga0207676_10054841 Ga0207676_100548413 169
396 3300026095 Ga0207676_10114491 Ga0207676_101144912 169
397 3300026095 Ga0207676_10164538 Ga0207676_101645382 169
398 3300026095 Ga0207676_10594755 Ga0207676_105947552 169
399 3300026116 Ga0207674_10001488 Ga0207674_1000148818 169
400 3300026116 Ga0207674_10003633 Ga0207674_1000363318 169
401 3300026116 Ga0207674_10013043 Ga0207674_100130438 169
402 3300026116 Ga0207674_10023350 Ga0207674_100233506 169
403 3300026116 Ga0207674_10027916 Ga0207674_100279168 169
404 3300026116 Ga0207674_10081229 Ga0207674_100812292 169
405 3300026116 Ga0207674_10173190 Ga0207674_101731903 169
406 3300026116 Ga0207674_10955956 Ga0207674_109559562 169
407 3300026118 Ga0207675_100097639 Ga0207675_1000976396 169
408 3300026118 Ga0207675_100582498 Ga0207675_1005824982 169
409 3300026121 Ga0207683_10003535 Ga0207683_100035354 169
410 3300026121 Ga0207683_10009767 Ga0207683_100097679 169
411 3300026121 Ga0207683_10021536 Ga0207683_100215362 169
412 3300026121 Ga0207683_10113052 Ga0207683_101130522 169
413 3300026142 Ga0207698_10000647 Ga0207698_100006478 169
414 3300026142 Ga0207698_10001368 Ga0207698_100013689 169
415 3300026142 Ga0207698_10001981 Ga0207698_100019812 169
416 3300026142 Ga0207698_10017848 Ga0207698_100178484 169
417 3300026142 Ga0207698_10061580 Ga0207698_100615805 169
418 3300026142 Ga0207698_10352694 Ga0207698_103526943 169
419 3300026142 Ga0207698_10431288 Ga0207698_104312882 169
420 3300026142 Ga0207698_10610233 Ga0207698_106102332 169
421 3300028379 Ga0268266_10037925 Ga0268266_100379252 169
422 3300028379 Ga0268266_10149400 Ga0268266_101494002 169
423 3300028380 Ga0268265_10021590 Ga0268265_100215902 169
424 3300028380 Ga0268265_10039594 Ga0268265_100395944 169
425 3300028381 Ga0268264_10015490 Ga0268264_100154903 169
426 3300031731 Ga0307405_10357725 Ga0307405_103577252 169
427 3300031731 Ga0307405_10383106 Ga0307405_103831062 169
428 3300031824 Ga0307413_10720858 Ga0307413_107208582 169
429 3300031852 Ga0307410_10040574 Ga0307410_100405743 169
430 3300031852 Ga0307410_10102640 Ga0307410_101026404 169
431 3300031852 Ga0307410_10393753 Ga0307410_103937532 169
432 3300031852 Ga0307410_10461284 Ga0307410_104612842 169
433 3300031901 Ga0307406_10251734 Ga0307406_102517342 169
434 3300031901 Ga0307406_10458286 Ga0307406_104582862 169
435 3300031903 Ga0307407_10188739 Ga0307407_101887391 169
436 3300031903 Ga0307407_10202694 Ga0307407_102026942 169
437 3300031911 Ga0307412_10120735 Ga0307412_101207352 169
438 3300031911 Ga0307412_10182150 Ga0307412_101821502 169
439 3300031911 Ga0307412_10699954 Ga0307412_106999542 169
440 3300031911 Ga0307412_11008827 Ga0307412_110088271 169
441 3300031995 Ga0307409_100141735 Ga0307409_1001417352 169
442 3300031995 Ga0307409_100945421 Ga0307409_1009454212 169
443 3300032002 Ga0307416_100158982 Ga0307416_1001589823 169
444 3300032002 Ga0307416_100282916 Ga0307416_1002829163 169
445 3300032004 Ga0307414_10230900 Ga0307414_102309002 169
446 3300032004 Ga0307414_10839561 Ga0307414_108395612 169
447 3300032005 Ga0307411_10029570 Ga0307411_100295703 169
448 3300032005 Ga0307411_10126730 Ga0307411_101267302 169
449 3300032005 Ga0307411_10165785 Ga0307411_101657853 169
450 3300032005 Ga0307411_10386629 Ga0307411_103866292 169
451 3300032005 Ga0307411_11170056 Ga0307411_111700562 169
452 3300032126 Ga0307415_100027261 Ga0307415_1000272613 169
453 3300032126 Ga0307415_100032440 Ga0307415_1000324402 169
454 3300032126 Ga0307415_100079553 Ga0307415_1000795532 169
455 3300032126 Ga0307415_100164933 Ga0307415_1001649333 169
456 3300037312 Ga0395899_0000514 Ga0395899_0000514_2032_2592 169
457 3300037312 Ga0395899_0005372 Ga0395899_0005372_3207_3749 169
458 3300037312 Ga0395899_0010033 Ga0395899_0010033_6025_6534 169
459 3300037312 Ga0395899_0123410 Ga0395899_0123410_1283_1843 169
460 3300037418 Ga0395900_0001018 Ga0395900_0001018_7365_7925 169
461 3300037418 Ga0395900_0018394 Ga0395900_0018394_6184_6693 169
462 3300037418 Ga0395900_0128422 Ga0395900_0128422_1877_2419 169
463 3300037418 Ga0395900_0160265 Ga0395900_0160265_320_880 169
464 3300037418 Ga0395900_0437293 Ga0395900_0437293_348_857 169
465 3300037418 Ga0395900_0537866 Ga0395900_0537866_119_679 169
466 3300037418 Ga0395900_0610404 Ga0395900_0610404_190_699 169
467 3300037466 Ga0395898_0000021 Ga0395898_0000021_62675_63235 169
468 3300037466 Ga0395898_0015950 Ga0395898_0015950_4848_5390 169
469 3300037466 Ga0395898_0037082 Ga0395898_0037082_1706_2266 169
470 3300037466 Ga0395898_0056425 Ga0395898_0056425_2833_3342 169
471 3300037466 Ga0395898_0126966 Ga0395898_0126966_1780_2289 169
472 3300037471 Ga0395905_0000006 Ga0395905_0000006_278927_279487 169
473 3300037471 Ga0395905_0028578 Ga0395905_0028578_36_596 169
474 3300037471 Ga0395905_0067276 Ga0395905_0067276_178_738 169
475 3300037471 Ga0395905_0082716 Ga0395905_0082716_2367_2876 169
476 3300037471 Ga0395905_0132523 Ga0395905_0132523_1056_1565 169
477 3300037471 Ga0395905_0164671 Ga0395905_0164671_1302_1862 169
478 3300037471 Ga0395905_0404359 Ga0395905_0404359_448_981 169
479 3300037471 Ga0395905_0501176 Ga0395905_0501176_446_1006 169
480 3300037471 Ga0395905_1077793 Ga0395905_1077793_130_690 169
481 3300037471 Ga0395905_1083138 Ga0395905_1083138_120_629 169
482 3300038443 Ga0395901_0000696 Ga0395901_0000696_31445_32005 169
483 3300038443 Ga0395901_0004314 Ga0395901_0004314_11445_11954 169
484 3300038443 Ga0395901_0007679 Ga0395901_0007679_7971_8480 169
485 3300038443 Ga0395901_0039783 Ga0395901_0039783_3646_4188 169
486 3300038443 Ga0395901_0136795 Ga0395901_0136795_124_657 169
487 3300038443 Ga0395901_0165446 Ga0395901_0165446_240_800 169
488 3300038443 Ga0395901_0644387 Ga0395901_0644387_176_736 169
489 3300038443 Ga0395901_1055061 Ga0395901_1055061_24_584 169
490 3300042005 Ga0439448_0017830 Ga0439448_0017830_114_674 169
491 3300042012 Ga0439455_0013618 Ga0439455_0013618_1206_1766 169
492 3300042157 Ga0439458_0010029 Ga0439458_0010029_110_670 169
493 3300044658 Ga0466972_0291955 Ga0466972_0291955_11_571 169
494 3300044684 Ga0466966_0293298 Ga0466966_0293298_10_519 169
495 3300044694 Ga0466963_0040632 Ga0466963_0040632_1829_2389 169
496 3300044694 Ga0466963_0620157 Ga0466963_0620157_53_625 169
497 3300044694 Ga0466963_0689365 Ga0466963_0689365_172_681 169
498 3300044694 Ga0466963_0826531 Ga0466963_0826531_98_607 169
499 3300044842 Ga0466957_0514707 Ga0466957_0514707_51_611 169
500 3300044842 Ga0466957_0803918 Ga0466957_0803918_23_583 169
501 3300045836 Ga0466958_0377207 Ga0466958_0377207_194_754 169
502 3300045976 Ga0466967_0088337 Ga0466967_0088337_2289_2798 169
503 3300045976 Ga0466967_0212012 Ga0466967_0212012_843_1352 169
504 3300045976 Ga0466967_0239982 Ga0466967_0239982_1039_1548 169
505 3300045976 Ga0466967_0335726 Ga0466967_0335726_239_799 169
506 3300045976 Ga0466967_0505194 Ga0466967_0505194_330_890 169
507 3300046491 Ga0495584_0042709 Ga0495584_0042709_1187_1741 169
508 3300046491 Ga0495584_0246912 Ga0495584_0246912_236_790 169
509 3300046500 Ga0495596_0020199 Ga0495596_0020199_998_1552 169
510 3300046506 Ga0495583_0011689 Ga0495583_0011689_53_607 169
511 3300046506 Ga0495583_0020161 Ga0495583_0020161_1340_1894 169
512 3300046506 Ga0495583_0129837 Ga0495583_0129837_54_608 169
513 3300046507 Ga0495606_0001113 Ga0495606_0001113_9513_10067 169
514 3300046507 Ga0495606_0086499 Ga0495606_0086499_682_1236 169
515 3300046515 Ga0495620_0167027 Ga0495620_0167027_42_596 169
516 3300046518 Ga0495631_0083945 Ga0495631_0083945_324_878 169
517 3300046520 Ga0495637_0172738 Ga0495637_0172738_40_594 169
518 3300046522 Ga0495643_0002421 Ga0495643_0002421_12984_13538 169
519 3300046522 Ga0495643_0052259 Ga0495643_0052259_37_591 169
520 3300046525 Ga0495663_0003389 Ga0495663_0003389_2709_3263 169
521 3300046525 Ga0495663_0223007 Ga0495663_0223007_43_603 169
522 3300046537 Ga0495598_0017135 Ga0495598_0017135_336_896 169
523 3300046542 Ga0495597_0081536 Ga0495597_0081536_709_1263 169
524 3300046558 Ga0495633_0002185 Ga0495633_0002185_5548_6102 169
525 3300046616 Ga0495668_0000163 Ga0495668_0000163_14472_15026 169
526 3300046616 Ga0495668_0014585 Ga0495668_0014585_1837_2397 169
527 3300046616 Ga0495668_0040080 Ga0495668_0040080_152_712 169
528 3300046648 Ga0495611_0008523 Ga0495611_0008523_2086_2640 169
529 3300046648 Ga0495611_0184834 Ga0495611_0184834_42_596 169
530 3300046660 Ga0495625_0070681 Ga0495625_0070681_52_606 169
531 3300046660 Ga0495625_0110311 Ga0495625_0110311_90_644 169
532 3300046660 Ga0495625_0114008 Ga0495625_0114008_19_573 169
533 3300046684 Ga0495669_0000437 Ga0495669_0000437_3615_4169 169
534 3300046684 Ga0495669_0008002 Ga0495669_0008002_3407_3967 169
535 3300046684 Ga0495669_0061422 Ga0495669_0061422_19_579 169
536 3300046691 Ga0495670_0170399 Ga0495670_0170399_498_1058 169
537 3300046691 Ga0495670_0555184 Ga0495670_0555184_22_576 169
538 3300046694 Ga0495649_0025567 Ga0495649_0025567_2263_2817 169
539 3300046810 Ga0495660_0031632 Ga0495660_0031632_630_1184 169
540 3300046810 Ga0495660_0046350 Ga0495660_0046350_1628_2182 169
541 3300047318 Ga0495636_0324824 Ga0495636_0324824_24_578 169
542 3300047323 Ga0495683_0006658 Ga0495683_0006658_4929_5483 169
543 3300047443 Ga0495687_000447 Ga0495687_000447_19720_20274 169
544 3300047445 Ga0495677_0005358 Ga0495677_0005358_2629_3183 169
545 3300047445 Ga0495677_0346047 Ga0495677_0346047_20_574 169
546 3300047470 Ga0495681_0017561 Ga0495681_0017561_2379_2933 169
547 3300048904 Ga0496101_0671723 Ga0496101_0671723_188_697 169
548 3300048905 Ga0496102_0000828 Ga0496102_0000828_10657_11211 169
549 3300048905 Ga0496102_0172834 Ga0496102_0172834_454_1014 169
550 3300048906 Ga0496103_0000636 Ga0496103_0000636_15454_16008 169
551 3300048906 Ga0496103_0309792 Ga0496103_0309792_407_916 169
552 3300048907 Ga0496104_0009187 Ga0496104_0009187_6555_7109 169
553 3300048907 Ga0496104_0375787 Ga0496104_0375787_179_739 169
554 3300048908 Ga0496105_0006991 Ga0496105_0006991_2491_3045 169
555 3300048909 Ga0496106_0137100 Ga0496106_0137100_136_696 169
556 3300048911 Ga0496108_0010521 Ga0496108_0010521_62_622 169
557 3300048911 Ga0496108_0027908 Ga0496108_0027908_1707_2267 169
558 3300048912 Ga0496109_0019198 Ga0496109_0019198_4409_4969 169
559 3300048912 Ga0496109_0046023 Ga0496109_0046023_1847_2407 169
560 3300048912 Ga0496109_1290452 Ga0496109_1290452_24_533 169
561 3300048913 Ga0496110_0122741 Ga0496110_0122741_1188_1742 169
562 3300048913 Ga0496110_0178827 Ga0496110_0178827_1356_1916 169
563 3300048913 Ga0496110_0319951 Ga0496110_0319951_580_1140 169
564 3300048913 Ga0496110_0998829 Ga0496110_0998829_147_707 169
565 3300048914 Ga0496111_0005767 Ga0496111_0005767_2889_3449 169
566 3300048914 Ga0496111_0438581 Ga0496111_0438581_99_659 169
567 3300048915 Ga0496112_0727475 Ga0496112_0727475_122_682 169
568 3300048916 Ga0496113_0308602 Ga0496113_0308602_245_805 169
569 3300048917 Ga0496114_0000021 Ga0496114_0000021_204162_204722 169
570 3300048917 Ga0496114_0020403 Ga0496114_0020403_4604_5158 169
571 3300048918 Ga0496115_0000624 Ga0496115_0000624_10648_11202 169
572 3300048918 Ga0496115_0001985 Ga0496115_0001985_1086_1595 169
573 3300048919 Ga0496116_0003361 Ga0496116_0003361_2321_2875 169
574 3300048920 Ga0496117_0001766 Ga0496117_0001766_13669_14223 169
575 3300048921 Ga0496118_0001902 Ga0496118_0001902_15551_16105 169
576 3300048922 Ga0496119_0003460 Ga0496119_0003460_2602_3156 169
577 3300048923 Ga0496120_0023070 Ga0496120_0023070_2530_3084 169
578 3300048924 Ga0496121_0002786 Ga0496121_0002786_10576_11130 169
579 3300048927 Ga0496124_0001562 Ga0496124_0001562_13648_14202 169
580 3300048929 Ga0496126_0001925 Ga0496126_0001925_13633_14187 169
581 3300050491 nmdc:mga00v17_117133_c1 nmdc:mga00v17_117133_c1_514_1074 169
582 3300050510 nmdc:mga06r32_986063_c1 nmdc:mga06r32_986063_c1_142_702 169
583 3300050513 nmdc:mga0rr50_294928_c1 nmdc:mga0rr50_294928_c1_122_682 169
584 3300050515 nmdc:mga0a205_6082_c1 nmdc:mga0a205_6082_c1_7536_8096 169
585 3300053079 Ga0500610_0000114 Ga0500610_0000114_12666_13220 169
586 3300053130 Ga0500642_0028960 Ga0500642_0028960_391_945 169
587 3300053730 Ga0500645_000170 Ga0500645_000170_35926_36480 169
588 3300059421 Ga0590071_004629 Ga0590071_004629_2113_2673 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

22

197

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3av3-assembly1.cif.gz_A crystal structure of glycinamide ribonucleotide transformylase 1 from geobacillus kaustophilus 0.8902 2 165
3p9x-assembly1.cif.gz_B crystal structure of phosphoribosylglycinamide formyltransferase from bacillus halodurans 0.8899 2 167
3tqr-assembly1.cif.gz_A structure of the phosphoribosylglycinamide formyltransferase (purn) in complex with ches from coxiella burnetii 0.8892 2 164
1meo-assembly1.cif.gz_A human glycinamide ribonucleotide transformylase at ph 4.2 0.8839 1 166
1men-assembly1.cif.gz_A complex structure of human gar tfase and substrate beta-gar 0.8811 2 166
ID Description Score Start End Superfamily
3av3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.8853 2 164 3.40.50.170
4ds3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.8772 1 166 3.40.50.170
af_Q20143_783_975_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.875 1 166 3.40.50.170
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.8723 12 167 3.40.50.170
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.8657 2 164 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A2M8F696-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9063 2 167 GO:0004644
GO:0005829
GO:0006189
AF-A0A7X0JAL5-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9045 1 169 GO:0004644
GO:0005829
GO:0006189
AF-A0A520HTS9-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9019 1 167 GO:0004644
GO:0005829
GO:0006189
AF-A0A154NC61-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9016 1 169 GO:0004644
GO:0005829
GO:0006189
AF-A0A7X0JAL5-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.8995 1 169 GO:0004644
GO:0005829
GO:0006189

Feature Viewer

pLDDT pTM Quality
86.44 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map