F466747
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 588 | 231 | 588 | 180 |
Family's Representative Sequence
| Representative Sequence | 3300005466|Ga0070685_10391420|Ga0070685_103914201 |
| Length | 203 |
| Sequence | MAIVAAPFRAKGGPRLTMRDAKRVAVLISGRGSNMRALVEQAIGYEVVLVASNKPFAPGLEWARARGIPTWTWDSKGVAKEAFDRMISAALDDHLVGTIALAGFMRVLSPWFISEWQGRVLNIHPSLLPKYRGLDTHQRALDAGDRVHGCSVHLVTEELDAGEVLGSREVPIVSGDDAGALEKRVLEAEHALYPKILSEFVTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 155 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 158 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 161 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 162 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 163 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 164 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 165 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 166 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 167 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 168 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 169 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 170 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 171 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 172 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 173 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 174 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 175 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 176 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 177 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 178 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 204 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 205 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 206 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 207 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 208 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 211 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 212 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 213 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 214 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 215 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 216 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 217 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 218 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 219 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 220 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 221 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 222 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 223 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 224 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 225 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 229 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 230 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 231 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.02 |
| Nodule | 0 |
| Rhizoplane | 4.42 |
| Rhizosphere | 93.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1028926 | 3300001915 | Bacteria | 834 |
| 2 | JGI24740J21852_10018730 | 3300001979 | Bacteria | 2448 |
| 3 | JGI24739J22299_10004359 | 3300001989 | Bacteria | 5421 |
| 4 | JGI24737J22298_10068017 | 3300001990 | Bacteria | 1065 |
| 5 | JGI24735J21928_10040136 | 3300002067 | Bacteria | 1367 |
| 6 | JGI24735J21928_10051821 | 3300002067 | Bacteria | 1184 |
| 7 | JGI24738J21930_10007357 | 3300002075 | Bacteria | 2544 |
| 8 | JGI24738J21930_10032763 | 3300002075 | Bacteria | 1059 |
| 9 | JGI24742J22300_10010005 | 3300002244 | Bacteria | 1566 |
| 10 | Ga0065165_1045447 | 3300005262 | Bacteria | 1279 |
| 11 | Ga0065715_10220665 | 3300005293 | Bacteria | 1193 |
| 12 | Ga0070658_10018933 | 3300005327 | Bacteria | 5515 |
| 13 | Ga0070658_10088163 | 3300005327 | Bacteria | 2555 |
| 14 | Ga0070658_10112268 | 3300005327 | Bacteria | 2259 |
| 15 | Ga0070676_10016308 | 3300005328 | Bacteria | 4106 |
| 16 | Ga0070676_10408872 | 3300005328 | Unclassified | 946 |
| 17 | Ga0070676_10645265 | 3300005328 | Bacteria | 768 |
| 18 | Ga0070683_100005295 | 3300005329 | Bacteria | 10747 |
| 19 | Ga0070683_100011024 | 3300005329 | Bacteria | 7791 |
| 20 | Ga0070683_100035063 | 3300005329 | Bacteria | 4587 |
| 21 | Ga0070670_100010847 | 3300005331 | Bacteria | 7785 |
| 22 | Ga0070670_100025540 | 3300005331 | Bacteria | 5081 |
| 23 | Ga0070670_100079017 | 3300005331 | Bacteria | 2826 |
| 24 | Ga0070670_100322804 | 3300005331 | Bacteria | 1353 |
| 25 | Ga0070677_10000997 | 3300005333 | Bacteria | 9161 |
| 26 | Ga0070677_10029415 | 3300005333 | Bacteria | 2083 |
| 27 | Ga0068869_100494127 | 3300005334 | Bacteria | 1020 |
| 28 | Ga0070666_10011770 | 3300005335 | Bacteria | 5501 |
| 29 | Ga0070666_10114242 | 3300005335 | Bacteria | 1869 |
| 30 | Ga0070680_100000834 | 3300005336 | Bacteria | 21786 |
| 31 | Ga0070680_100022301 | 3300005336 | Bacteria | 5041 |
| 32 | Ga0070680_100131475 | 3300005336 | Bacteria | 2094 |
| 33 | Ga0070680_100207836 | 3300005336 | Bacteria | 1651 |
| 34 | Ga0070680_100247758 | 3300005336 | Bacteria | 1506 |
| 35 | Ga0070680_100742509 | 3300005336 | Bacteria | 845 |
| 36 | Ga0068868_100046121 | 3300005338 | Bacteria | 3411 |
| 37 | Ga0068868_100175176 | 3300005338 | Bacteria | 1777 |
| 38 | Ga0070660_100015476 | 3300005339 | Bacteria | 5510 |
| 39 | Ga0070660_100032087 | 3300005339 | Bacteria | 3950 |
| 40 | Ga0070660_100039524 | 3300005339 | Bacteria | 3586 |
| 41 | Ga0070660_100053691 | 3300005339 | Bacteria | 3109 |
| 42 | Ga0070660_100226815 | 3300005339 | Bacteria | 1519 |
| 43 | Ga0070660_100279879 | 3300005339 | Bacteria | 1365 |
| 44 | Ga0070660_100306173 | 3300005339 | Bacteria | 1303 |
| 45 | Ga0070691_10001109 | 3300005341 | Bacteria | 11174 |
| 46 | Ga0070661_100011683 | 3300005344 | Bacteria | 6123 |
| 47 | Ga0070661_100014547 | 3300005344 | Bacteria | 5545 |
| 48 | Ga0070661_100047096 | 3300005344 | Bacteria | 3155 |
| 49 | Ga0070661_100161052 | 3300005344 | Bacteria | 1699 |
| 50 | Ga0070661_100218714 | 3300005344 | Bacteria | 1460 |
| 51 | Ga0070661_100301206 | 3300005344 | Bacteria | 1248 |
| 52 | Ga0070692_10028373 | 3300005345 | Bacteria | 2781 |
| 53 | Ga0070692_10153035 | 3300005345 | Bacteria | 1315 |
| 54 | Ga0070692_10329499 | 3300005345 | Bacteria | 942 |
| 55 | Ga0070668_100001813 | 3300005347 | Bacteria | 15545 |
| 56 | Ga0070668_100035677 | 3300005347 | Bacteria | 3793 |
| 57 | Ga0070668_100277327 | 3300005347 | Bacteria | 1399 |
| 58 | Ga0070669_100102673 | 3300005353 | Bacteria | 2159 |
| 59 | Ga0070669_100123241 | 3300005353 | Bacteria | 1980 |
| 60 | Ga0070669_100454093 | 3300005353 | Bacteria | 1057 |
| 61 | Ga0070675_100000637 | 3300005354 | Bacteria | 24178 |
| 62 | Ga0070671_100002819 | 3300005355 | Bacteria | 13513 |
| 63 | Ga0070674_100005968 | 3300005356 | Bacteria | 7080 |
| 64 | Ga0070674_100023740 | 3300005356 | Bacteria | 3974 |
| 65 | Ga0070674_100138906 | 3300005356 | Bacteria | 1821 |
| 66 | Ga0070674_100288284 | 3300005356 | Bacteria | 1304 |
| 67 | Ga0070673_100049443 | 3300005364 | Bacteria | 3283 |
| 68 | Ga0070673_100121521 | 3300005364 | Bacteria | 2179 |
| 69 | Ga0070673_100726059 | 3300005364 | Bacteria | 914 |
| 70 | Ga0070659_100003111 | 3300005366 | Bacteria | 11806 |
| 71 | Ga0070659_100017538 | 3300005366 | Bacteria | 5392 |
| 72 | Ga0070659_100029313 | 3300005366 | Bacteria | 4253 |
| 73 | Ga0070659_100042779 | 3300005366 | Bacteria | 3542 |
| 74 | Ga0070659_100070971 | 3300005366 | Bacteria | 2768 |
| 75 | Ga0070659_100171871 | 3300005366 | Bacteria | 1775 |
| 76 | Ga0070659_100869509 | 3300005366 | Bacteria | 787 |
| 77 | Ga0070667_100006814 | 3300005367 | Bacteria | 9490 |
| 78 | Ga0070667_100023784 | 3300005367 | Bacteria | 5086 |
| 79 | Ga0070667_100249253 | 3300005367 | Bacteria | 1587 |
| 80 | Ga0070714_100030925 | 3300005435 | Bacteria | 4461 |
| 81 | Ga0070694_100208093 | 3300005444 | Bacteria | 1462 |
| 82 | Ga0070663_100071647 | 3300005455 | Bacteria | 2522 |
| 83 | Ga0070663_100108066 | 3300005455 | Bacteria | 2086 |
| 84 | Ga0070663_100247134 | 3300005455 | Bacteria | 1411 |
| 85 | Ga0070663_100485479 | 3300005455 | Bacteria | 1023 |
| 86 | Ga0070678_100001260 | 3300005456 | Bacteria | 13428 |
| 87 | Ga0070678_100032705 | 3300005456 | Bacteria | 3603 |
| 88 | Ga0070678_100153082 | 3300005456 | Bacteria | 1860 |
| 89 | Ga0070662_100020005 | 3300005457 | Bacteria | 4555 |
| 90 | Ga0070662_100031091 | 3300005457 | Bacteria | 3744 |
| 91 | Ga0070662_100806300 | 3300005457 | Bacteria | 798 |
| 92 | Ga0070681_10022750 | 3300005458 | Bacteria | 6299 |
| 93 | Ga0070681_10065216 | 3300005458 | Bacteria | 3611 |
| 94 | Ga0068867_100004445 | 3300005459 | Bacteria | 9860 |
| 95 | Ga0068867_100102582 | 3300005459 | Bacteria | 2187 |
| 96 | Ga0070685_10391420 | 3300005466 | Bacteria | 960 |
| 97 | Ga0070679_100089757 | 3300005530 | Bacteria | 3060 |
| 98 | Ga0070679_100101762 | 3300005530 | Bacteria | 2859 |
| 99 | Ga0070679_100701867 | 3300005530 | Bacteria | 954 |
| 100 | Ga0070679_100795660 | 3300005530 | Bacteria | 889 |
| 101 | Ga0070684_100069704 | 3300005535 | Bacteria | 3092 |
| 102 | Ga0070684_100332872 | 3300005535 | Bacteria | 1395 |
| 103 | Ga0068853_100026812 | 3300005539 | Bacteria | 4841 |
| 104 | Ga0068853_100066591 | 3300005539 | Bacteria | 3128 |
| 105 | Ga0068853_100373461 | 3300005539 | Bacteria | 1331 |
| 106 | Ga0070672_100073961 | 3300005543 | Bacteria | 2717 |
| 107 | Ga0070672_100097523 | 3300005543 | Bacteria | 2380 |
| 108 | Ga0070672_100147708 | 3300005543 | Bacteria | 1943 |
| 109 | Ga0070672_100373523 | 3300005543 | Bacteria | 1219 |
| 110 | Ga0070695_100641718 | 3300005545 | Bacteria | 838 |
| 111 | Ga0070696_101007390 | 3300005546 | Bacteria | 696 |
| 112 | Ga0070693_100195393 | 3300005547 | Bacteria | 1311 |
| 113 | Ga0070665_100116436 | 3300005548 | Bacteria | 2675 |
| 114 | Ga0068855_100006737 | 3300005563 | Bacteria | 13931 |
| 115 | Ga0068855_100052252 | 3300005563 | Bacteria | 4811 |
| 116 | Ga0068855_100128146 | 3300005563 | Bacteria | 2900 |
| 117 | Ga0068855_100207989 | 3300005563 | Bacteria | 2200 |
| 118 | Ga0068855_100448893 | 3300005563 | Bacteria | 1407 |
| 119 | Ga0068855_100672022 | 3300005563 | Bacteria | 1111 |
| 120 | Ga0068855_101054834 | 3300005563 | Bacteria | 852 |
| 121 | Ga0070664_100000207 | 3300005564 | Bacteria | 42082 |
| 122 | Ga0070664_100018669 | 3300005564 | Bacteria | 5702 |
| 123 | Ga0070664_100042636 | 3300005564 | Bacteria | 3830 |
| 124 | Ga0070664_100054798 | 3300005564 | Bacteria | 3385 |
| 125 | Ga0070664_100056725 | 3300005564 | Bacteria | 3328 |
| 126 | Ga0070664_100063862 | 3300005564 | Bacteria | 3139 |
| 127 | Ga0070664_100383643 | 3300005564 | Bacteria | 1283 |
| 128 | Ga0068857_100024467 | 3300005577 | Bacteria | 5316 |
| 129 | Ga0068857_100051464 | 3300005577 | Bacteria | 3654 |
| 130 | Ga0068857_100183121 | 3300005577 | Bacteria | 1906 |
| 131 | Ga0068857_100350540 | 3300005577 | Bacteria | 1367 |
| 132 | Ga0068857_100368516 | 3300005577 | Bacteria | 1332 |
| 133 | Ga0068857_101250398 | 3300005577 | Bacteria | 720 |
| 134 | Ga0068854_100001469 | 3300005578 | Bacteria | 14276 |
| 135 | Ga0068854_100104612 | 3300005578 | Bacteria | 2127 |
| 136 | Ga0068856_100002757 | 3300005614 | Bacteria | 17993 |
| 137 | Ga0068856_100043027 | 3300005614 | Bacteria | 4443 |
| 138 | Ga0068856_100047272 | 3300005614 | Bacteria | 4240 |
| 139 | Ga0068856_100268078 | 3300005614 | Bacteria | 1723 |
| 140 | Ga0068852_100003532 | 3300005616 | Bacteria | 10941 |
| 141 | Ga0068852_100115790 | 3300005616 | Bacteria | 2444 |
| 142 | Ga0068852_100159300 | 3300005616 | Bacteria | 2106 |
| 143 | Ga0068852_100236326 | 3300005616 | Bacteria | 1744 |
| 144 | Ga0068852_100256822 | 3300005616 | Bacteria | 1676 |
| 145 | Ga0068852_100355751 | 3300005616 | Bacteria | 1431 |
| 146 | Ga0068859_100115387 | 3300005617 | Bacteria | 2750 |
| 147 | Ga0068859_100270674 | 3300005617 | Bacteria | 1791 |
| 148 | Ga0068859_100701158 | 3300005617 | Bacteria | 1103 |
| 149 | Ga0068864_100007304 | 3300005618 | Bacteria | 9088 |
| 150 | Ga0068864_100166433 | 3300005618 | Bacteria | 2007 |
| 151 | Ga0068864_100521929 | 3300005618 | Bacteria | 1145 |
| 152 | Ga0068864_100809918 | 3300005618 | Bacteria | 921 |
| 153 | Ga0068864_101003272 | 3300005618 | Bacteria | 828 |
| 154 | Ga0068861_100245577 | 3300005719 | Bacteria | 1525 |
| 155 | Ga0068851_10018818 | 3300005834 | Bacteria | 3332 |
| 156 | Ga0068851_10040393 | 3300005834 | Bacteria | 2344 |
| 157 | Ga0068863_100043886 | 3300005841 | Bacteria | 4244 |
| 158 | Ga0068863_100134878 | 3300005841 | Bacteria | 2358 |
| 159 | Ga0068863_100147312 | 3300005841 | Bacteria | 2252 |
| 160 | Ga0068863_100629474 | 3300005841 | Bacteria | 1063 |
| 161 | Ga0068858_100018773 | 3300005842 | Bacteria | 6469 |
| 162 | Ga0068858_100305712 | 3300005842 | Bacteria | 1518 |
| 163 | Ga0068860_100009940 | 3300005843 | Bacteria | 9428 |
| 164 | Ga0068860_100721240 | 3300005843 | Bacteria | 1007 |
| 165 | Ga0068862_100031315 | 3300005844 | Bacteria | 4489 |
| 166 | Ga0068862_100038220 | 3300005844 | Bacteria | 4070 |
| 167 | Ga0068862_100239079 | 3300005844 | Bacteria | 1650 |
| 168 | Ga0075362_10043562 | 3300006177 | Bacteria | 1987 |
| 169 | Ga0097621_100032254 | 3300006237 | Bacteria | 4163 |
| 170 | Ga0068871_100097389 | 3300006358 | Bacteria | 2459 |
| 171 | Ga0075428_100233026 | 3300006844 | Bacteria | 1987 |
| 172 | Ga0075431_100833483 | 3300006847 | Bacteria | 894 |
| 173 | Ga0075433_10011495 | 3300006852 | Bacteria | 7129 |
| 174 | Ga0075434_100624084 | 3300006871 | Bacteria | 1097 |
| 175 | Ga0068865_100090684 | 3300006881 | Bacteria | 2217 |
| 176 | Ga0068865_100188905 | 3300006881 | Bacteria | 1592 |
| 177 | Ga0068865_100217270 | 3300006881 | Bacteria | 1493 |
| 178 | Ga0068865_100378595 | 3300006881 | Bacteria | 1154 |
| 179 | Ga0097620_100115385 | 3300006931 | Bacteria | 2750 |
| 180 | Ga0097620_100270684 | 3300006931 | Bacteria | 1791 |
| 181 | Ga0097620_100701166 | 3300006931 | Bacteria | 1103 |
| 182 | Ga0075435_100220745 | 3300007076 | Bacteria | 1610 |
| 183 | Ga0105240_11403729 | 3300009093 | Bacteria | 734 |
| 184 | Ga0105245_10948433 | 3300009098 | Bacteria | 903 |
| 185 | Ga0105247_10133470 | 3300009101 | Bacteria | 1620 |
| 186 | Ga0105247_10164050 | 3300009101 | Bacteria | 1473 |
| 187 | Ga0105243_10000251 | 3300009148 | Bacteria | 61790 |
| 188 | Ga0105243_10131287 | 3300009148 | Bacteria | 2125 |
| 189 | Ga0105241_10004809 | 3300009174 | Bacteria | 9950 |
| 190 | Ga0105241_10826672 | 3300009174 | Unclassified | 855 |
| 191 | Ga0105241_10864804 | 3300009174 | Bacteria | 837 |
| 192 | Ga0105242_10371000 | 3300009176 | Bacteria | 1327 |
| 193 | Ga0105242_10762226 | 3300009176 | Bacteria | 954 |
| 194 | Ga0105248_10009598 | 3300009177 | Bacteria | 10653 |
| 195 | Ga0105248_10026178 | 3300009177 | Bacteria | 6490 |
| 196 | Ga0105238_10229405 | 3300009551 | Bacteria | 1834 |
| 197 | Ga0105249_10502974 | 3300009553 | Bacteria | 1257 |
| 198 | Ga0105239_10290300 | 3300010375 | Bacteria | 1842 |
| 199 | Ga0105239_11391203 | 3300010375 | Bacteria | 810 |
| 200 | Ga0105246_10033781 | 3300011119 | Bacteria | 3402 |
| 201 | Ga0105246_10081041 | 3300011119 | Bacteria | 2312 |
| 202 | Ga0105246_10303148 | 3300011119 | Bacteria | 1291 |
| 203 | Ga0157327_1036871 | 3300012512 | Bacteria | 639 |
| 204 | Ga0157373_10007014 | 3300013100 | Bacteria | 8395 |
| 205 | Ga0157373_10019837 | 3300013100 | Bacteria | 4891 |
| 206 | Ga0157373_10029482 | 3300013100 | Bacteria | 3952 |
| 207 | Ga0157373_10113962 | 3300013100 | Bacteria | 1900 |
| 208 | Ga0157373_10138425 | 3300013100 | Bacteria | 1712 |
| 209 | Ga0157373_10206230 | 3300013100 | Bacteria | 1386 |
| 210 | Ga0157373_10371188 | 3300013100 | Bacteria | 1022 |
| 211 | Ga0157373_10908481 | 3300013100 | Bacteria | 654 |
| 212 | Ga0157371_10000097 | 3300013102 | Bacteria | 134150 |
| 213 | Ga0157371_10000672 | 3300013102 | Bacteria | 40585 |
| 214 | Ga0157371_10007261 | 3300013102 | Bacteria | 8999 |
| 215 | Ga0157371_10139008 | 3300013102 | Bacteria | 1730 |
| 216 | Ga0157371_10154532 | 3300013102 | Bacteria | 1637 |
| 217 | Ga0157371_10288889 | 3300013102 | Bacteria | 1185 |
| 218 | Ga0157371_10690415 | 3300013102 | Bacteria | 764 |
| 219 | Ga0157370_10083604 | 3300013104 | Bacteria | 3001 |
| 220 | Ga0157370_10105484 | 3300013104 | Bacteria | 2638 |
| 221 | Ga0157370_10111263 | 3300013104 | Bacteria | 2560 |
| 222 | Ga0157370_10162936 | 3300013104 | Bacteria | 2074 |
| 223 | Ga0157370_10226088 | 3300013104 | Bacteria | 1732 |
| 224 | Ga0157369_10015160 | 3300013105 | Bacteria | 8700 |
| 225 | Ga0157369_10074758 | 3300013105 | Bacteria | 3634 |
| 226 | Ga0157369_10181774 | 3300013105 | Bacteria | 2212 |
| 227 | Ga0157369_10189669 | 3300013105 | Bacteria | 2160 |
| 228 | Ga0157369_10764383 | 3300013105 | Bacteria | 994 |
| 229 | Ga0157374_10056966 | 3300013296 | Bacteria | 3650 |
| 230 | Ga0157374_10475619 | 3300013296 | Bacteria | 1252 |
| 231 | Ga0157378_11165935 | 3300013297 | Bacteria | 809 |
| 232 | Ga0157372_10294126 | 3300013307 | Bacteria | 1888 |
| 233 | Ga0157372_10387889 | 3300013307 | Bacteria | 1627 |
| 234 | Ga0157372_10469415 | 3300013307 | Bacteria | 1467 |
| 235 | Ga0157372_10550021 | 3300013307 | Bacteria | 1345 |
| 236 | Ga0157372_10640106 | 3300013307 | Bacteria | 1238 |
| 237 | Ga0157372_11118273 | 3300013307 | Bacteria | 911 |
| 238 | Ga0157375_10244020 | 3300013308 | Bacteria | 1956 |
| 239 | Ga0157375_10844955 | 3300013308 | Bacteria | 1062 |
| 240 | Ga0163163_10592187 | 3300014325 | Bacteria | 1172 |
| 241 | Ga0157380_10007468 | 3300014326 | Bacteria | 7762 |
| 242 | Ga0182008_10127822 | 3300014497 | Bacteria | 1266 |
| 243 | Ga0157377_10032875 | 3300014745 | Bacteria | 2828 |
| 244 | Ga0157379_10066864 | 3300014968 | Bacteria | 3214 |
| 245 | Ga0207697_10041568 | 3300025315 | Bacteria | 1888 |
| 246 | Ga0207656_10104770 | 3300025321 | Bacteria | 1301 |
| 247 | Ga0207682_10002413 | 3300025893 | Bacteria | 8412 |
| 248 | Ga0207682_10030830 | 3300025893 | Bacteria | 2149 |
| 249 | Ga0207710_10258327 | 3300025900 | Bacteria | 872 |
| 250 | Ga0207688_10023320 | 3300025901 | Bacteria | 3388 |
| 251 | Ga0207688_10037924 | 3300025901 | Bacteria | 2674 |
| 252 | Ga0207680_10159193 | 3300025903 | Bacteria | 1512 |
| 253 | Ga0207647_10000870 | 3300025904 | Bacteria | 23366 |
| 254 | Ga0207647_10028810 | 3300025904 | Bacteria | 3602 |
| 255 | Ga0207647_10039999 | 3300025904 | Bacteria | 2955 |
| 256 | Ga0207647_10072738 | 3300025904 | Bacteria | 2073 |
| 257 | Ga0207645_10001588 | 3300025907 | Bacteria | 18529 |
| 258 | Ga0207645_10019240 | 3300025907 | Bacteria | 4478 |
| 259 | Ga0207645_10039122 | 3300025907 | Bacteria | 3039 |
| 260 | Ga0207643_10488766 | 3300025908 | Bacteria | 786 |
| 261 | Ga0207705_10000169 | 3300025909 | Bacteria | 69941 |
| 262 | Ga0207705_10003070 | 3300025909 | Bacteria | 12729 |
| 263 | Ga0207705_10025962 | 3300025909 | Bacteria | 4180 |
| 264 | Ga0207705_10027747 | 3300025909 | Bacteria | 4038 |
| 265 | Ga0207705_10055255 | 3300025909 | Bacteria | 2862 |
| 266 | Ga0207705_10057598 | 3300025909 | Bacteria | 2803 |
| 267 | Ga0207705_10128814 | 3300025909 | Bacteria | 1882 |
| 268 | Ga0207705_10268918 | 3300025909 | Bacteria | 1303 |
| 269 | Ga0207705_10394267 | 3300025909 | Bacteria | 1070 |
| 270 | Ga0207705_10812569 | 3300025909 | Bacteria | 725 |
| 271 | Ga0207654_10000606 | 3300025911 | Bacteria | 20229 |
| 272 | Ga0207707_10041327 | 3300025912 | Bacteria | 4027 |
| 273 | Ga0207707_10120770 | 3300025912 | Bacteria | 2291 |
| 274 | Ga0207695_10002617 | 3300025913 | Bacteria | 26348 |
| 275 | Ga0207671_10044589 | 3300025914 | Bacteria | 3280 |
| 276 | Ga0207660_10014640 | 3300025917 | Bacteria | 5165 |
| 277 | Ga0207660_10021280 | 3300025917 | Bacteria | 4360 |
| 278 | Ga0207660_10027210 | 3300025917 | Bacteria | 3899 |
| 279 | Ga0207660_10185535 | 3300025917 | Bacteria | 1617 |
| 280 | Ga0207660_10190956 | 3300025917 | Bacteria | 1595 |
| 281 | Ga0207660_10324485 | 3300025917 | Bacteria | 1230 |
| 282 | Ga0207657_10000128 | 3300025919 | Bacteria | 76013 |
| 283 | Ga0207657_10000948 | 3300025919 | Bacteria | 30737 |
| 284 | Ga0207657_10002684 | 3300025919 | Bacteria | 19173 |
| 285 | Ga0207657_10009585 | 3300025919 | Bacteria | 9721 |
| 286 | Ga0207657_10034086 | 3300025919 | Bacteria | 4583 |
| 287 | Ga0207657_10053685 | 3300025919 | Bacteria | 3490 |
| 288 | Ga0207657_10232018 | 3300025919 | Bacteria | 1476 |
| 289 | Ga0207657_10300388 | 3300025919 | Bacteria | 1272 |
| 290 | Ga0207649_10000874 | 3300025920 | Bacteria | 19101 |
| 291 | Ga0207649_10003715 | 3300025920 | Bacteria | 8323 |
| 292 | Ga0207649_10010568 | 3300025920 | Bacteria | 5076 |
| 293 | Ga0207649_10241783 | 3300025920 | Bacteria | 1296 |
| 294 | Ga0207649_10397154 | 3300025920 | Unclassified | 1031 |
| 295 | Ga0207652_10011548 | 3300025921 | Bacteria | 7122 |
| 296 | Ga0207652_10022628 | 3300025921 | Bacteria | 5202 |
| 297 | Ga0207652_10117113 | 3300025921 | Bacteria | 2367 |
| 298 | Ga0207652_10215672 | 3300025921 | Bacteria | 1729 |
| 299 | Ga0207652_10893488 | 3300025921 | Bacteria | 785 |
| 300 | Ga0207681_10012905 | 3300025923 | Bacteria | 5166 |
| 301 | Ga0207681_10015565 | 3300025923 | Bacteria | 4745 |
| 302 | Ga0207681_10222713 | 3300025923 | Bacteria | 1460 |
| 303 | Ga0207694_10061289 | 3300025924 | Bacteria | 2928 |
| 304 | Ga0207694_10245834 | 3300025924 | Bacteria | 1463 |
| 305 | Ga0207650_10043697 | 3300025925 | Bacteria | 3290 |
| 306 | Ga0207650_10063528 | 3300025925 | Bacteria | 2760 |
| 307 | Ga0207650_10103608 | 3300025925 | Bacteria | 2194 |
| 308 | Ga0207650_10106915 | 3300025925 | Bacteria | 2161 |
| 309 | Ga0207659_10044012 | 3300025926 | Bacteria | 3139 |
| 310 | Ga0207700_10284304 | 3300025928 | Bacteria | 1424 |
| 311 | Ga0207664_10055353 | 3300025929 | Bacteria | 3147 |
| 312 | Ga0207664_10528200 | 3300025929 | Bacteria | 1058 |
| 313 | Ga0207644_10034028 | 3300025931 | Bacteria | 3565 |
| 314 | Ga0207644_10045797 | 3300025931 | Bacteria | 3113 |
| 315 | Ga0207644_10248132 | 3300025931 | Bacteria | 1419 |
| 316 | Ga0207690_10027810 | 3300025932 | Bacteria | 3577 |
| 317 | Ga0207690_10054203 | 3300025932 | Bacteria | 2695 |
| 318 | Ga0207690_10084138 | 3300025932 | Bacteria | 2229 |
| 319 | Ga0207690_10158777 | 3300025932 | Bacteria | 1683 |
| 320 | Ga0207706_10004513 | 3300025933 | Bacteria | 13073 |
| 321 | Ga0207706_10014483 | 3300025933 | Bacteria | 7149 |
| 322 | Ga0207706_10057754 | 3300025933 | Bacteria | 3418 |
| 323 | Ga0207706_10078756 | 3300025933 | Bacteria | 2898 |
| 324 | Ga0207706_10392296 | 3300025933 | Bacteria | 1204 |
| 325 | Ga0207706_10658606 | 3300025933 | Bacteria | 896 |
| 326 | Ga0207686_10020399 | 3300025934 | Bacteria | 3786 |
| 327 | Ga0207709_10000188 | 3300025935 | Bacteria | 82582 |
| 328 | Ga0207669_10000185 | 3300025937 | Bacteria | 28588 |
| 329 | Ga0207669_10003885 | 3300025937 | Bacteria | 6520 |
| 330 | Ga0207669_10049240 | 3300025937 | Bacteria | 2510 |
| 331 | Ga0207704_10065698 | 3300025938 | Bacteria | 2273 |
| 332 | Ga0207704_10094069 | 3300025938 | Bacteria | 1978 |
| 333 | Ga0207691_10090793 | 3300025940 | Bacteria | 2738 |
| 334 | Ga0207691_10142461 | 3300025940 | Bacteria | 2111 |
| 335 | Ga0207691_10227254 | 3300025940 | Bacteria | 1617 |
| 336 | Ga0207691_10333358 | 3300025940 | Bacteria | 1300 |
| 337 | Ga0207711_10001624 | 3300025941 | Bacteria | 20742 |
| 338 | Ga0207711_10032914 | 3300025941 | Bacteria | 4384 |
| 339 | Ga0207711_10487104 | 3300025941 | Bacteria | 1149 |
| 340 | Ga0207689_10022619 | 3300025942 | Bacteria | 5282 |
| 341 | Ga0207661_10036009 | 3300025944 | Bacteria | 3860 |
| 342 | Ga0207661_10044750 | 3300025944 | Bacteria | 3500 |
| 343 | Ga0207679_10000286 | 3300025945 | Bacteria | 38353 |
| 344 | Ga0207679_10021911 | 3300025945 | Bacteria | 4341 |
| 345 | Ga0207679_10037440 | 3300025945 | Bacteria | 3448 |
| 346 | Ga0207679_10111785 | 3300025945 | Bacteria | 2158 |
| 347 | Ga0207679_10780592 | 3300025945 | Bacteria | 870 |
| 348 | Ga0207667_10000010 | 3300025949 | Bacteria | 477432 |
| 349 | Ga0207667_10003642 | 3300025949 | Bacteria | 18988 |
| 350 | Ga0207667_10009700 | 3300025949 | Bacteria | 11323 |
| 351 | Ga0207667_10075833 | 3300025949 | Bacteria | 3490 |
| 352 | Ga0207667_10080702 | 3300025949 | Bacteria | 3370 |
| 353 | Ga0207667_10117229 | 3300025949 | Bacteria | 2744 |
| 354 | Ga0207651_10050975 | 3300025960 | Bacteria | 2814 |
| 355 | Ga0207651_10057965 | 3300025960 | Bacteria | 2674 |
| 356 | Ga0207651_10588564 | 3300025960 | Bacteria | 971 |
| 357 | Ga0207712_10231247 | 3300025961 | Bacteria | 1484 |
| 358 | Ga0207668_10000074 | 3300025972 | Bacteria | 75726 |
| 359 | Ga0207668_10149534 | 3300025972 | Bacteria | 1806 |
| 360 | Ga0207668_10207331 | 3300025972 | Bacteria | 1565 |
| 361 | Ga0207640_10002376 | 3300025981 | Bacteria | 10074 |
| 362 | Ga0207640_10106571 | 3300025981 | Unclassified | 1977 |
| 363 | Ga0207640_10258194 | 3300025981 | Bacteria | 1356 |
| 364 | Ga0207658_10014644 | 3300025986 | Bacteria | 5372 |
| 365 | Ga0207658_10146498 | 3300025986 | Bacteria | 1918 |
| 366 | Ga0207658_10313736 | 3300025986 | Bacteria | 1355 |
| 367 | Ga0207677_10240333 | 3300026023 | Bacteria | 1465 |
| 368 | Ga0207677_10368086 | 3300026023 | Bacteria | 1209 |
| 369 | Ga0207677_10911173 | 3300026023 | Bacteria | 793 |
| 370 | Ga0207703_10112867 | 3300026035 | Bacteria | 2322 |
| 371 | Ga0207703_10247089 | 3300026035 | Bacteria | 1606 |
| 372 | Ga0207639_10002715 | 3300026041 | Bacteria | 11869 |
| 373 | Ga0207639_10004552 | 3300026041 | Bacteria | 9338 |
| 374 | Ga0207639_10219000 | 3300026041 | Bacteria | 1643 |
| 375 | Ga0207639_10757382 | 3300026041 | Bacteria | 903 |
| 376 | Ga0207678_10004608 | 3300026067 | Bacteria | 12388 |
| 377 | Ga0207678_10014926 | 3300026067 | Bacteria | 6834 |
| 378 | Ga0207678_10031686 | 3300026067 | Bacteria | 4610 |
| 379 | Ga0207678_10039479 | 3300026067 | Bacteria | 4097 |
| 380 | Ga0207678_10046457 | 3300026067 | Bacteria | 3754 |
| 381 | Ga0207678_10306539 | 3300026067 | Bacteria | 1365 |
| 382 | Ga0207678_10703679 | 3300026067 | Bacteria | 889 |
| 383 | Ga0207702_10003658 | 3300026078 | Bacteria | 13926 |
| 384 | Ga0207702_10036604 | 3300026078 | Bacteria | 4106 |
| 385 | Ga0207702_10074727 | 3300026078 | Unclassified | 2926 |
| 386 | Ga0207702_10125149 | 3300026078 | Bacteria | 2306 |
| 387 | Ga0207702_10193656 | 3300026078 | Bacteria | 1880 |
| 388 | Ga0207702_10229909 | 3300026078 | Bacteria | 1733 |
| 389 | Ga0207641_10020421 | 3300026088 | Bacteria | 5440 |
| 390 | Ga0207641_10108754 | 3300026088 | Bacteria | 2454 |
| 391 | Ga0207641_10142766 | 3300026088 | Bacteria | 2162 |
| 392 | Ga0207641_10430910 | 3300026088 | Bacteria | 1271 |
| 393 | Ga0207648_10029760 | 3300026089 | Bacteria | 4842 |
| 394 | Ga0207648_10131957 | 3300026089 | Bacteria | 2199 |
| 395 | Ga0207676_10054841 | 3300026095 | Bacteria | 3125 |
| 396 | Ga0207676_10114491 | 3300026095 | Bacteria | 2262 |
| 397 | Ga0207676_10164538 | 3300026095 | Bacteria | 1926 |
| 398 | Ga0207676_10594755 | 3300026095 | Bacteria | 1062 |
| 399 | Ga0207674_10001488 | 3300026116 | Bacteria | 30251 |
| 400 | Ga0207674_10003633 | 3300026116 | Bacteria | 18804 |
| 401 | Ga0207674_10013043 | 3300026116 | Bacteria | 9256 |
| 402 | Ga0207674_10023350 | 3300026116 | Bacteria | 6627 |
| 403 | Ga0207674_10027916 | 3300026116 | Bacteria | 5964 |
| 404 | Ga0207674_10081229 | 3300026116 | Bacteria | 3244 |
| 405 | Ga0207674_10173190 | 3300026116 | Bacteria | 2111 |
| 406 | Ga0207674_10955956 | 3300026116 | Bacteria | 825 |
| 407 | Ga0207675_100097639 | 3300026118 | Bacteria | 2766 |
| 408 | Ga0207675_100582498 | 3300026118 | Bacteria | 1120 |
| 409 | Ga0207683_10003535 | 3300026121 | Bacteria | 13628 |
| 410 | Ga0207683_10009767 | 3300026121 | Bacteria | 8180 |
| 411 | Ga0207683_10021536 | 3300026121 | Bacteria | 5521 |
| 412 | Ga0207683_10113052 | 3300026121 | Bacteria | 2432 |
| 413 | Ga0207698_10000647 | 3300026142 | Bacteria | 20147 |
| 414 | Ga0207698_10001368 | 3300026142 | Bacteria | 14189 |
| 415 | Ga0207698_10001981 | 3300026142 | Bacteria | 12049 |
| 416 | Ga0207698_10017848 | 3300026142 | Bacteria | 4823 |
| 417 | Ga0207698_10061580 | 3300026142 | Bacteria | 2925 |
| 418 | Ga0207698_10352694 | 3300026142 | Bacteria | 1390 |
| 419 | Ga0207698_10431288 | 3300026142 | Bacteria | 1267 |
| 420 | Ga0207698_10610233 | 3300026142 | Bacteria | 1077 |
| 421 | Ga0268266_10037925 | 3300028379 | Bacteria | 4103 |
| 422 | Ga0268266_10149400 | 3300028379 | Bacteria | 2104 |
| 423 | Ga0268265_10021590 | 3300028380 | Bacteria | 4513 |
| 424 | Ga0268265_10039594 | 3300028380 | Bacteria | 3475 |
| 425 | Ga0268264_10015490 | 3300028381 | Bacteria | 6250 |
| 426 | Ga0307405_10357725 | 3300031731 | Unclassified | 1128 |
| 427 | Ga0307405_10383106 | 3300031731 | Bacteria | 1095 |
| 428 | Ga0307413_10720858 | 3300031824 | Unclassified | 830 |
| 429 | Ga0307410_10040574 | 3300031852 | Bacteria | 3064 |
| 430 | Ga0307410_10102640 | 3300031852 | Bacteria | 2052 |
| 431 | Ga0307410_10393753 | 3300031852 | Unclassified | 1117 |
| 432 | Ga0307410_10461284 | 3300031852 | Bacteria | 1038 |
| 433 | Ga0307406_10251734 | 3300031901 | Bacteria | 1331 |
| 434 | Ga0307406_10458286 | 3300031901 | Bacteria | 1024 |
| 435 | Ga0307407_10188739 | 3300031903 | Bacteria | 1372 |
| 436 | Ga0307407_10202694 | 3300031903 | Bacteria | 1330 |
| 437 | Ga0307412_10120735 | 3300031911 | Bacteria | 1886 |
| 438 | Ga0307412_10182150 | 3300031911 | Bacteria | 1581 |
| 439 | Ga0307412_10699954 | 3300031911 | Unclassified | 869 |
| 440 | Ga0307412_11008827 | 3300031911 | Bacteria | 736 |
| 441 | Ga0307409_100141735 | 3300031995 | Bacteria | 2072 |
| 442 | Ga0307409_100945421 | 3300031995 | Unclassified | 877 |
| 443 | Ga0307416_100158982 | 3300032002 | Bacteria | 2085 |
| 444 | Ga0307416_100282916 | 3300032002 | Bacteria | 1636 |
| 445 | Ga0307414_10230900 | 3300032004 | Bacteria | 1525 |
| 446 | Ga0307414_10839561 | 3300032004 | Unclassified | 839 |
| 447 | Ga0307411_10029570 | 3300032005 | Bacteria | 3348 |
| 448 | Ga0307411_10126730 | 3300032005 | Bacteria | 1858 |
| 449 | Ga0307411_10165785 | 3300032005 | Bacteria | 1660 |
| 450 | Ga0307411_10386629 | 3300032005 | Bacteria | 1152 |
| 451 | Ga0307411_11170056 | 3300032005 | Bacteria | 696 |
| 452 | Ga0307415_100027261 | 3300032126 | Bacteria | 3617 |
| 453 | Ga0307415_100032440 | 3300032126 | Bacteria | 3377 |
| 454 | Ga0307415_100079553 | 3300032126 | Bacteria | 2335 |
| 455 | Ga0307415_100164933 | 3300032126 | Bacteria | 1721 |
| 456 | Ga0395899_0000514 | 3300037312 | Bacteria | 42939 |
| 457 | Ga0395899_0005372 | 3300037312 | Bacteria | 9947 |
| 458 | Ga0395899_0010033 | 3300037312 | Bacteria | 7260 |
| 459 | Ga0395899_0123410 | 3300037312 | Unclassified | 1854 |
| 460 | Ga0395900_0001018 | 3300037418 | Bacteria | 36138 |
| 461 | Ga0395900_0018394 | 3300037418 | Bacteria | 7125 |
| 462 | Ga0395900_0128422 | 3300037418 | Bacteria | 2598 |
| 463 | Ga0395900_0160265 | 3300037418 | Bacteria | 2295 |
| 464 | Ga0395900_0437293 | 3300037418 | Bacteria | 1266 |
| 465 | Ga0395900_0537866 | 3300037418 | Bacteria | 1114 |
| 466 | Ga0395900_0610404 | 3300037418 | Unclassified | 1030 |
| 467 | Ga0395898_0000021 | 3300037466 | Bacteria | 393971 |
| 468 | Ga0395898_0015950 | 3300037466 | Bacteria | 7698 |
| 469 | Ga0395898_0037082 | 3300037466 | Bacteria | 4837 |
| 470 | Ga0395898_0056425 | 3300037466 | Bacteria | 3828 |
| 471 | Ga0395898_0126966 | 3300037466 | Bacteria | 2443 |
| 472 | Ga0395905_0000006 | 3300037471 | Bacteria | 549428 |
| 473 | Ga0395905_0028578 | 3300037471 | Bacteria | 5256 |
| 474 | Ga0395905_0067276 | 3300037471 | Bacteria | 3355 |
| 475 | Ga0395905_0082716 | 3300037471 | Bacteria | 3008 |
| 476 | Ga0395905_0132523 | 3300037471 | Bacteria | 2344 |
| 477 | Ga0395905_0164671 | 3300037471 | Bacteria | 2083 |
| 478 | Ga0395905_0404359 | 3300037471 | Bacteria | 1260 |
| 479 | Ga0395905_0501176 | 3300037471 | Bacteria | 1114 |
| 480 | Ga0395905_1077793 | 3300037471 | Bacteria | 707 |
| 481 | Ga0395905_1083138 | 3300037471 | Bacteria | 704 |
| 482 | Ga0395901_0000696 | 3300038443 | Bacteria | 38377 |
| 483 | Ga0395901_0004314 | 3300038443 | Bacteria | 14354 |
| 484 | Ga0395901_0007679 | 3300038443 | Bacteria | 10879 |
| 485 | Ga0395901_0039783 | 3300038443 | Bacteria | 4866 |
| 486 | Ga0395901_0136795 | 3300038443 | Bacteria | 2575 |
| 487 | Ga0395901_0165446 | 3300038443 | Bacteria | 2322 |
| 488 | Ga0395901_0644387 | 3300038443 | Bacteria | 1063 |
| 489 | Ga0395901_1055061 | 3300038443 | Bacteria | 785 |
| 490 | Ga0439448_0017830 | 3300042005 | Bacteria | 2171 |
| 491 | Ga0439455_0013618 | 3300042012 | Bacteria | 1845 |
| 492 | Ga0439458_0010029 | 3300042157 | Bacteria | 2110 |
| 493 | Ga0466972_0291955 | 3300044658 | Bacteria | 762 |
| 494 | Ga0466966_0293298 | 3300044684 | Bacteria | 978 |
| 495 | Ga0466963_0040632 | 3300044694 | Bacteria | 3049 |
| 496 | Ga0466963_0620157 | 3300044694 | Unclassified | 764 |
| 497 | Ga0466963_0689365 | 3300044694 | Bacteria | 721 |
| 498 | Ga0466963_0826531 | 3300044694 | Bacteria | 653 |
| 499 | Ga0466957_0514707 | 3300044842 | Bacteria | 831 |
| 500 | Ga0466957_0803918 | 3300044842 | Bacteria | 668 |
| 501 | Ga0466958_0377207 | 3300045836 | Bacteria | 914 |
| 502 | Ga0466967_0088337 | 3300045976 | Bacteria | 2813 |
| 503 | Ga0466967_0212012 | 3300045976 | Bacteria | 1837 |
| 504 | Ga0466967_0239982 | 3300045976 | Bacteria | 1729 |
| 505 | Ga0466967_0335726 | 3300045976 | Bacteria | 1460 |
| 506 | Ga0466967_0505194 | 3300045976 | Bacteria | 1187 |
| 507 | Ga0495584_0042709 | 3300046491 | Bacteria | 2288 |
| 508 | Ga0495584_0246912 | 3300046491 | Bacteria | 907 |
| 509 | Ga0495596_0020199 | 3300046500 | Bacteria | 2728 |
| 510 | Ga0495583_0011689 | 3300046506 | Bacteria | 5027 |
| 511 | Ga0495583_0020161 | 3300046506 | Bacteria | 3462 |
| 512 | Ga0495583_0129837 | 3300046506 | Bacteria | 1055 |
| 513 | Ga0495606_0001113 | 3300046507 | Bacteria | 38409 |
| 514 | Ga0495606_0086499 | 3300046507 | Bacteria | 1937 |
| 515 | Ga0495620_0167027 | 3300046515 | Bacteria | 854 |
| 516 | Ga0495631_0083945 | 3300046518 | Bacteria | 1373 |
| 517 | Ga0495637_0172738 | 3300046520 | Bacteria | 805 |
| 518 | Ga0495643_0002421 | 3300046522 | Bacteria | 14836 |
| 519 | Ga0495643_0052259 | 3300046522 | Bacteria | 2194 |
| 520 | Ga0495663_0003389 | 3300046525 | Bacteria | 4606 |
| 521 | Ga0495663_0223007 | 3300046525 | Bacteria | 663 |
| 522 | Ga0495598_0017135 | 3300046537 | Bacteria | 1863 |
| 523 | Ga0495597_0081536 | 3300046542 | Bacteria | 1383 |
| 524 | Ga0495633_0002185 | 3300046558 | Bacteria | 14022 |
| 525 | Ga0495668_0000163 | 3300046616 | Bacteria | 99607 |
| 526 | Ga0495668_0014585 | 3300046616 | Bacteria | 4602 |
| 527 | Ga0495668_0040080 | 3300046616 | Bacteria | 2613 |
| 528 | Ga0495611_0008523 | 3300046648 | Bacteria | 4335 |
| 529 | Ga0495611_0184834 | 3300046648 | Bacteria | 973 |
| 530 | Ga0495625_0070681 | 3300046660 | Bacteria | 2451 |
| 531 | Ga0495625_0110311 | 3300046660 | Bacteria | 1881 |
| 532 | Ga0495625_0114008 | 3300046660 | Bacteria | 1845 |
| 533 | Ga0495669_0000437 | 3300046684 | Bacteria | 19820 |
| 534 | Ga0495669_0008002 | 3300046684 | Bacteria | 4436 |
| 535 | Ga0495669_0061422 | 3300046684 | Bacteria | 1700 |
| 536 | Ga0495670_0170399 | 3300046691 | Bacteria | 1146 |
| 537 | Ga0495670_0555184 | 3300046691 | Bacteria | 625 |
| 538 | Ga0495649_0025567 | 3300046694 | Bacteria | 3289 |
| 539 | Ga0495660_0031632 | 3300046810 | Bacteria | 2975 |
| 540 | Ga0495660_0046350 | 3300046810 | Bacteria | 2384 |
| 541 | Ga0495636_0324824 | 3300047318 | Bacteria | 723 |
| 542 | Ga0495683_0006658 | 3300047323 | Bacteria | 6297 |
| 543 | Ga0495687_000447 | 3300047443 | Bacteria | 50911 |
| 544 | Ga0495677_0005358 | 3300047445 | Bacteria | 4867 |
| 545 | Ga0495677_0346047 | 3300047445 | Bacteria | 586 |
| 546 | Ga0495681_0017561 | 3300047470 | Bacteria | 3968 |
| 547 | Ga0496101_0671723 | 3300048904 | Bacteria | 818 |
| 548 | Ga0496102_0000828 | 3300048905 | Bacteria | 29896 |
| 549 | Ga0496102_0172834 | 3300048905 | Bacteria | 2034 |
| 550 | Ga0496103_0000636 | 3300048906 | Bacteria | 26810 |
| 551 | Ga0496103_0309792 | 3300048906 | Bacteria | 1016 |
| 552 | Ga0496104_0009187 | 3300048907 | Bacteria | 8790 |
| 553 | Ga0496104_0375787 | 3300048907 | Bacteria | 1334 |
| 554 | Ga0496105_0006991 | 3300048908 | Bacteria | 8693 |
| 555 | Ga0496106_0137100 | 3300048909 | Bacteria | 1923 |
| 556 | Ga0496108_0010521 | 3300048911 | Bacteria | 7515 |
| 557 | Ga0496108_0027908 | 3300048911 | Bacteria | 4667 |
| 558 | Ga0496109_0019198 | 3300048912 | Bacteria | 6021 |
| 559 | Ga0496109_0046023 | 3300048912 | Bacteria | 3961 |
| 560 | Ga0496109_1290452 | 3300048912 | Bacteria | 666 |
| 561 | Ga0496110_0122741 | 3300048913 | Bacteria | 2341 |
| 562 | Ga0496110_0178827 | 3300048913 | Bacteria | 1926 |
| 563 | Ga0496110_0319951 | 3300048913 | Bacteria | 1413 |
| 564 | Ga0496110_0998829 | 3300048913 | Bacteria | 744 |
| 565 | Ga0496111_0005767 | 3300048914 | Bacteria | 7991 |
| 566 | Ga0496111_0438581 | 3300048914 | Bacteria | 964 |
| 567 | Ga0496112_0727475 | 3300048915 | Bacteria | 919 |
| 568 | Ga0496113_0308602 | 3300048916 | Bacteria | 1267 |
| 569 | Ga0496114_0000021 | 3300048917 | Bacteria | 227038 |
| 570 | Ga0496114_0020403 | 3300048917 | Bacteria | 5379 |
| 571 | Ga0496115_0000624 | 3300048918 | Bacteria | 26823 |
| 572 | Ga0496115_0001985 | 3300048918 | Bacteria | 14608 |
| 573 | Ga0496116_0003361 | 3300048919 | Bacteria | 15887 |
| 574 | Ga0496117_0001766 | 3300048920 | Bacteria | 29764 |
| 575 | Ga0496118_0001902 | 3300048921 | Bacteria | 29748 |
| 576 | Ga0496119_0003460 | 3300048922 | Bacteria | 16379 |
| 577 | Ga0496120_0023070 | 3300048923 | Bacteria | 3900 |
| 578 | Ga0496121_0002786 | 3300048924 | Bacteria | 25928 |
| 579 | Ga0496124_0001562 | 3300048927 | Bacteria | 33102 |
| 580 | Ga0496126_0001925 | 3300048929 | Bacteria | 29687 |
| 581 | nmdc:mga00v17_117133_c1 | 3300050491 | Bacteria | 1694 |
| 582 | nmdc:mga06r32_986063_c1 | 3300050510 | Bacteria | 796 |
| 583 | nmdc:mga0rr50_294928_c1 | 3300050513 | Bacteria | 1355 |
| 584 | nmdc:mga0a205_6082_c1 | 3300050515 | Bacteria | 10886 |
| 585 | Ga0500610_0000114 | 3300053079 | Bacteria | 24378 |
| 586 | Ga0500642_0028960 | 3300053130 | Bacteria | 2290 |
| 587 | Ga0500645_000170 | 3300053730 | Bacteria | 51134 |
| 588 | Ga0590071_004629 | 3300059421 | Bacteria | 3329 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300012512 | Ga0157327_1036871 | Ga0157327_10368711 | 168 |
| 2 | 3300001915 | JGI24741J21665_1028926 | JGI24741J21665_10289262 | 169 |
| 3 | 3300001979 | JGI24740J21852_10018730 | JGI24740J21852_100187302 | 169 |
| 4 | 3300001989 | JGI24739J22299_10004359 | JGI24739J22299_100043595 | 169 |
| 5 | 3300001990 | JGI24737J22298_10068017 | JGI24737J22298_100680172 | 169 |
| 6 | 3300002067 | JGI24735J21928_10040136 | JGI24735J21928_100401362 | 169 |
| 7 | 3300002067 | JGI24735J21928_10051821 | JGI24735J21928_100518212 | 169 |
| 8 | 3300002075 | JGI24738J21930_10007357 | JGI24738J21930_100073574 | 169 |
| 9 | 3300002075 | JGI24738J21930_10032763 | JGI24738J21930_100327632 | 169 |
| 10 | 3300002244 | JGI24742J22300_10010005 | JGI24742J22300_100100052 | 169 |
| 11 | 3300005262 | Ga0065165_1045447 | Ga0065165_10454472 | 169 |
| 12 | 3300005293 | Ga0065715_10220665 | Ga0065715_102206652 | 169 |
| 13 | 3300005327 | Ga0070658_10018933 | Ga0070658_100189335 | 169 |
| 14 | 3300005327 | Ga0070658_10088163 | Ga0070658_100881633 | 169 |
| 15 | 3300005327 | Ga0070658_10112268 | Ga0070658_101122682 | 169 |
| 16 | 3300005328 | Ga0070676_10016308 | Ga0070676_100163081 | 169 |
| 17 | 3300005328 | Ga0070676_10408872 | Ga0070676_104088721 | 169 |
| 18 | 3300005328 | Ga0070676_10645265 | Ga0070676_106452651 | 169 |
| 19 | 3300005329 | Ga0070683_100005295 | Ga0070683_1000052956 | 169 |
| 20 | 3300005329 | Ga0070683_100011024 | Ga0070683_1000110244 | 169 |
| 21 | 3300005329 | Ga0070683_100035063 | Ga0070683_1000350633 | 169 |
| 22 | 3300005331 | Ga0070670_100010847 | Ga0070670_1000108474 | 169 |
| 23 | 3300005331 | Ga0070670_100025540 | Ga0070670_1000255403 | 169 |
| 24 | 3300005331 | Ga0070670_100079017 | Ga0070670_1000790175 | 169 |
| 25 | 3300005331 | Ga0070670_100322804 | Ga0070670_1003228042 | 169 |
| 26 | 3300005333 | Ga0070677_10000997 | Ga0070677_100009976 | 169 |
| 27 | 3300005333 | Ga0070677_10029415 | Ga0070677_100294152 | 169 |
| 28 | 3300005334 | Ga0068869_100494127 | Ga0068869_1004941272 | 169 |
| 29 | 3300005335 | Ga0070666_10011770 | Ga0070666_100117704 | 169 |
| 30 | 3300005335 | Ga0070666_10114242 | Ga0070666_101142421 | 169 |
| 31 | 3300005336 | Ga0070680_100000834 | Ga0070680_10000083411 | 169 |
| 32 | 3300005336 | Ga0070680_100022301 | Ga0070680_1000223013 | 169 |
| 33 | 3300005336 | Ga0070680_100131475 | Ga0070680_1001314753 | 169 |
| 34 | 3300005336 | Ga0070680_100207836 | Ga0070680_1002078363 | 169 |
| 35 | 3300005336 | Ga0070680_100247758 | Ga0070680_1002477581 | 169 |
| 36 | 3300005336 | Ga0070680_100742509 | Ga0070680_1007425092 | 169 |
| 37 | 3300005338 | Ga0068868_100046121 | Ga0068868_1000461212 | 169 |
| 38 | 3300005338 | Ga0068868_100175176 | Ga0068868_1001751762 | 169 |
| 39 | 3300005339 | Ga0070660_100015476 | Ga0070660_1000154764 | 169 |
| 40 | 3300005339 | Ga0070660_100032087 | Ga0070660_1000320873 | 169 |
| 41 | 3300005339 | Ga0070660_100039524 | Ga0070660_1000395244 | 169 |
| 42 | 3300005339 | Ga0070660_100053691 | Ga0070660_1000536912 | 169 |
| 43 | 3300005339 | Ga0070660_100226815 | Ga0070660_1002268152 | 169 |
| 44 | 3300005339 | Ga0070660_100279879 | Ga0070660_1002798792 | 169 |
| 45 | 3300005339 | Ga0070660_100306173 | Ga0070660_1003061733 | 169 |
| 46 | 3300005341 | Ga0070691_10001109 | Ga0070691_100011096 | 169 |
| 47 | 3300005344 | Ga0070661_100011683 | Ga0070661_1000116834 | 169 |
| 48 | 3300005344 | Ga0070661_100014547 | Ga0070661_1000145472 | 169 |
| 49 | 3300005344 | Ga0070661_100047096 | Ga0070661_1000470964 | 169 |
| 50 | 3300005344 | Ga0070661_100161052 | Ga0070661_1001610522 | 169 |
| 51 | 3300005344 | Ga0070661_100218714 | Ga0070661_1002187142 | 169 |
| 52 | 3300005344 | Ga0070661_100301206 | Ga0070661_1003012062 | 169 |
| 53 | 3300005345 | Ga0070692_10028373 | Ga0070692_100283732 | 169 |
| 54 | 3300005345 | Ga0070692_10153035 | Ga0070692_101530352 | 169 |
| 55 | 3300005345 | Ga0070692_10329499 | Ga0070692_103294992 | 169 |
| 56 | 3300005347 | Ga0070668_100001813 | Ga0070668_1000018137 | 169 |
| 57 | 3300005347 | Ga0070668_100035677 | Ga0070668_1000356774 | 169 |
| 58 | 3300005347 | Ga0070668_100277327 | Ga0070668_1002773272 | 169 |
| 59 | 3300005353 | Ga0070669_100102673 | Ga0070669_1001026733 | 169 |
| 60 | 3300005353 | Ga0070669_100123241 | Ga0070669_1001232412 | 169 |
| 61 | 3300005353 | Ga0070669_100454093 | Ga0070669_1004540932 | 169 |
| 62 | 3300005354 | Ga0070675_100000637 | Ga0070675_10000063719 | 169 |
| 63 | 3300005355 | Ga0070671_100002819 | Ga0070671_1000028192 | 169 |
| 64 | 3300005356 | Ga0070674_100005968 | Ga0070674_1000059687 | 169 |
| 65 | 3300005356 | Ga0070674_100023740 | Ga0070674_1000237402 | 169 |
| 66 | 3300005356 | Ga0070674_100138906 | Ga0070674_1001389062 | 169 |
| 67 | 3300005356 | Ga0070674_100288284 | Ga0070674_1002882842 | 169 |
| 68 | 3300005364 | Ga0070673_100049443 | Ga0070673_1000494432 | 169 |
| 69 | 3300005364 | Ga0070673_100121521 | Ga0070673_1001215213 | 169 |
| 70 | 3300005364 | Ga0070673_100726059 | Ga0070673_1007260592 | 169 |
| 71 | 3300005366 | Ga0070659_100003111 | Ga0070659_1000031114 | 169 |
| 72 | 3300005366 | Ga0070659_100017538 | Ga0070659_1000175382 | 169 |
| 73 | 3300005366 | Ga0070659_100029313 | Ga0070659_1000293133 | 169 |
| 74 | 3300005366 | Ga0070659_100042779 | Ga0070659_1000427792 | 169 |
| 75 | 3300005366 | Ga0070659_100070971 | Ga0070659_1000709712 | 169 |
| 76 | 3300005366 | Ga0070659_100171871 | Ga0070659_1001718712 | 169 |
| 77 | 3300005366 | Ga0070659_100869509 | Ga0070659_1008695091 | 169 |
| 78 | 3300005367 | Ga0070667_100006814 | Ga0070667_1000068148 | 169 |
| 79 | 3300005367 | Ga0070667_100023784 | Ga0070667_1000237846 | 169 |
| 80 | 3300005367 | Ga0070667_100249253 | Ga0070667_1002492532 | 169 |
| 81 | 3300005435 | Ga0070714_100030925 | Ga0070714_1000309254 | 169 |
| 82 | 3300005444 | Ga0070694_100208093 | Ga0070694_1002080933 | 169 |
| 83 | 3300005455 | Ga0070663_100071647 | Ga0070663_1000716473 | 169 |
| 84 | 3300005455 | Ga0070663_100108066 | Ga0070663_1001080664 | 169 |
| 85 | 3300005455 | Ga0070663_100247134 | Ga0070663_1002471343 | 169 |
| 86 | 3300005455 | Ga0070663_100485479 | Ga0070663_1004854792 | 169 |
| 87 | 3300005456 | Ga0070678_100001260 | Ga0070678_10000126011 | 169 |
| 88 | 3300005456 | Ga0070678_100032705 | Ga0070678_1000327052 | 169 |
| 89 | 3300005456 | Ga0070678_100153082 | Ga0070678_1001530822 | 169 |
| 90 | 3300005457 | Ga0070662_100020005 | Ga0070662_1000200054 | 169 |
| 91 | 3300005457 | Ga0070662_100031091 | Ga0070662_1000310913 | 169 |
| 92 | 3300005457 | Ga0070662_100806300 | Ga0070662_1008063001 | 169 |
| 93 | 3300005458 | Ga0070681_10022750 | Ga0070681_100227506 | 169 |
| 94 | 3300005458 | Ga0070681_10065216 | Ga0070681_100652162 | 169 |
| 95 | 3300005459 | Ga0068867_100004445 | Ga0068867_1000044455 | 169 |
| 96 | 3300005459 | Ga0068867_100102582 | Ga0068867_1001025824 | 169 |
| 97 | 3300005466 | Ga0070685_10391420 | Ga0070685_103914201 | 169 |
| 98 | 3300005530 | Ga0070679_100089757 | Ga0070679_1000897573 | 169 |
| 99 | 3300005530 | Ga0070679_100101762 | Ga0070679_1001017623 | 169 |
| 100 | 3300005530 | Ga0070679_100701867 | Ga0070679_1007018671 | 169 |
| 101 | 3300005530 | Ga0070679_100795660 | Ga0070679_1007956602 | 169 |
| 102 | 3300005535 | Ga0070684_100069704 | Ga0070684_1000697042 | 169 |
| 103 | 3300005535 | Ga0070684_100332872 | Ga0070684_1003328723 | 169 |
| 104 | 3300005539 | Ga0068853_100026812 | Ga0068853_1000268126 | 169 |
| 105 | 3300005539 | Ga0068853_100066591 | Ga0068853_1000665913 | 169 |
| 106 | 3300005539 | Ga0068853_100373461 | Ga0068853_1003734612 | 169 |
| 107 | 3300005543 | Ga0070672_100073961 | Ga0070672_1000739613 | 169 |
| 108 | 3300005543 | Ga0070672_100097523 | Ga0070672_1000975232 | 169 |
| 109 | 3300005543 | Ga0070672_100147708 | Ga0070672_1001477082 | 169 |
| 110 | 3300005543 | Ga0070672_100373523 | Ga0070672_1003735232 | 169 |
| 111 | 3300005545 | Ga0070695_100641718 | Ga0070695_1006417182 | 169 |
| 112 | 3300005546 | Ga0070696_101007390 | Ga0070696_1010073901 | 169 |
| 113 | 3300005547 | Ga0070693_100195393 | Ga0070693_1001953933 | 169 |
| 114 | 3300005548 | Ga0070665_100116436 | Ga0070665_1001164362 | 169 |
| 115 | 3300005563 | Ga0068855_100006737 | Ga0068855_1000067373 | 169 |
| 116 | 3300005563 | Ga0068855_100052252 | Ga0068855_1000522523 | 169 |
| 117 | 3300005563 | Ga0068855_100128146 | Ga0068855_1001281462 | 169 |
| 118 | 3300005563 | Ga0068855_100207989 | Ga0068855_1002079892 | 169 |
| 119 | 3300005563 | Ga0068855_100448893 | Ga0068855_1004488933 | 169 |
| 120 | 3300005563 | Ga0068855_100672022 | Ga0068855_1006720222 | 169 |
| 121 | 3300005563 | Ga0068855_101054834 | Ga0068855_1010548342 | 169 |
| 122 | 3300005564 | Ga0070664_100000207 | Ga0070664_10000020735 | 169 |
| 123 | 3300005564 | Ga0070664_100018669 | Ga0070664_1000186695 | 169 |
| 124 | 3300005564 | Ga0070664_100042636 | Ga0070664_1000426363 | 169 |
| 125 | 3300005564 | Ga0070664_100054798 | Ga0070664_1000547984 | 169 |
| 126 | 3300005564 | Ga0070664_100056725 | Ga0070664_1000567253 | 169 |
| 127 | 3300005564 | Ga0070664_100063862 | Ga0070664_1000638622 | 169 |
| 128 | 3300005564 | Ga0070664_100383643 | Ga0070664_1003836433 | 169 |
| 129 | 3300005577 | Ga0068857_100024467 | Ga0068857_1000244677 | 169 |
| 130 | 3300005577 | Ga0068857_100051464 | Ga0068857_1000514645 | 169 |
| 131 | 3300005577 | Ga0068857_100183121 | Ga0068857_1001831212 | 169 |
| 132 | 3300005577 | Ga0068857_100350540 | Ga0068857_1003505402 | 169 |
| 133 | 3300005577 | Ga0068857_100368516 | Ga0068857_1003685163 | 169 |
| 134 | 3300005577 | Ga0068857_101250398 | Ga0068857_1012503982 | 169 |
| 135 | 3300005578 | Ga0068854_100001469 | Ga0068854_1000014699 | 169 |
| 136 | 3300005578 | Ga0068854_100104612 | Ga0068854_1001046122 | 169 |
| 137 | 3300005614 | Ga0068856_100002757 | Ga0068856_10000275712 | 169 |
| 138 | 3300005614 | Ga0068856_100043027 | Ga0068856_1000430272 | 169 |
| 139 | 3300005614 | Ga0068856_100047272 | Ga0068856_1000472724 | 169 |
| 140 | 3300005614 | Ga0068856_100268078 | Ga0068856_1002680782 | 169 |
| 141 | 3300005616 | Ga0068852_100003532 | Ga0068852_1000035328 | 169 |
| 142 | 3300005616 | Ga0068852_100115790 | Ga0068852_1001157902 | 169 |
| 143 | 3300005616 | Ga0068852_100159300 | Ga0068852_1001593002 | 169 |
| 144 | 3300005616 | Ga0068852_100236326 | Ga0068852_1002363263 | 169 |
| 145 | 3300005616 | Ga0068852_100256822 | Ga0068852_1002568222 | 169 |
| 146 | 3300005616 | Ga0068852_100355751 | Ga0068852_1003557512 | 169 |
| 147 | 3300005617 | Ga0068859_100115387 | Ga0068859_1001153872 | 169 |
| 148 | 3300005617 | Ga0068859_100270674 | Ga0068859_1002706744 | 169 |
| 149 | 3300005617 | Ga0068859_100701158 | Ga0068859_1007011581 | 169 |
| 150 | 3300005618 | Ga0068864_100007304 | Ga0068864_1000073049 | 169 |
| 151 | 3300005618 | Ga0068864_100166433 | Ga0068864_1001664332 | 169 |
| 152 | 3300005618 | Ga0068864_100521929 | Ga0068864_1005219291 | 169 |
| 153 | 3300005618 | Ga0068864_100809918 | Ga0068864_1008099182 | 169 |
| 154 | 3300005618 | Ga0068864_101003272 | Ga0068864_1010032722 | 169 |
| 155 | 3300005719 | Ga0068861_100245577 | Ga0068861_1002455772 | 169 |
| 156 | 3300005834 | Ga0068851_10018818 | Ga0068851_100188185 | 169 |
| 157 | 3300005834 | Ga0068851_10040393 | Ga0068851_100403933 | 169 |
| 158 | 3300005841 | Ga0068863_100043886 | Ga0068863_1000438866 | 169 |
| 159 | 3300005841 | Ga0068863_100134878 | Ga0068863_1001348784 | 169 |
| 160 | 3300005841 | Ga0068863_100147312 | Ga0068863_1001473123 | 169 |
| 161 | 3300005841 | Ga0068863_100629474 | Ga0068863_1006294742 | 169 |
| 162 | 3300005842 | Ga0068858_100018773 | Ga0068858_1000187733 | 169 |
| 163 | 3300005842 | Ga0068858_100305712 | Ga0068858_1003057124 | 169 |
| 164 | 3300005843 | Ga0068860_100009940 | Ga0068860_1000099409 | 169 |
| 165 | 3300005843 | Ga0068860_100721240 | Ga0068860_1007212401 | 169 |
| 166 | 3300005844 | Ga0068862_100031315 | Ga0068862_1000313157 | 169 |
| 167 | 3300005844 | Ga0068862_100038220 | Ga0068862_1000382202 | 169 |
| 168 | 3300005844 | Ga0068862_100239079 | Ga0068862_1002390792 | 169 |
| 169 | 3300006177 | Ga0075362_10043562 | Ga0075362_100435623 | 169 |
| 170 | 3300006237 | Ga0097621_100032254 | Ga0097621_1000322544 | 169 |
| 171 | 3300006358 | Ga0068871_100097389 | Ga0068871_1000973893 | 169 |
| 172 | 3300006844 | Ga0075428_100233026 | Ga0075428_1002330262 | 169 |
| 173 | 3300006847 | Ga0075431_100833483 | Ga0075431_1008334832 | 169 |
| 174 | 3300006852 | Ga0075433_10011495 | Ga0075433_100114957 | 169 |
| 175 | 3300006871 | Ga0075434_100624084 | Ga0075434_1006240841 | 169 |
| 176 | 3300006881 | Ga0068865_100090684 | Ga0068865_1000906843 | 169 |
| 177 | 3300006881 | Ga0068865_100188905 | Ga0068865_1001889052 | 169 |
| 178 | 3300006881 | Ga0068865_100217270 | Ga0068865_1002172702 | 169 |
| 179 | 3300006881 | Ga0068865_100378595 | Ga0068865_1003785953 | 169 |
| 180 | 3300006931 | Ga0097620_100115385 | Ga0097620_1001153852 | 169 |
| 181 | 3300006931 | Ga0097620_100270684 | Ga0097620_1002706844 | 169 |
| 182 | 3300006931 | Ga0097620_100701166 | Ga0097620_1007011661 | 169 |
| 183 | 3300007076 | Ga0075435_100220745 | Ga0075435_1002207452 | 169 |
| 184 | 3300009093 | Ga0105240_11403729 | Ga0105240_114037291 | 169 |
| 185 | 3300009098 | Ga0105245_10948433 | Ga0105245_109484332 | 169 |
| 186 | 3300009101 | Ga0105247_10133470 | Ga0105247_101334702 | 169 |
| 187 | 3300009101 | Ga0105247_10164050 | Ga0105247_101640502 | 169 |
| 188 | 3300009148 | Ga0105243_10000251 | Ga0105243_100002518 | 169 |
| 189 | 3300009148 | Ga0105243_10131287 | Ga0105243_101312873 | 169 |
| 190 | 3300009174 | Ga0105241_10004809 | Ga0105241_100048092 | 169 |
| 191 | 3300009174 | Ga0105241_10826672 | Ga0105241_108266722 | 169 |
| 192 | 3300009174 | Ga0105241_10864804 | Ga0105241_108648042 | 169 |
| 193 | 3300009176 | Ga0105242_10371000 | Ga0105242_103710002 | 169 |
| 194 | 3300009176 | Ga0105242_10762226 | Ga0105242_107622262 | 169 |
| 195 | 3300009177 | Ga0105248_10009598 | Ga0105248_100095987 | 169 |
| 196 | 3300009177 | Ga0105248_10026178 | Ga0105248_100261787 | 169 |
| 197 | 3300009551 | Ga0105238_10229405 | Ga0105238_102294052 | 169 |
| 198 | 3300009553 | Ga0105249_10502974 | Ga0105249_105029743 | 169 |
| 199 | 3300010375 | Ga0105239_10290300 | Ga0105239_102903002 | 169 |
| 200 | 3300010375 | Ga0105239_11391203 | Ga0105239_113912032 | 169 |
| 201 | 3300011119 | Ga0105246_10033781 | Ga0105246_100337815 | 169 |
| 202 | 3300011119 | Ga0105246_10081041 | Ga0105246_100810414 | 169 |
| 203 | 3300011119 | Ga0105246_10303148 | Ga0105246_103031481 | 169 |
| 204 | 3300013100 | Ga0157373_10007014 | Ga0157373_100070149 | 169 |
| 205 | 3300013100 | Ga0157373_10019837 | Ga0157373_100198375 | 169 |
| 206 | 3300013100 | Ga0157373_10029482 | Ga0157373_100294823 | 169 |
| 207 | 3300013100 | Ga0157373_10113962 | Ga0157373_101139622 | 169 |
| 208 | 3300013100 | Ga0157373_10138425 | Ga0157373_101384252 | 169 |
| 209 | 3300013100 | Ga0157373_10206230 | Ga0157373_102062302 | 169 |
| 210 | 3300013100 | Ga0157373_10371188 | Ga0157373_103711882 | 169 |
| 211 | 3300013100 | Ga0157373_10908481 | Ga0157373_109084811 | 169 |
| 212 | 3300013102 | Ga0157371_10000097 | Ga0157371_1000009732 | 169 |
| 213 | 3300013102 | Ga0157371_10000672 | Ga0157371_1000067242 | 169 |
| 214 | 3300013102 | Ga0157371_10007261 | Ga0157371_100072617 | 169 |
| 215 | 3300013102 | Ga0157371_10139008 | Ga0157371_101390083 | 169 |
| 216 | 3300013102 | Ga0157371_10154532 | Ga0157371_101545322 | 169 |
| 217 | 3300013102 | Ga0157371_10288889 | Ga0157371_102888892 | 169 |
| 218 | 3300013102 | Ga0157371_10690415 | Ga0157371_106904152 | 169 |
| 219 | 3300013104 | Ga0157370_10083604 | Ga0157370_100836042 | 169 |
| 220 | 3300013104 | Ga0157370_10105484 | Ga0157370_101054843 | 169 |
| 221 | 3300013104 | Ga0157370_10111263 | Ga0157370_101112634 | 169 |
| 222 | 3300013104 | Ga0157370_10162936 | Ga0157370_101629362 | 169 |
| 223 | 3300013104 | Ga0157370_10226088 | Ga0157370_102260882 | 169 |
| 224 | 3300013105 | Ga0157369_10015160 | Ga0157369_100151606 | 169 |
| 225 | 3300013105 | Ga0157369_10074758 | Ga0157369_100747582 | 169 |
| 226 | 3300013105 | Ga0157369_10181774 | Ga0157369_101817743 | 169 |
| 227 | 3300013105 | Ga0157369_10189669 | Ga0157369_101896693 | 169 |
| 228 | 3300013105 | Ga0157369_10764383 | Ga0157369_107643832 | 169 |
| 229 | 3300013296 | Ga0157374_10056966 | Ga0157374_100569663 | 169 |
| 230 | 3300013296 | Ga0157374_10475619 | Ga0157374_104756192 | 169 |
| 231 | 3300013297 | Ga0157378_11165935 | Ga0157378_111659352 | 169 |
| 232 | 3300013307 | Ga0157372_10294126 | Ga0157372_102941262 | 169 |
| 233 | 3300013307 | Ga0157372_10387889 | Ga0157372_103878892 | 169 |
| 234 | 3300013307 | Ga0157372_10469415 | Ga0157372_104694152 | 169 |
| 235 | 3300013307 | Ga0157372_10550021 | Ga0157372_105500213 | 169 |
| 236 | 3300013307 | Ga0157372_10640106 | Ga0157372_106401063 | 169 |
| 237 | 3300013307 | Ga0157372_11118273 | Ga0157372_111182731 | 169 |
| 238 | 3300013308 | Ga0157375_10244020 | Ga0157375_102440202 | 169 |
| 239 | 3300013308 | Ga0157375_10844955 | Ga0157375_108449552 | 169 |
| 240 | 3300014325 | Ga0163163_10592187 | Ga0163163_105921871 | 169 |
| 241 | 3300014326 | Ga0157380_10007468 | Ga0157380_100074686 | 169 |
| 242 | 3300014497 | Ga0182008_10127822 | Ga0182008_101278222 | 169 |
| 243 | 3300014745 | Ga0157377_10032875 | Ga0157377_100328752 | 169 |
| 244 | 3300014968 | Ga0157379_10066864 | Ga0157379_100668643 | 169 |
| 245 | 3300025315 | Ga0207697_10041568 | Ga0207697_100415682 | 169 |
| 246 | 3300025321 | Ga0207656_10104770 | Ga0207656_101047701 | 169 |
| 247 | 3300025893 | Ga0207682_10002413 | Ga0207682_100024136 | 169 |
| 248 | 3300025893 | Ga0207682_10030830 | Ga0207682_100308302 | 169 |
| 249 | 3300025900 | Ga0207710_10258327 | Ga0207710_102583272 | 169 |
| 250 | 3300025901 | Ga0207688_10023320 | Ga0207688_100233203 | 169 |
| 251 | 3300025901 | Ga0207688_10037924 | Ga0207688_100379242 | 169 |
| 252 | 3300025903 | Ga0207680_10159193 | Ga0207680_101591932 | 169 |
| 253 | 3300025904 | Ga0207647_10000870 | Ga0207647_100008707 | 169 |
| 254 | 3300025904 | Ga0207647_10028810 | Ga0207647_100288105 | 169 |
| 255 | 3300025904 | Ga0207647_10039999 | Ga0207647_100399994 | 169 |
| 256 | 3300025904 | Ga0207647_10072738 | Ga0207647_100727383 | 169 |
| 257 | 3300025907 | Ga0207645_10001588 | Ga0207645_100015887 | 169 |
| 258 | 3300025907 | Ga0207645_10019240 | Ga0207645_100192402 | 169 |
| 259 | 3300025907 | Ga0207645_10039122 | Ga0207645_100391222 | 169 |
| 260 | 3300025908 | Ga0207643_10488766 | Ga0207643_104887662 | 169 |
| 261 | 3300025909 | Ga0207705_10000169 | Ga0207705_100001697 | 169 |
| 262 | 3300025909 | Ga0207705_10003070 | Ga0207705_100030705 | 169 |
| 263 | 3300025909 | Ga0207705_10025962 | Ga0207705_100259623 | 169 |
| 264 | 3300025909 | Ga0207705_10027747 | Ga0207705_100277474 | 169 |
| 265 | 3300025909 | Ga0207705_10055255 | Ga0207705_100552552 | 169 |
| 266 | 3300025909 | Ga0207705_10057598 | Ga0207705_100575984 | 169 |
| 267 | 3300025909 | Ga0207705_10128814 | Ga0207705_101288142 | 169 |
| 268 | 3300025909 | Ga0207705_10268918 | Ga0207705_102689182 | 169 |
| 269 | 3300025909 | Ga0207705_10394267 | Ga0207705_103942672 | 169 |
| 270 | 3300025909 | Ga0207705_10812569 | Ga0207705_108125692 | 169 |
| 271 | 3300025911 | Ga0207654_10000606 | Ga0207654_1000060613 | 169 |
| 272 | 3300025912 | Ga0207707_10041327 | Ga0207707_100413274 | 169 |
| 273 | 3300025912 | Ga0207707_10120770 | Ga0207707_101207704 | 169 |
| 274 | 3300025913 | Ga0207695_10002617 | Ga0207695_1000261718 | 169 |
| 275 | 3300025914 | Ga0207671_10044589 | Ga0207671_100445892 | 169 |
| 276 | 3300025917 | Ga0207660_10014640 | Ga0207660_100146402 | 169 |
| 277 | 3300025917 | Ga0207660_10021280 | Ga0207660_100212804 | 169 |
| 278 | 3300025917 | Ga0207660_10027210 | Ga0207660_100272103 | 169 |
| 279 | 3300025917 | Ga0207660_10185535 | Ga0207660_101855352 | 169 |
| 280 | 3300025917 | Ga0207660_10190956 | Ga0207660_101909562 | 169 |
| 281 | 3300025917 | Ga0207660_10324485 | Ga0207660_103244852 | 169 |
| 282 | 3300025919 | Ga0207657_10000128 | Ga0207657_1000012838 | 169 |
| 283 | 3300025919 | Ga0207657_10000948 | Ga0207657_1000094818 | 169 |
| 284 | 3300025919 | Ga0207657_10002684 | Ga0207657_100026844 | 169 |
| 285 | 3300025919 | Ga0207657_10009585 | Ga0207657_100095854 | 169 |
| 286 | 3300025919 | Ga0207657_10034086 | Ga0207657_100340867 | 169 |
| 287 | 3300025919 | Ga0207657_10053685 | Ga0207657_100536852 | 169 |
| 288 | 3300025919 | Ga0207657_10232018 | Ga0207657_102320182 | 169 |
| 289 | 3300025919 | Ga0207657_10300388 | Ga0207657_103003882 | 169 |
| 290 | 3300025920 | Ga0207649_10000874 | Ga0207649_1000087416 | 169 |
| 291 | 3300025920 | Ga0207649_10003715 | Ga0207649_100037159 | 169 |
| 292 | 3300025920 | Ga0207649_10010568 | Ga0207649_100105684 | 169 |
| 293 | 3300025920 | Ga0207649_10241783 | Ga0207649_102417832 | 169 |
| 294 | 3300025920 | Ga0207649_10397154 | Ga0207649_103971542 | 169 |
| 295 | 3300025921 | Ga0207652_10011548 | Ga0207652_100115482 | 169 |
| 296 | 3300025921 | Ga0207652_10022628 | Ga0207652_100226284 | 169 |
| 297 | 3300025921 | Ga0207652_10117113 | Ga0207652_101171133 | 169 |
| 298 | 3300025921 | Ga0207652_10215672 | Ga0207652_102156722 | 169 |
| 299 | 3300025921 | Ga0207652_10893488 | Ga0207652_108934881 | 169 |
| 300 | 3300025923 | Ga0207681_10012905 | Ga0207681_100129053 | 169 |
| 301 | 3300025923 | Ga0207681_10015565 | Ga0207681_100155653 | 169 |
| 302 | 3300025923 | Ga0207681_10222713 | Ga0207681_102227132 | 169 |
| 303 | 3300025924 | Ga0207694_10061289 | Ga0207694_100612892 | 169 |
| 304 | 3300025924 | Ga0207694_10245834 | Ga0207694_102458342 | 169 |
| 305 | 3300025925 | Ga0207650_10043697 | Ga0207650_100436974 | 169 |
| 306 | 3300025925 | Ga0207650_10063528 | Ga0207650_100635285 | 169 |
| 307 | 3300025925 | Ga0207650_10103608 | Ga0207650_101036082 | 169 |
| 308 | 3300025925 | Ga0207650_10106915 | Ga0207650_101069152 | 169 |
| 309 | 3300025926 | Ga0207659_10044012 | Ga0207659_100440123 | 169 |
| 310 | 3300025928 | Ga0207700_10284304 | Ga0207700_102843043 | 169 |
| 311 | 3300025929 | Ga0207664_10055353 | Ga0207664_100553532 | 169 |
| 312 | 3300025929 | Ga0207664_10528200 | Ga0207664_105282002 | 169 |
| 313 | 3300025931 | Ga0207644_10034028 | Ga0207644_100340282 | 169 |
| 314 | 3300025931 | Ga0207644_10045797 | Ga0207644_100457973 | 169 |
| 315 | 3300025931 | Ga0207644_10248132 | Ga0207644_102481322 | 169 |
| 316 | 3300025932 | Ga0207690_10027810 | Ga0207690_100278104 | 169 |
| 317 | 3300025932 | Ga0207690_10054203 | Ga0207690_100542032 | 169 |
| 318 | 3300025932 | Ga0207690_10084138 | Ga0207690_100841383 | 169 |
| 319 | 3300025932 | Ga0207690_10158777 | Ga0207690_101587771 | 169 |
| 320 | 3300025933 | Ga0207706_10004513 | Ga0207706_100045132 | 169 |
| 321 | 3300025933 | Ga0207706_10014483 | Ga0207706_100144833 | 169 |
| 322 | 3300025933 | Ga0207706_10057754 | Ga0207706_100577545 | 169 |
| 323 | 3300025933 | Ga0207706_10078756 | Ga0207706_100787563 | 169 |
| 324 | 3300025933 | Ga0207706_10392296 | Ga0207706_103922963 | 169 |
| 325 | 3300025933 | Ga0207706_10658606 | Ga0207706_106586061 | 169 |
| 326 | 3300025934 | Ga0207686_10020399 | Ga0207686_100203992 | 169 |
| 327 | 3300025935 | Ga0207709_10000188 | Ga0207709_1000018822 | 169 |
| 328 | 3300025937 | Ga0207669_10000185 | Ga0207669_1000018523 | 169 |
| 329 | 3300025937 | Ga0207669_10003885 | Ga0207669_100038857 | 169 |
| 330 | 3300025937 | Ga0207669_10049240 | Ga0207669_100492404 | 169 |
| 331 | 3300025938 | Ga0207704_10065698 | Ga0207704_100656982 | 169 |
| 332 | 3300025938 | Ga0207704_10094069 | Ga0207704_100940693 | 169 |
| 333 | 3300025940 | Ga0207691_10090793 | Ga0207691_100907933 | 169 |
| 334 | 3300025940 | Ga0207691_10142461 | Ga0207691_101424612 | 169 |
| 335 | 3300025940 | Ga0207691_10227254 | Ga0207691_102272542 | 169 |
| 336 | 3300025940 | Ga0207691_10333358 | Ga0207691_103333582 | 169 |
| 337 | 3300025941 | Ga0207711_10001624 | Ga0207711_1000162415 | 169 |
| 338 | 3300025941 | Ga0207711_10032914 | Ga0207711_100329144 | 169 |
| 339 | 3300025941 | Ga0207711_10487104 | Ga0207711_104871041 | 169 |
| 340 | 3300025942 | Ga0207689_10022619 | Ga0207689_100226197 | 169 |
| 341 | 3300025944 | Ga0207661_10036009 | Ga0207661_100360094 | 169 |
| 342 | 3300025944 | Ga0207661_10044750 | Ga0207661_100447503 | 169 |
| 343 | 3300025945 | Ga0207679_10000286 | Ga0207679_1000028635 | 169 |
| 344 | 3300025945 | Ga0207679_10021911 | Ga0207679_100219114 | 169 |
| 345 | 3300025945 | Ga0207679_10037440 | Ga0207679_100374404 | 169 |
| 346 | 3300025945 | Ga0207679_10111785 | Ga0207679_101117852 | 169 |
| 347 | 3300025945 | Ga0207679_10780592 | Ga0207679_107805921 | 169 |
| 348 | 3300025949 | Ga0207667_10000010 | Ga0207667_10000010279 | 169 |
| 349 | 3300025949 | Ga0207667_10003642 | Ga0207667_1000364217 | 169 |
| 350 | 3300025949 | Ga0207667_10009700 | Ga0207667_100097008 | 169 |
| 351 | 3300025949 | Ga0207667_10075833 | Ga0207667_100758332 | 169 |
| 352 | 3300025949 | Ga0207667_10080702 | Ga0207667_100807023 | 169 |
| 353 | 3300025949 | Ga0207667_10117229 | Ga0207667_101172292 | 169 |
| 354 | 3300025960 | Ga0207651_10050975 | Ga0207651_100509755 | 169 |
| 355 | 3300025960 | Ga0207651_10057965 | Ga0207651_100579653 | 169 |
| 356 | 3300025960 | Ga0207651_10588564 | Ga0207651_105885642 | 169 |
| 357 | 3300025961 | Ga0207712_10231247 | Ga0207712_102312473 | 169 |
| 358 | 3300025972 | Ga0207668_10000074 | Ga0207668_1000007459 | 169 |
| 359 | 3300025972 | Ga0207668_10149534 | Ga0207668_101495342 | 169 |
| 360 | 3300025972 | Ga0207668_10207331 | Ga0207668_102073312 | 169 |
| 361 | 3300025981 | Ga0207640_10002376 | Ga0207640_100023768 | 169 |
| 362 | 3300025981 | Ga0207640_10106571 | Ga0207640_101065713 | 169 |
| 363 | 3300025981 | Ga0207640_10258194 | Ga0207640_102581942 | 169 |
| 364 | 3300025986 | Ga0207658_10014644 | Ga0207658_100146447 | 169 |
| 365 | 3300025986 | Ga0207658_10146498 | Ga0207658_101464983 | 169 |
| 366 | 3300025986 | Ga0207658_10313736 | Ga0207658_103137361 | 169 |
| 367 | 3300026023 | Ga0207677_10240333 | Ga0207677_102403332 | 169 |
| 368 | 3300026023 | Ga0207677_10368086 | Ga0207677_103680862 | 169 |
| 369 | 3300026023 | Ga0207677_10911173 | Ga0207677_109111732 | 169 |
| 370 | 3300026035 | Ga0207703_10112867 | Ga0207703_101128672 | 169 |
| 371 | 3300026035 | Ga0207703_10247089 | Ga0207703_102470894 | 169 |
| 372 | 3300026041 | Ga0207639_10002715 | Ga0207639_100027155 | 169 |
| 373 | 3300026041 | Ga0207639_10004552 | Ga0207639_100045522 | 169 |
| 374 | 3300026041 | Ga0207639_10219000 | Ga0207639_102190002 | 169 |
| 375 | 3300026041 | Ga0207639_10757382 | Ga0207639_107573822 | 169 |
| 376 | 3300026067 | Ga0207678_10004608 | Ga0207678_100046083 | 169 |
| 377 | 3300026067 | Ga0207678_10014926 | Ga0207678_100149263 | 169 |
| 378 | 3300026067 | Ga0207678_10031686 | Ga0207678_100316866 | 169 |
| 379 | 3300026067 | Ga0207678_10039479 | Ga0207678_100394794 | 169 |
| 380 | 3300026067 | Ga0207678_10046457 | Ga0207678_100464574 | 169 |
| 381 | 3300026067 | Ga0207678_10306539 | Ga0207678_103065392 | 169 |
| 382 | 3300026067 | Ga0207678_10703679 | Ga0207678_107036792 | 169 |
| 383 | 3300026078 | Ga0207702_10003658 | Ga0207702_100036585 | 169 |
| 384 | 3300026078 | Ga0207702_10036604 | Ga0207702_100366043 | 169 |
| 385 | 3300026078 | Ga0207702_10074727 | Ga0207702_100747272 | 169 |
| 386 | 3300026078 | Ga0207702_10125149 | Ga0207702_101251494 | 169 |
| 387 | 3300026078 | Ga0207702_10193656 | Ga0207702_101936562 | 169 |
| 388 | 3300026078 | Ga0207702_10229909 | Ga0207702_102299092 | 169 |
| 389 | 3300026088 | Ga0207641_10020421 | Ga0207641_100204216 | 169 |
| 390 | 3300026088 | Ga0207641_10108754 | Ga0207641_101087543 | 169 |
| 391 | 3300026088 | Ga0207641_10142766 | Ga0207641_101427662 | 169 |
| 392 | 3300026088 | Ga0207641_10430910 | Ga0207641_104309102 | 169 |
| 393 | 3300026089 | Ga0207648_10029760 | Ga0207648_100297605 | 169 |
| 394 | 3300026089 | Ga0207648_10131957 | Ga0207648_101319575 | 169 |
| 395 | 3300026095 | Ga0207676_10054841 | Ga0207676_100548413 | 169 |
| 396 | 3300026095 | Ga0207676_10114491 | Ga0207676_101144912 | 169 |
| 397 | 3300026095 | Ga0207676_10164538 | Ga0207676_101645382 | 169 |
| 398 | 3300026095 | Ga0207676_10594755 | Ga0207676_105947552 | 169 |
| 399 | 3300026116 | Ga0207674_10001488 | Ga0207674_1000148818 | 169 |
| 400 | 3300026116 | Ga0207674_10003633 | Ga0207674_1000363318 | 169 |
| 401 | 3300026116 | Ga0207674_10013043 | Ga0207674_100130438 | 169 |
| 402 | 3300026116 | Ga0207674_10023350 | Ga0207674_100233506 | 169 |
| 403 | 3300026116 | Ga0207674_10027916 | Ga0207674_100279168 | 169 |
| 404 | 3300026116 | Ga0207674_10081229 | Ga0207674_100812292 | 169 |
| 405 | 3300026116 | Ga0207674_10173190 | Ga0207674_101731903 | 169 |
| 406 | 3300026116 | Ga0207674_10955956 | Ga0207674_109559562 | 169 |
| 407 | 3300026118 | Ga0207675_100097639 | Ga0207675_1000976396 | 169 |
| 408 | 3300026118 | Ga0207675_100582498 | Ga0207675_1005824982 | 169 |
| 409 | 3300026121 | Ga0207683_10003535 | Ga0207683_100035354 | 169 |
| 410 | 3300026121 | Ga0207683_10009767 | Ga0207683_100097679 | 169 |
| 411 | 3300026121 | Ga0207683_10021536 | Ga0207683_100215362 | 169 |
| 412 | 3300026121 | Ga0207683_10113052 | Ga0207683_101130522 | 169 |
| 413 | 3300026142 | Ga0207698_10000647 | Ga0207698_100006478 | 169 |
| 414 | 3300026142 | Ga0207698_10001368 | Ga0207698_100013689 | 169 |
| 415 | 3300026142 | Ga0207698_10001981 | Ga0207698_100019812 | 169 |
| 416 | 3300026142 | Ga0207698_10017848 | Ga0207698_100178484 | 169 |
| 417 | 3300026142 | Ga0207698_10061580 | Ga0207698_100615805 | 169 |
| 418 | 3300026142 | Ga0207698_10352694 | Ga0207698_103526943 | 169 |
| 419 | 3300026142 | Ga0207698_10431288 | Ga0207698_104312882 | 169 |
| 420 | 3300026142 | Ga0207698_10610233 | Ga0207698_106102332 | 169 |
| 421 | 3300028379 | Ga0268266_10037925 | Ga0268266_100379252 | 169 |
| 422 | 3300028379 | Ga0268266_10149400 | Ga0268266_101494002 | 169 |
| 423 | 3300028380 | Ga0268265_10021590 | Ga0268265_100215902 | 169 |
| 424 | 3300028380 | Ga0268265_10039594 | Ga0268265_100395944 | 169 |
| 425 | 3300028381 | Ga0268264_10015490 | Ga0268264_100154903 | 169 |
| 426 | 3300031731 | Ga0307405_10357725 | Ga0307405_103577252 | 169 |
| 427 | 3300031731 | Ga0307405_10383106 | Ga0307405_103831062 | 169 |
| 428 | 3300031824 | Ga0307413_10720858 | Ga0307413_107208582 | 169 |
| 429 | 3300031852 | Ga0307410_10040574 | Ga0307410_100405743 | 169 |
| 430 | 3300031852 | Ga0307410_10102640 | Ga0307410_101026404 | 169 |
| 431 | 3300031852 | Ga0307410_10393753 | Ga0307410_103937532 | 169 |
| 432 | 3300031852 | Ga0307410_10461284 | Ga0307410_104612842 | 169 |
| 433 | 3300031901 | Ga0307406_10251734 | Ga0307406_102517342 | 169 |
| 434 | 3300031901 | Ga0307406_10458286 | Ga0307406_104582862 | 169 |
| 435 | 3300031903 | Ga0307407_10188739 | Ga0307407_101887391 | 169 |
| 436 | 3300031903 | Ga0307407_10202694 | Ga0307407_102026942 | 169 |
| 437 | 3300031911 | Ga0307412_10120735 | Ga0307412_101207352 | 169 |
| 438 | 3300031911 | Ga0307412_10182150 | Ga0307412_101821502 | 169 |
| 439 | 3300031911 | Ga0307412_10699954 | Ga0307412_106999542 | 169 |
| 440 | 3300031911 | Ga0307412_11008827 | Ga0307412_110088271 | 169 |
| 441 | 3300031995 | Ga0307409_100141735 | Ga0307409_1001417352 | 169 |
| 442 | 3300031995 | Ga0307409_100945421 | Ga0307409_1009454212 | 169 |
| 443 | 3300032002 | Ga0307416_100158982 | Ga0307416_1001589823 | 169 |
| 444 | 3300032002 | Ga0307416_100282916 | Ga0307416_1002829163 | 169 |
| 445 | 3300032004 | Ga0307414_10230900 | Ga0307414_102309002 | 169 |
| 446 | 3300032004 | Ga0307414_10839561 | Ga0307414_108395612 | 169 |
| 447 | 3300032005 | Ga0307411_10029570 | Ga0307411_100295703 | 169 |
| 448 | 3300032005 | Ga0307411_10126730 | Ga0307411_101267302 | 169 |
| 449 | 3300032005 | Ga0307411_10165785 | Ga0307411_101657853 | 169 |
| 450 | 3300032005 | Ga0307411_10386629 | Ga0307411_103866292 | 169 |
| 451 | 3300032005 | Ga0307411_11170056 | Ga0307411_111700562 | 169 |
| 452 | 3300032126 | Ga0307415_100027261 | Ga0307415_1000272613 | 169 |
| 453 | 3300032126 | Ga0307415_100032440 | Ga0307415_1000324402 | 169 |
| 454 | 3300032126 | Ga0307415_100079553 | Ga0307415_1000795532 | 169 |
| 455 | 3300032126 | Ga0307415_100164933 | Ga0307415_1001649333 | 169 |
| 456 | 3300037312 | Ga0395899_0000514 | Ga0395899_0000514_2032_2592 | 169 |
| 457 | 3300037312 | Ga0395899_0005372 | Ga0395899_0005372_3207_3749 | 169 |
| 458 | 3300037312 | Ga0395899_0010033 | Ga0395899_0010033_6025_6534 | 169 |
| 459 | 3300037312 | Ga0395899_0123410 | Ga0395899_0123410_1283_1843 | 169 |
| 460 | 3300037418 | Ga0395900_0001018 | Ga0395900_0001018_7365_7925 | 169 |
| 461 | 3300037418 | Ga0395900_0018394 | Ga0395900_0018394_6184_6693 | 169 |
| 462 | 3300037418 | Ga0395900_0128422 | Ga0395900_0128422_1877_2419 | 169 |
| 463 | 3300037418 | Ga0395900_0160265 | Ga0395900_0160265_320_880 | 169 |
| 464 | 3300037418 | Ga0395900_0437293 | Ga0395900_0437293_348_857 | 169 |
| 465 | 3300037418 | Ga0395900_0537866 | Ga0395900_0537866_119_679 | 169 |
| 466 | 3300037418 | Ga0395900_0610404 | Ga0395900_0610404_190_699 | 169 |
| 467 | 3300037466 | Ga0395898_0000021 | Ga0395898_0000021_62675_63235 | 169 |
| 468 | 3300037466 | Ga0395898_0015950 | Ga0395898_0015950_4848_5390 | 169 |
| 469 | 3300037466 | Ga0395898_0037082 | Ga0395898_0037082_1706_2266 | 169 |
| 470 | 3300037466 | Ga0395898_0056425 | Ga0395898_0056425_2833_3342 | 169 |
| 471 | 3300037466 | Ga0395898_0126966 | Ga0395898_0126966_1780_2289 | 169 |
| 472 | 3300037471 | Ga0395905_0000006 | Ga0395905_0000006_278927_279487 | 169 |
| 473 | 3300037471 | Ga0395905_0028578 | Ga0395905_0028578_36_596 | 169 |
| 474 | 3300037471 | Ga0395905_0067276 | Ga0395905_0067276_178_738 | 169 |
| 475 | 3300037471 | Ga0395905_0082716 | Ga0395905_0082716_2367_2876 | 169 |
| 476 | 3300037471 | Ga0395905_0132523 | Ga0395905_0132523_1056_1565 | 169 |
| 477 | 3300037471 | Ga0395905_0164671 | Ga0395905_0164671_1302_1862 | 169 |
| 478 | 3300037471 | Ga0395905_0404359 | Ga0395905_0404359_448_981 | 169 |
| 479 | 3300037471 | Ga0395905_0501176 | Ga0395905_0501176_446_1006 | 169 |
| 480 | 3300037471 | Ga0395905_1077793 | Ga0395905_1077793_130_690 | 169 |
| 481 | 3300037471 | Ga0395905_1083138 | Ga0395905_1083138_120_629 | 169 |
| 482 | 3300038443 | Ga0395901_0000696 | Ga0395901_0000696_31445_32005 | 169 |
| 483 | 3300038443 | Ga0395901_0004314 | Ga0395901_0004314_11445_11954 | 169 |
| 484 | 3300038443 | Ga0395901_0007679 | Ga0395901_0007679_7971_8480 | 169 |
| 485 | 3300038443 | Ga0395901_0039783 | Ga0395901_0039783_3646_4188 | 169 |
| 486 | 3300038443 | Ga0395901_0136795 | Ga0395901_0136795_124_657 | 169 |
| 487 | 3300038443 | Ga0395901_0165446 | Ga0395901_0165446_240_800 | 169 |
| 488 | 3300038443 | Ga0395901_0644387 | Ga0395901_0644387_176_736 | 169 |
| 489 | 3300038443 | Ga0395901_1055061 | Ga0395901_1055061_24_584 | 169 |
| 490 | 3300042005 | Ga0439448_0017830 | Ga0439448_0017830_114_674 | 169 |
| 491 | 3300042012 | Ga0439455_0013618 | Ga0439455_0013618_1206_1766 | 169 |
| 492 | 3300042157 | Ga0439458_0010029 | Ga0439458_0010029_110_670 | 169 |
| 493 | 3300044658 | Ga0466972_0291955 | Ga0466972_0291955_11_571 | 169 |
| 494 | 3300044684 | Ga0466966_0293298 | Ga0466966_0293298_10_519 | 169 |
| 495 | 3300044694 | Ga0466963_0040632 | Ga0466963_0040632_1829_2389 | 169 |
| 496 | 3300044694 | Ga0466963_0620157 | Ga0466963_0620157_53_625 | 169 |
| 497 | 3300044694 | Ga0466963_0689365 | Ga0466963_0689365_172_681 | 169 |
| 498 | 3300044694 | Ga0466963_0826531 | Ga0466963_0826531_98_607 | 169 |
| 499 | 3300044842 | Ga0466957_0514707 | Ga0466957_0514707_51_611 | 169 |
| 500 | 3300044842 | Ga0466957_0803918 | Ga0466957_0803918_23_583 | 169 |
| 501 | 3300045836 | Ga0466958_0377207 | Ga0466958_0377207_194_754 | 169 |
| 502 | 3300045976 | Ga0466967_0088337 | Ga0466967_0088337_2289_2798 | 169 |
| 503 | 3300045976 | Ga0466967_0212012 | Ga0466967_0212012_843_1352 | 169 |
| 504 | 3300045976 | Ga0466967_0239982 | Ga0466967_0239982_1039_1548 | 169 |
| 505 | 3300045976 | Ga0466967_0335726 | Ga0466967_0335726_239_799 | 169 |
| 506 | 3300045976 | Ga0466967_0505194 | Ga0466967_0505194_330_890 | 169 |
| 507 | 3300046491 | Ga0495584_0042709 | Ga0495584_0042709_1187_1741 | 169 |
| 508 | 3300046491 | Ga0495584_0246912 | Ga0495584_0246912_236_790 | 169 |
| 509 | 3300046500 | Ga0495596_0020199 | Ga0495596_0020199_998_1552 | 169 |
| 510 | 3300046506 | Ga0495583_0011689 | Ga0495583_0011689_53_607 | 169 |
| 511 | 3300046506 | Ga0495583_0020161 | Ga0495583_0020161_1340_1894 | 169 |
| 512 | 3300046506 | Ga0495583_0129837 | Ga0495583_0129837_54_608 | 169 |
| 513 | 3300046507 | Ga0495606_0001113 | Ga0495606_0001113_9513_10067 | 169 |
| 514 | 3300046507 | Ga0495606_0086499 | Ga0495606_0086499_682_1236 | 169 |
| 515 | 3300046515 | Ga0495620_0167027 | Ga0495620_0167027_42_596 | 169 |
| 516 | 3300046518 | Ga0495631_0083945 | Ga0495631_0083945_324_878 | 169 |
| 517 | 3300046520 | Ga0495637_0172738 | Ga0495637_0172738_40_594 | 169 |
| 518 | 3300046522 | Ga0495643_0002421 | Ga0495643_0002421_12984_13538 | 169 |
| 519 | 3300046522 | Ga0495643_0052259 | Ga0495643_0052259_37_591 | 169 |
| 520 | 3300046525 | Ga0495663_0003389 | Ga0495663_0003389_2709_3263 | 169 |
| 521 | 3300046525 | Ga0495663_0223007 | Ga0495663_0223007_43_603 | 169 |
| 522 | 3300046537 | Ga0495598_0017135 | Ga0495598_0017135_336_896 | 169 |
| 523 | 3300046542 | Ga0495597_0081536 | Ga0495597_0081536_709_1263 | 169 |
| 524 | 3300046558 | Ga0495633_0002185 | Ga0495633_0002185_5548_6102 | 169 |
| 525 | 3300046616 | Ga0495668_0000163 | Ga0495668_0000163_14472_15026 | 169 |
| 526 | 3300046616 | Ga0495668_0014585 | Ga0495668_0014585_1837_2397 | 169 |
| 527 | 3300046616 | Ga0495668_0040080 | Ga0495668_0040080_152_712 | 169 |
| 528 | 3300046648 | Ga0495611_0008523 | Ga0495611_0008523_2086_2640 | 169 |
| 529 | 3300046648 | Ga0495611_0184834 | Ga0495611_0184834_42_596 | 169 |
| 530 | 3300046660 | Ga0495625_0070681 | Ga0495625_0070681_52_606 | 169 |
| 531 | 3300046660 | Ga0495625_0110311 | Ga0495625_0110311_90_644 | 169 |
| 532 | 3300046660 | Ga0495625_0114008 | Ga0495625_0114008_19_573 | 169 |
| 533 | 3300046684 | Ga0495669_0000437 | Ga0495669_0000437_3615_4169 | 169 |
| 534 | 3300046684 | Ga0495669_0008002 | Ga0495669_0008002_3407_3967 | 169 |
| 535 | 3300046684 | Ga0495669_0061422 | Ga0495669_0061422_19_579 | 169 |
| 536 | 3300046691 | Ga0495670_0170399 | Ga0495670_0170399_498_1058 | 169 |
| 537 | 3300046691 | Ga0495670_0555184 | Ga0495670_0555184_22_576 | 169 |
| 538 | 3300046694 | Ga0495649_0025567 | Ga0495649_0025567_2263_2817 | 169 |
| 539 | 3300046810 | Ga0495660_0031632 | Ga0495660_0031632_630_1184 | 169 |
| 540 | 3300046810 | Ga0495660_0046350 | Ga0495660_0046350_1628_2182 | 169 |
| 541 | 3300047318 | Ga0495636_0324824 | Ga0495636_0324824_24_578 | 169 |
| 542 | 3300047323 | Ga0495683_0006658 | Ga0495683_0006658_4929_5483 | 169 |
| 543 | 3300047443 | Ga0495687_000447 | Ga0495687_000447_19720_20274 | 169 |
| 544 | 3300047445 | Ga0495677_0005358 | Ga0495677_0005358_2629_3183 | 169 |
| 545 | 3300047445 | Ga0495677_0346047 | Ga0495677_0346047_20_574 | 169 |
| 546 | 3300047470 | Ga0495681_0017561 | Ga0495681_0017561_2379_2933 | 169 |
| 547 | 3300048904 | Ga0496101_0671723 | Ga0496101_0671723_188_697 | 169 |
| 548 | 3300048905 | Ga0496102_0000828 | Ga0496102_0000828_10657_11211 | 169 |
| 549 | 3300048905 | Ga0496102_0172834 | Ga0496102_0172834_454_1014 | 169 |
| 550 | 3300048906 | Ga0496103_0000636 | Ga0496103_0000636_15454_16008 | 169 |
| 551 | 3300048906 | Ga0496103_0309792 | Ga0496103_0309792_407_916 | 169 |
| 552 | 3300048907 | Ga0496104_0009187 | Ga0496104_0009187_6555_7109 | 169 |
| 553 | 3300048907 | Ga0496104_0375787 | Ga0496104_0375787_179_739 | 169 |
| 554 | 3300048908 | Ga0496105_0006991 | Ga0496105_0006991_2491_3045 | 169 |
| 555 | 3300048909 | Ga0496106_0137100 | Ga0496106_0137100_136_696 | 169 |
| 556 | 3300048911 | Ga0496108_0010521 | Ga0496108_0010521_62_622 | 169 |
| 557 | 3300048911 | Ga0496108_0027908 | Ga0496108_0027908_1707_2267 | 169 |
| 558 | 3300048912 | Ga0496109_0019198 | Ga0496109_0019198_4409_4969 | 169 |
| 559 | 3300048912 | Ga0496109_0046023 | Ga0496109_0046023_1847_2407 | 169 |
| 560 | 3300048912 | Ga0496109_1290452 | Ga0496109_1290452_24_533 | 169 |
| 561 | 3300048913 | Ga0496110_0122741 | Ga0496110_0122741_1188_1742 | 169 |
| 562 | 3300048913 | Ga0496110_0178827 | Ga0496110_0178827_1356_1916 | 169 |
| 563 | 3300048913 | Ga0496110_0319951 | Ga0496110_0319951_580_1140 | 169 |
| 564 | 3300048913 | Ga0496110_0998829 | Ga0496110_0998829_147_707 | 169 |
| 565 | 3300048914 | Ga0496111_0005767 | Ga0496111_0005767_2889_3449 | 169 |
| 566 | 3300048914 | Ga0496111_0438581 | Ga0496111_0438581_99_659 | 169 |
| 567 | 3300048915 | Ga0496112_0727475 | Ga0496112_0727475_122_682 | 169 |
| 568 | 3300048916 | Ga0496113_0308602 | Ga0496113_0308602_245_805 | 169 |
| 569 | 3300048917 | Ga0496114_0000021 | Ga0496114_0000021_204162_204722 | 169 |
| 570 | 3300048917 | Ga0496114_0020403 | Ga0496114_0020403_4604_5158 | 169 |
| 571 | 3300048918 | Ga0496115_0000624 | Ga0496115_0000624_10648_11202 | 169 |
| 572 | 3300048918 | Ga0496115_0001985 | Ga0496115_0001985_1086_1595 | 169 |
| 573 | 3300048919 | Ga0496116_0003361 | Ga0496116_0003361_2321_2875 | 169 |
| 574 | 3300048920 | Ga0496117_0001766 | Ga0496117_0001766_13669_14223 | 169 |
| 575 | 3300048921 | Ga0496118_0001902 | Ga0496118_0001902_15551_16105 | 169 |
| 576 | 3300048922 | Ga0496119_0003460 | Ga0496119_0003460_2602_3156 | 169 |
| 577 | 3300048923 | Ga0496120_0023070 | Ga0496120_0023070_2530_3084 | 169 |
| 578 | 3300048924 | Ga0496121_0002786 | Ga0496121_0002786_10576_11130 | 169 |
| 579 | 3300048927 | Ga0496124_0001562 | Ga0496124_0001562_13648_14202 | 169 |
| 580 | 3300048929 | Ga0496126_0001925 | Ga0496126_0001925_13633_14187 | 169 |
| 581 | 3300050491 | nmdc:mga00v17_117133_c1 | nmdc:mga00v17_117133_c1_514_1074 | 169 |
| 582 | 3300050510 | nmdc:mga06r32_986063_c1 | nmdc:mga06r32_986063_c1_142_702 | 169 |
| 583 | 3300050513 | nmdc:mga0rr50_294928_c1 | nmdc:mga0rr50_294928_c1_122_682 | 169 |
| 584 | 3300050515 | nmdc:mga0a205_6082_c1 | nmdc:mga0a205_6082_c1_7536_8096 | 169 |
| 585 | 3300053079 | Ga0500610_0000114 | Ga0500610_0000114_12666_13220 | 169 |
| 586 | 3300053130 | Ga0500642_0028960 | Ga0500642_0028960_391_945 | 169 |
| 587 | 3300053730 | Ga0500645_000170 | Ga0500645_000170_35926_36480 | 169 |
| 588 | 3300059421 | Ga0590071_004629 | Ga0590071_004629_2113_2673 | 169 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3av3-assembly1.cif.gz_A | crystal structure of glycinamide ribonucleotide transformylase 1 from geobacillus kaustophilus | 0.8902 | 2 | 165 |
| 3p9x-assembly1.cif.gz_B | crystal structure of phosphoribosylglycinamide formyltransferase from bacillus halodurans | 0.8899 | 2 | 167 |
| 3tqr-assembly1.cif.gz_A | structure of the phosphoribosylglycinamide formyltransferase (purn) in complex with ches from coxiella burnetii | 0.8892 | 2 | 164 |
| 1meo-assembly1.cif.gz_A | human glycinamide ribonucleotide transformylase at ph 4.2 | 0.8839 | 1 | 166 |
| 1men-assembly1.cif.gz_A | complex structure of human gar tfase and substrate beta-gar | 0.8811 | 2 | 166 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3av3A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.8853 | 2 | 164 | 3.40.50.170 |
| 4ds3A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.8772 | 1 | 166 | 3.40.50.170 |
| af_Q20143_783_975_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.875 | 1 | 166 | 3.40.50.170 |
| af_Q2FZI7_1_188_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.8723 | 12 | 167 | 3.40.50.170 |
| 3aufA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.8657 | 2 | 164 | 3.40.50.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M8F696-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9063 | 2 | 167 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A7X0JAL5-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9045 | 1 | 169 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A520HTS9-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9019 | 1 | 167 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A154NC61-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9016 | 1 | 169 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A7X0JAL5-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.8995 | 1 | 169 |
GO:0004644
GO:0005829 GO:0006189 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar