F466752

General Info

Members Datasets Scaffolds Average Seq Length
588 304 1176 278

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100001926|Ga0068864_1000019262
Length 307
Sequence VKALRLRRRAVKTAEATGSPEVVARRAFVTPEGVDLRLQVGAYTDRALALLLDALIIVGCLVALTILAGVAAWASKSPAPVRAITIIWLLGSFVLRVGYFIGFELHARGATPGKRAMGLRVIARDGRRLTADAIFARNAMRELEVFLPATFLLARGYGVDGALISLGAIWTGVLAIFPLFNRDRLRLGDLAAGTMVVKAPKIRLLRDIAESAPQIVGDLAFTDAQLDAYGIKELQVLEQVLRTGDRRSMAAVAQRIRGKIDWRGPDDLADRSFLNAYYAALRGRLETGLLFGRARRDKHDVAPQAKT

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
181 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
184 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
185 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
186 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
187 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
190 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
191 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
192 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
193 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
194 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
202 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
210 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
218 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
219 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
221 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
224 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
236 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
237 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
249 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
254 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
265 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
266 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
267 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
268 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
269 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
270 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
271 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
272 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
273 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
274 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
275 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
276 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
277 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
278 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
279 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
280 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
281 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
282 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
285 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
286 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
287 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
288 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
289 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
290 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
291 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
292 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
293 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
294 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
295 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
296 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
297 2643221583 Caulobacter sp. Root655 Isolate Unclassified
298 2643221584 Caulobacter sp. Root656 Isolate Unclassified
299 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
300 2818991435 Caulobacter henricii 536 Isolate Unclassified
301 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
302 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
303 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
304 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.94
Metatranscriptomes 0.68
Isolates 2.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.39
Nodule 0
Rhizoplane 1.02
Rhizosphere 80.78
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100001926 3300005618 Bacteria 17044
2 SwRhRL2b_contig_2353265 2162886007 Bacteria 3437
3 JGI24739J22299_10004390 3300001989 Bacteria 5400
4 JGI24739J22299_10022776 3300001989 Bacteria 2220
5 JGI24739J22299_10060859 3300001989 Bacteria 1194
6 JGI24737J22298_10001315 3300001990 Bacteria 8806
7 JGI24737J22298_10003134 3300001990 Bacteria 5870
8 JGI24737J22298_10030440 3300001990 Bacteria 1689
9 JGI24743J22301_10033448 3300001991 Bacteria 1018
10 JGI24735J21928_10004071 3300002067 Bacteria 4937
11 JGI24735J21928_10004239 3300002067 Bacteria 4837
12 JGI24735J21928_10012361 3300002067 Bacteria 2699
13 JGI24738J21930_10001372 3300002075 Bacteria 6758
14 JGI24744J21845_10000256 3300002077 Bacteria 8647
15 rootL2_10198081 3300003322 Bacteria 4001
16 Ga0055542_1016692 3300003762 Bacteria 1150
17 Ga0055526_1001076 3300003771 Bacteria 19956
18 Ga0055537_1002835 3300003773 Bacteria 5565
19 Ga0055537_1007899 3300003773 Bacteria 2510
20 Ga0055524_1003448 3300003775 Bacteria 7668
21 Ga0055528_1003643 3300003790 Bacteria 7650
22 Ga0055531_10008415 3300003794 Bacteria 5443
23 Ga0065165_1001453 3300005262 Bacteria 25633
24 Ga0070658_10000037 3300005327 Bacteria 141493
25 Ga0070658_10000116 3300005327 Bacteria 71744
26 Ga0070658_10011202 3300005327 Bacteria 7187
27 Ga0070658_10015397 3300005327 Bacteria 6120
28 Ga0070658_10049332 3300005327 Bacteria 3410
29 Ga0070658_10065782 3300005327 Bacteria 2960
30 Ga0070658_10296292 3300005327 Bacteria 1379
31 Ga0070676_10006052 3300005328 Bacteria 6456
32 Ga0070676_10105682 3300005328 Unclassified 1746
33 Ga0070670_100000039 3300005331 Bacteria 152618
34 Ga0070670_100035340 3300005331 Bacteria 4303
35 Ga0068869_100011830 3300005334 Bacteria 5740
36 Ga0070666_10241688 3300005335 Bacteria 1277
37 Ga0070680_100001403 3300005336 Bacteria 17395
38 Ga0070680_100116463 3300005336 Bacteria 2228
39 Ga0068868_100000970 3300005338 Bacteria 19516
40 Ga0070660_100000994 3300005339 Bacteria 19014
41 Ga0070660_100001976 3300005339 Bacteria 14155
42 Ga0070660_100003168 3300005339 Bacteria 11299
43 Ga0070660_100006873 3300005339 Bacteria 7893
44 Ga0070660_100178891 3300005339 Bacteria 1716
45 Ga0070661_100124982 3300005344 Unclassified 1929
46 Ga0070692_10002808 3300005345 Bacteria 6875
47 Ga0070668_100003848 3300005347 Bacteria 11078
48 Ga0070668_100006150 3300005347 Bacteria 8894
49 Ga0070668_100586265 3300005347 Bacteria 974
50 Ga0070675_100004608 3300005354 Bacteria 10527
51 Ga0070671_100008198 3300005355 Bacteria 8361
52 Ga0070671_100037285 3300005355 Bacteria 4031
53 Ga0070671_100268568 3300005355 Bacteria 1450
54 Ga0070674_100214388 3300005356 Bacteria 1494
55 Ga0070673_100001358 3300005364 Bacteria 14304
56 Ga0070659_100003495 3300005366 Bacteria 11188
57 Ga0070659_100010762 3300005366 Bacteria 6743
58 Ga0070659_100032132 3300005366 Bacteria 4069
59 Ga0070659_100036397 3300005366 Bacteria 3838
60 Ga0070659_100049741 3300005366 Bacteria 3297
61 Ga0070659_100516775 3300005366 Bacteria 1019
62 Ga0070667_100000164 3300005367 Bacteria 82930
63 Ga0070667_100217675 3300005367 Bacteria 1699
64 Ga0070714_100015674 3300005435 Bacteria 6101
65 Ga0070713_100059788 3300005436 Bacteria 3184
66 Ga0070663_100155707 3300005455 Bacteria 1756
67 Ga0070662_100076930 3300005457 Bacteria 2475
68 Ga0070662_100097065 3300005457 Bacteria 2224
69 Ga0070662_100459141 3300005457 Unclassified 1058
70 Ga0070681_10014035 3300005458 Bacteria 7973
71 Ga0070681_10425703 3300005458 Bacteria 1239
72 Ga0068867_100005413 3300005459 Bacteria 9028
73 Ga0070679_100056489 3300005530 Bacteria 3911
74 Ga0068853_100040550 3300005539 Bacteria 3973
75 Ga0068853_100088414 3300005539 Bacteria 2720
76 Ga0068853_100229788 3300005539 Bacteria 1697
77 Ga0068853_100418855 3300005539 Bacteria 1256
78 Ga0070672_100013145 3300005543 Bacteria 5836
79 Ga0070672_100076684 3300005543 Bacteria 2671
80 Ga0070693_100147219 3300005547 Bacteria 1488
81 Ga0070665_100000136 3300005548 Bacteria 138094
82 Ga0070665_100000435 3300005548 Bacteria 60967
83 Ga0070665_100000489 3300005548 Bacteria 56677
84 Ga0070665_100016248 3300005548 Bacteria 7467
85 Ga0070665_100020761 3300005548 Bacteria 6601
86 Ga0070665_100036073 3300005548 Bacteria 4975
87 Ga0070665_100048722 3300005548 Bacteria 4253
88 Ga0070665_100100502 3300005548 Bacteria 2896
89 Ga0070665_100137374 3300005548 Bacteria 2447
90 Ga0070665_100239664 3300005548 Bacteria 1814
91 Ga0068855_100000007 3300005563 Bacteria 273676
92 Ga0068855_100063223 3300005563 Bacteria 4320
93 Ga0068855_100256605 3300005563 Bacteria 1949
94 Ga0068855_100270212 3300005563 Bacteria 1891
95 Ga0068855_100411052 3300005563 Bacteria 1481
96 Ga0068855_100781177 3300005563 Bacteria 1016
97 Ga0070664_100328389 3300005564 Bacteria 1387
98 Ga0068857_100009248 3300005577 Bacteria 8549
99 Ga0068857_100019033 3300005577 Bacteria 6025
100 Ga0068854_100157372 3300005578 Unclassified 1757
101 Ga0068856_100038808 3300005614 Bacteria 4675
102 Ga0068856_100121773 3300005614 Bacteria 2610
103 Ga0068856_100690593 3300005614 Bacteria 1041
104 Ga0068852_100138959 3300005616 Bacteria 2246
105 Ga0068852_100329124 3300005616 Bacteria 1486
106 Ga0068859_100035534 3300005617 Bacteria 5000
107 Ga0068859_100177934 3300005617 Bacteria 2209
108 Ga0068864_100000068 3300005618 Bacteria 115507
109 Ga0068861_100000146 3300005719 Bacteria 36431
110 Ga0068851_10066204 3300005834 Unclassified 1861
111 Ga0068863_100000223 3300005841 Bacteria 60094
112 Ga0068863_100002510 3300005841 Bacteria 18239
113 Ga0068863_100060219 3300005841 Bacteria 3590
114 Ga0068858_100000764 3300005842 Bacteria 33720
115 Ga0068858_100010832 3300005842 Bacteria 8620
116 Ga0068860_100000625 3300005843 Bacteria 41833
117 Ga0068860_100150890 3300005843 Bacteria 2238
118 Ga0068860_100594234 3300005843 Bacteria 1112
119 Ga0068862_100001161 3300005844 Bacteria 24847
120 Ga0068862_100062737 3300005844 Bacteria 3197
121 Ga0068862_100094065 3300005844 Bacteria 2614
122 Ga0081455_10002135 3300005937 Bacteria 23563
123 Ga0081539_10067609 3300005985 Bacteria 1932
124 Ga0070717_10252251 3300006028 Unclassified 1559
125 Ga0075368_10007263 3300006042 Bacteria 3906
126 Ga0075364_10000232 3300006051 Bacteria 26442
127 Ga0075367_10023125 3300006178 Bacteria 3494
128 Ga0075366_10084013 3300006195 Bacteria 1903
129 Ga0075366_10148781 3300006195 Bacteria 1417
130 Ga0075370_10012093 3300006353 Bacteria 4553
131 Ga0068871_100004600 3300006358 Bacteria 9628
132 Ga0068865_100001283 3300006881 Bacteria 14608
133 Ga0097620_100035534 3300006931 Bacteria 5000
134 Ga0097620_100177929 3300006931 Bacteria 2209
135 Ga0105240_10018769 3300009093 Bacteria 9266
136 Ga0105240_10077350 3300009093 Bacteria 4099
137 Ga0105240_10094998 3300009093 Bacteria 3636
138 Ga0105240_10108114 3300009093 Bacteria 3370
139 Ga0105240_10228452 3300009093 Bacteria 2164
140 Ga0105245_10014270 3300009098 Bacteria 6923
141 Ga0105245_10044572 3300009098 Bacteria 3960
142 Ga0105243_10020717 3300009148 Bacteria 4988
143 Ga0105241_10070536 3300009174 Bacteria 2711
144 Ga0105241_10273443 3300009174 Bacteria 1440
145 Ga0105242_10010984 3300009176 Bacteria 6955
146 Ga0105248_10000099 3300009177 Bacteria 95945
147 Ga0105248_10010002 3300009177 Bacteria 10441
148 Ga0105248_10029787 3300009177 Bacteria 6091
149 Ga0105248_10034407 3300009177 Bacteria 5665
150 Ga0105248_10187890 3300009177 Bacteria 2328
151 Ga0105248_10196573 3300009177 Bacteria 2272
152 Ga0105237_10007063 3300009545 Bacteria 12348
153 Ga0105238_10003301 3300009551 Bacteria 16113
154 Ga0105238_10008431 3300009551 Bacteria 10318
155 Ga0105238_10077789 3300009551 Bacteria 3308
156 Ga0105238_10167960 3300009551 Bacteria 2170
157 Ga0105238_10223899 3300009551 Bacteria 1858
158 Ga0105249_10002152 3300009553 Bacteria 17061
159 Ga0105249_10004406 3300009553 Bacteria 12174
160 Ga0105249_10308981 3300009553 Bacteria 1589
161 Ga0105239_10075500 3300010375 Bacteria 3706
162 Ga0105239_10096726 3300010375 Bacteria 3262
163 Ga0105239_10346147 3300010375 Bacteria 1678
164 Ga0105246_10014523 3300011119 Bacteria 4953
165 Ga0157373_10008438 3300013100 Bacteria 7651
166 Ga0157373_10021265 3300013100 Bacteria 4711
167 Ga0157373_10036196 3300013100 Bacteria 3544
168 Ga0157373_10069890 3300013100 Bacteria 2482
169 Ga0157371_10105923 3300013102 Bacteria 1995
170 Ga0157371_10320866 3300013102 Unclassified 1124
171 Ga0157370_10008876 3300013104 Bacteria 10805
172 Ga0157369_10004923 3300013105 Bacteria 15654
173 Ga0157369_10006787 3300013105 Bacteria 13207
174 Ga0157369_10036033 3300013105 Bacteria 5423
175 Ga0157374_10080838 3300013296 Bacteria 3083
176 Ga0157378_10304540 3300013297 Bacteria 1543
177 Ga0157378_10562408 3300013297 Bacteria 1147
178 Ga0163162_10046822 3300013306 Bacteria 4335
179 Ga0157372_10001259 3300013307 Bacteria 27423
180 Ga0157372_10297229 3300013307 Bacteria 1878
181 Ga0163163_10125355 3300014325 Bacteria 2606
182 Ga0182008_10156179 3300014497 Bacteria 1146
183 Ga0157379_10090311 3300014968 Bacteria 2748
184 Ga0157379_10463008 3300014968 Bacteria 1172
185 Ga0157376_10003735 3300014969 Bacteria 10521
186 Ga0163161_10032833 3300017792 Bacteria 3708
187 Ga0163161_10207562 3300017792 Bacteria 1512
188 Ga0197907_10013985 3300020069 Bacteria 1065
189 Ga0206354_11031140 3300020081 Bacteria 3444
190 Ga0206353_10140244 3300020082 Bacteria 2295
191 Ga0206353_10320286 3300020082 Bacteria 1399
192 Ga0213873_10000027 3300021358 Bacteria 73909
193 Ga0213876_10000004 3300021384 Bacteria 943822
194 Ga0213876_10000524 3300021384 Bacteria 29280
195 Ga0213876_10023018 3300021384 Bacteria 3292
196 Ga0209147_100587 3300025229 Bacteria 20169
197 Ga0209148_1000061 3300025254 Bacteria 349575
198 Ga0209565_1000100 3300025263 Bacteria 130380
199 Ga0209565_1000127 3300025263 Bacteria 109900
200 Ga0209673_1000645 3300025273 Bacteria 51774
201 Ga0209673_1040053 3300025273 Bacteria 1344
202 Ga0209675_1005784 3300025291 Bacteria 5094
203 Ga0209564_1002956 3300025295 Bacteria 12266
204 Ga0209564_1006067 3300025295 Bacteria 6654
205 Ga0209564_1014974 3300025295 Bacteria 3187
206 Ga0209758_1000779 3300025297 Bacteria 45780
207 Ga0209758_1004368 3300025297 Bacteria 11821
208 Ga0209758_1011482 3300025297 Bacteria 5121
209 Ga0209050_1003868 3300025298 Bacteria 10635
210 Ga0209050_1029613 3300025298 Bacteria 1746
211 Ga0209256_1005367 3300025299 Bacteria 7421
212 Ga0209257_1008431 3300025304 Bacteria 5862
213 Ga0207688_10262749 3300025901 Bacteria 1048
214 Ga0207680_10044167 3300025903 Bacteria 2619
215 Ga0207647_10004165 3300025904 Bacteria 10726
216 Ga0207647_10004201 3300025904 Bacteria 10681
217 Ga0207647_10009213 3300025904 Bacteria 7024
218 Ga0207645_10009774 3300025907 Bacteria 6621
219 Ga0207705_10000008 3300025909 Bacteria 589717
220 Ga0207705_10000268 3300025909 Bacteria 49981
221 Ga0207705_10033836 3300025909 Bacteria 3652
222 Ga0207705_10050812 3300025909 Bacteria 2985
223 Ga0207654_10236872 3300025911 Bacteria 1218
224 Ga0207707_10146823 3300025912 Bacteria 2062
225 Ga0207695_10000961 3300025913 Bacteria 51376
226 Ga0207695_10036326 3300025913 Bacteria 5328
227 Ga0207695_10042052 3300025913 Bacteria 4886
228 Ga0207695_10045586 3300025913 Bacteria 4653
229 Ga0207660_10015901 3300025917 Bacteria 4975
230 Ga0207660_10037100 3300025917 Bacteria 3393
231 Ga0207657_10003864 3300025919 Bacteria 15902
232 Ga0207657_10006132 3300025919 Bacteria 12493
233 Ga0207657_10006527 3300025919 Bacteria 12082
234 Ga0207657_10011298 3300025919 Bacteria 8867
235 Ga0207657_10053559 3300025919 Bacteria 3495
236 Ga0207657_10124864 3300025919 Bacteria 2114
237 Ga0207657_10358580 3300025919 Bacteria 1149
238 Ga0207649_10021099 3300025920 Bacteria 3744
239 Ga0207652_10223087 3300025921 Bacteria 1698
240 Ga0207652_10307241 3300025921 Bacteria 1431
241 Ga0207681_10269605 3300025923 Bacteria 1336
242 Ga0207694_10002795 3300025924 Bacteria 14092
243 Ga0207650_10000161 3300025925 Bacteria 81097
244 Ga0207659_10011161 3300025926 Bacteria 5668
245 Ga0207687_10004703 3300025927 Bacteria 9080
246 Ga0207687_10026932 3300025927 Bacteria 3853
247 Ga0207664_10026266 3300025929 Bacteria 4400
248 Ga0207644_10000790 3300025931 Bacteria 20093
249 Ga0207644_10025112 3300025931 Bacteria 4095
250 Ga0207690_10001493 3300025932 Bacteria 14611
251 Ga0207690_10002735 3300025932 Bacteria 10647
252 Ga0207690_10023455 3300025932 Bacteria 3850
253 Ga0207690_10030833 3300025932 Bacteria 3425
254 Ga0207690_10160490 3300025932 Bacteria 1675
255 Ga0207690_10491362 3300025932 Bacteria 992
256 Ga0207706_10017369 3300025933 Bacteria 6482
257 Ga0207706_10017733 3300025933 Bacteria 6413
258 Ga0207706_10029003 3300025933 Bacteria 4940
259 Ga0207706_10105057 3300025933 Bacteria 2485
260 Ga0207686_10000503 3300025934 Bacteria 25575
261 Ga0207709_10003879 3300025935 Bacteria 8747
262 Ga0207704_10000006 3300025938 Bacteria 220005
263 Ga0207691_10020900 3300025940 Bacteria 6184
264 Ga0207691_10045745 3300025940 Bacteria 4023
265 Ga0207711_10000117 3300025941 Bacteria 81970
266 Ga0207711_10006371 3300025941 Bacteria 9947
267 Ga0207711_10036946 3300025941 Bacteria 4145
268 Ga0207711_10046862 3300025941 Bacteria 3694
269 Ga0207711_10105948 3300025941 Bacteria 2494
270 Ga0207689_10011398 3300025942 Bacteria 7619
271 Ga0207679_10284765 3300025945 Bacteria 1419
272 Ga0207667_10000038 3300025949 Bacteria 280720
273 Ga0207667_10030568 3300025949 Bacteria 5826
274 Ga0207667_10203550 3300025949 Bacteria 2030
275 Ga0207667_10204380 3300025949 Bacteria 2026
276 Ga0207651_10000001 3300025960 Bacteria 516823
277 Ga0207712_10008409 3300025961 Bacteria 6521
278 Ga0207712_10151979 3300025961 Bacteria 1789
279 Ga0207712_10168500 3300025961 Bacteria 1709
280 Ga0207668_10000180 3300025972 Bacteria 42714
281 Ga0207668_10002043 3300025972 Bacteria 11770
282 Ga0207668_10005205 3300025972 Bacteria 7653
283 Ga0207640_10000427 3300025981 Bacteria 25987
284 Ga0207640_10277262 3300025981 Unclassified 1315
285 Ga0207640_10588366 3300025981 Bacteria 940
286 Ga0207658_10000106 3300025986 Bacteria 90920
287 Ga0207658_10147567 3300025986 Bacteria 1912
288 Ga0207677_10000562 3300026023 Bacteria 23478
289 Ga0207677_10032755 3300026023 Bacteria 3344
290 Ga0207703_10000413 3300026035 Bacteria 45571
291 Ga0207703_10011313 3300026035 Bacteria 6940
292 Ga0207639_10004458 3300026041 Bacteria 9450
293 Ga0207639_10079422 3300026041 Bacteria 2593
294 Ga0207639_10083255 3300026041 Bacteria 2539
295 Ga0207678_10027690 3300026067 Bacteria 4947
296 Ga0207678_10037556 3300026067 Bacteria 4212
297 Ga0207678_10161656 3300026067 Bacteria 1912
298 Ga0207702_10599019 3300026078 Bacteria 1081
299 Ga0207702_10606973 3300026078 Bacteria 1074
300 Ga0207641_10000134 3300026088 Bacteria 109053
301 Ga0207641_10019352 3300026088 Bacteria 5587
302 Ga0207641_10042862 3300026088 Bacteria 3798
303 Ga0207641_10174979 3300026088 Bacteria 1962
304 Ga0207648_10007905 3300026089 Bacteria 10371
305 Ga0207676_10000744 3300026095 Bacteria 25497
306 Ga0207676_10001706 3300026095 Bacteria 16192
307 Ga0207674_10009103 3300026116 Bacteria 11396
308 Ga0207675_100000126 3300026118 Bacteria 63505
309 Ga0207683_10002975 3300026121 Bacteria 14784
310 Ga0207698_10032989 3300026142 Bacteria 3757
311 Ga0207698_10036135 3300026142 Bacteria 3623
312 Ga0207698_10048853 3300026142 Bacteria 3215
313 Ga0268266_10000003 3300028379 Bacteria 1701703
314 Ga0268266_10000450 3300028379 Bacteria 60987
315 Ga0268266_10019870 3300028379 Bacteria 5725
316 Ga0268266_10050163 3300028379 Unclassified 3580
317 Ga0268266_10058849 3300028379 Bacteria 3309
318 Ga0268266_10059112 3300028379 Bacteria 3302
319 Ga0268266_10075686 3300028379 Bacteria 2924
320 Ga0268266_10096623 3300028379 Bacteria 2597
321 Ga0268265_10002588 3300028380 Bacteria 13494
322 Ga0268265_10047390 3300028380 Bacteria 3220
323 Ga0268264_10000059 3300028381 Bacteria 306927
324 Ga0268264_10715481 3300028381 Bacteria 995
325 Ga0307515_10043113 3300028794 Bacteria 7027
326 Ga0265338_10025412 3300028800 Bacteria 6009
327 Ga0265338_10083282 3300028800 Bacteria 2676
328 Ga0307513_10008532 3300031456 Bacteria 13095
329 Ga0307413_10018210 3300031824 Bacteria 3678
330 Ga0307413_10070301 3300031824 Bacteria 2200
331 Ga0307413_10130664 3300031824 Bacteria 1718
332 Ga0307407_10030397 3300031903 Bacteria 2913
333 Ga0307409_100047147 3300031995 Bacteria 3268
334 Ga0307409_100082438 3300031995 Bacteria 2603
335 Ga0307409_100408225 3300031995 Bacteria 1299
336 Ga0307416_100461745 3300032002 Bacteria 1325
337 Ga0307414_10011678 3300032004 Bacteria 5162
338 Ga0307414_10053232 3300032004 Bacteria 2822
339 Ga0307411_10001079 3300032005 Bacteria 10587
340 Ga0307411_10092659 3300032005 Bacteria 2114
341 Ga0307415_100285091 3300032126 Bacteria 1360
342 Ga0307510_10163787 3300033180 Bacteria 1816
343 Ga0373943_0095095 3300035170 Unclassified 1549
344 Ga0373935_0016436 3300035692 Bacteria 4477
345 Ga0373927_0069184 3300035695 Bacteria 2285
346 Ga0373947_0057425 3300035725 Unclassified 2355
347 Ga0373925_0014958 3300037068 Bacteria 5610
348 Ga0395899_0014383 3300037312 Bacteria 6041
349 Ga0395899_0019846 3300037312 Bacteria 5100
350 Ga0395899_0092304 3300037312 Bacteria 2193
351 Ga0395900_0005031 3300037418 Bacteria 13873
352 Ga0395900_0026359 3300037418 Bacteria 5953
353 Ga0395900_0031253 3300037418 Bacteria 5469
354 Ga0395900_0063503 3300037418 Bacteria 3796
355 Ga0395900_0070305 3300037418 Bacteria 3599
356 Ga0395900_0072383 3300037418 Bacteria 3544
357 Ga0395900_0085522 3300037418 Bacteria 3241
358 Ga0395900_0142491 3300037418 Bacteria 2453
359 Ga0395900_0346766 3300037418 Bacteria 1459
360 Ga0395900_0379889 3300037418 Bacteria 1381
361 Ga0395898_0038175 3300037466 Bacteria 4762
362 Ga0395898_0040930 3300037466 Bacteria 4579
363 Ga0395898_0052256 3300037466 Bacteria 3992
364 Ga0395898_0263653 3300037466 Bacteria 1643
365 Ga0395898_0705083 3300037466 Bacteria 951
366 Ga0395905_0005768 3300037471 Bacteria 12584
367 Ga0395905_0011547 3300037471 Bacteria 8534
368 Ga0395905_0012993 3300037471 Bacteria 8002
369 Ga0395905_0013025 3300037471 Bacteria 7991
370 Ga0395905_0014297 3300037471 Bacteria 7584
371 Ga0395905_0015457 3300037471 Bacteria 7256
372 Ga0395905_0048851 3300037471 Bacteria 3964
373 Ga0395905_0055648 3300037471 Bacteria 3702
374 Ga0395905_0066436 3300037471 Bacteria 3377
375 Ga0395905_0095121 3300037471 Bacteria 2796
376 Ga0395905_0116115 3300037471 Bacteria 2515
377 Ga0395905_0121404 3300037471 Bacteria 2456
378 Ga0395905_0146971 3300037471 Bacteria 2218
379 Ga0395905_0173287 3300037471 Bacteria 2026
380 Ga0395905_0242975 3300037471 Bacteria 1682
381 Ga0395905_0281723 3300037471 Bacteria 1548
382 Ga0395905_0356342 3300037471 Bacteria 1355
383 Ga0395905_0458745 3300037471 Bacteria 1173
384 Ga0395905_0593614 3300037471 Bacteria 1009
385 Ga0395901_0009568 3300038443 Bacteria 9834
386 Ga0395901_0013801 3300038443 Bacteria 8215
387 Ga0395901_0016921 3300038443 Bacteria 7433
388 Ga0395901_0033970 3300038443 Bacteria 5266
389 Ga0395901_0034571 3300038443 Bacteria 5220
390 Ga0395901_0034841 3300038443 Bacteria 5200
391 Ga0395901_0054665 3300038443 Bacteria 4150
392 Ga0395901_0055067 3300038443 Bacteria 4135
393 Ga0395901_0142155 3300038443 Bacteria 2522
394 Ga0395901_0166275 3300038443 Bacteria 2316
395 Ga0395901_0419444 3300038443 Bacteria 1372
396 Ga0436365_0102423 3300039437 Bacteria 73123
397 Ga0436365_0225691 3300039437 Bacteria 12735
398 Ga0436365_0429708 3300039437 Bacteria 77395
399 Ga0436365_1067410 3300039437 Bacteria 5710
400 Ga0436362_0740394 3300039453 Bacteria 73123
401 Ga0439439_0028760 3300041406 Bacteria 1409
402 Ga0439461_0000033 3300041410 Bacteria 17253
403 Ga0439465_0000209 3300041413 Bacteria 15633
404 Ga0451806_872881 3300041462 Unclassified 1364
405 Ga0451845_0258826 3300041501 Unclassified 1180
406 Ga0439431_0000358 3300041997 Bacteria 9607
407 Ga0439442_015424 3300042002 Bacteria 1574
408 Ga0439445_0067815 3300042004 Bacteria 983
409 Ga0439448_0000431 3300042005 Bacteria 9613
410 Ga0439448_0000657 3300042005 Bacteria 8209
411 Ga0439432_000370 3300042006 Bacteria 16561
412 Ga0439452_008123 3300042010 Bacteria 3174
413 Ga0439455_0001314 3300042012 Bacteria 4092
414 Ga0439462_0001366 3300042015 Bacteria 5389
415 Ga0439446_0008433 3300042156 Bacteria 2736
416 Ga0439458_0000258 3300042157 Bacteria 12892
417 Ga0439458_0000396 3300042157 Bacteria 10951
418 Ga0439458_0001933 3300042157 Bacteria 5136
419 Ga0439434_0001411 3300042435 Bacteria 6935
420 Ga0466972_0002432 3300044658 Bacteria 9191
421 Ga0466965_0036027 3300044683 Bacteria 2426
422 Ga0466966_0004705 3300044684 Bacteria 8983
423 Ga0466966_0041924 3300044684 Bacteria 2940
424 Ga0466961_0056008 3300044693 Bacteria 2512
425 Ga0466961_0288450 3300044693 Bacteria 1004
426 Ga0466963_0012898 3300044694 Bacteria 5121
427 Ga0466963_0021200 3300044694 Bacteria 4096
428 Ga0466963_0048984 3300044694 Bacteria 2793
429 Ga0466963_0074521 3300044694 Bacteria 2289
430 Ga0466964_0011559 3300044706 Bacteria 3336
431 Ga0466964_0012297 3300044706 Bacteria 3239
432 Ga0466971_0021426 3300044719 Bacteria 2876
433 Ga0466970_0033531 3300044765 Bacteria 2714
434 Ga0466970_0054842 3300044765 Bacteria 2129
435 Ga0466957_0070884 3300044842 Bacteria 2154
436 Ga0466957_0110915 3300044842 Bacteria 1739
437 Ga0466960_0047716 3300044901 Bacteria 2055
438 Ga0466959_0063100 3300045049 Bacteria 2691
439 Ga0466959_0133397 3300045049 Bacteria 1759
440 Ga0466958_0002033 3300045836 Bacteria 9982
441 Ga0466958_0035982 3300045836 Bacteria 2961
442 Ga0466967_0003464 3300045976 Bacteria 10300
443 Ga0466967_0006189 3300045976 Bacteria 8435
444 Ga0466967_0010339 3300045976 Bacteria 6994
445 Ga0466967_0032583 3300045976 Bacteria 4401
446 Ga0466967_0210409 3300045976 Bacteria 1844
447 Ga0466967_0282495 3300045976 Bacteria 1593
448 Ga0466967_0349712 3300045976 Bacteria 1430
449 Ga0466967_0555471 3300045976 Bacteria 1130
450 Ga0495617_006660 3300046452 Bacteria 4037
451 Ga0495627_000452 3300046453 Bacteria 35632
452 Ga0495627_000484 3300046453 Bacteria 33611
453 Ga0495629_0015242 3300046459 Bacteria 5522
454 Ga0495638_0000371 3300046460 Bacteria 55687
455 Ga0495638_0001764 3300046460 Bacteria 18950
456 Ga0495638_0003191 3300046460 Bacteria 12956
457 Ga0495638_0065125 3300046460 Bacteria 2244
458 Ga0495650_0000007 3300046471 Bacteria 718072
459 Ga0495594_0048846 3300046499 Bacteria 2325
460 Ga0495583_0000024 3300046506 Bacteria 274122
461 Ga0495583_0001045 3300046506 Bacteria 31275
462 Ga0495606_0007663 3300046507 Bacteria 9573
463 Ga0495610_0000029 3300046512 Bacteria 271137
464 Ga0495610_0000083 3300046512 Bacteria 112946
465 Ga0495610_0028060 3300046512 Bacteria 2982
466 Ga0495616_0001006 3300046513 Bacteria 20158
467 Ga0495616_0015276 3300046513 Bacteria 4271
468 Ga0495620_0048563 3300046515 Bacteria 1821
469 Ga0495632_0000007 3300046519 Bacteria 343246
470 Ga0495632_0015731 3300046519 Bacteria 4229
471 Ga0495637_0000971 3300046520 Bacteria 18217
472 Ga0495637_0007154 3300046520 Bacteria 5555
473 Ga0495637_0020350 3300046520 Bacteria 3055
474 Ga0495643_0000005 3300046522 Bacteria 443135
475 Ga0495643_0006901 3300046522 Bacteria 7394
476 Ga0495663_0000005 3300046525 Bacteria 342265
477 Ga0495654_0000116 3300046530 Bacteria 90109
478 Ga0495622_0005934 3300046557 Bacteria 5675
479 Ga0495633_0001368 3300046558 Bacteria 19079
480 Ga0495633_0007470 3300046558 Bacteria 6284
481 Ga0495633_0015727 3300046558 Bacteria 3922
482 Ga0495668_0063125 3300046616 Bacteria 2040
483 Ga0495625_0000051 3300046660 Bacteria 193325
484 Ga0495625_0012782 3300046660 Bacteria 6789
485 Ga0495625_0028532 3300046660 Bacteria 4185
486 Ga0495658_0190896 3300046683 Bacteria 1274
487 Ga0495669_0043410 3300046684 Bacteria 2001
488 Ga0495670_0078887 3300046691 Bacteria 1675
489 Ga0495671_0000007 3300046692 Bacteria 443069
490 Ga0495660_0029563 3300046810 Bacteria 3090
491 Ga0495672_0008040 3300047320 Bacteria 7845
492 Ga0495672_0205290 3300047320 Bacteria 983
493 Ga0495679_007045 3300047446 Bacteria 4748
494 Ga0495673_0000082 3300047469 Bacteria 199141
495 Ga0495673_0025099 3300047469 Bacteria 2868
496 Ga0495673_0090049 3300047469 Bacteria 1255
497 Ga0495681_0000036 3300047470 Bacteria 124207
498 Ga0495681_0012249 3300047470 Bacteria 5052
499 Ga0495681_0078331 3300047470 Bacteria 1481
500 Ga0495686_0000091 3300047472 Bacteria 190563
501 Ga0495686_0016065 3300047472 Bacteria 5087
502 Ga0495686_0016391 3300047472 Bacteria 5026
503 Ga0495593_0058174 3300047673 Bacteria 2028
504 Ga0496102_0098908 3300048905 Bacteria 2707
505 Ga0496108_0001497 3300048911 Bacteria 18476
506 Ga0496110_0128998 3300048913 Bacteria 2283
507 Ga0496115_0001421 3300048918 Bacteria 17142
508 Ga0496115_0001934 3300048918 Bacteria 14779
509 Ga0496116_0047442 3300048919 Bacteria 2891
510 Ga0496117_0011255 3300048920 Bacteria 8030
511 Ga0496117_0017303 3300048920 Bacteria 6028
512 Ga0496118_0033750 3300048921 Bacteria 4191
513 Ga0496118_0073150 3300048921 Bacteria 2457
514 Ga0496121_0001604 3300048924 Bacteria 37523
515 Ga0496121_0003614 3300048924 Bacteria 21832
516 Ga0496121_0143625 3300048924 Bacteria 1767
517 Ga0496122_0000385 3300048925 Bacteria 94046
518 Ga0496122_0074400 3300048925 Bacteria 2404
519 Ga0496122_0091160 3300048925 Bacteria 2076
520 Ga0496123_0001451 3300048926 Bacteria 33000
521 Ga0496123_0009318 3300048926 Bacteria 8859
522 Ga0496123_0145316 3300048926 Unclassified 1289
523 Ga0496124_0067144 3300048927 Bacteria 2985
524 Ga0496125_0055350 3300048928 Bacteria 3233
525 Ga0496125_0095864 3300048928 Bacteria 2205
526 Ga0496125_0128725 3300048928 Bacteria 1787
527 Ga0496125_0287791 3300048928 Bacteria 1014
528 Ga0496126_0061088 3300048929 Bacteria 3386
529 Ga0495678_007842 3300049459 Bacteria 5485
530 Ga0495682_0019706 3300049460 Bacteria 2535
531 Ga0501037_0161218 3300049573 Bacteria 1599
532 Ga0501067_0008845 3300049583 Bacteria 5579
533 Ga0501068_0050299 3300049584 Bacteria 2519
534 Ga0501071_0536945 3300049587 Unclassified 898
535 Ga0501074_0032077 3300049590 Bacteria 3808
536 Ga0501080_0011952 3300049742 Bacteria 7953
537 nmdc:mga0k408_88523_c1 3300050493 Bacteria 1818
538 nmdc:mga0k408_94355_c1 3300050493 Bacteria 1760
539 nmdc:mga06z11_65687_c1 3300050494 Bacteria 1905
540 nmdc:mga07m45_4197_c2 3300050496 Bacteria 3370
541 Ga0500643_006999 3300053087 Bacteria 4626
542 Ga0500646_0074040 3300053090 Bacteria 1027
543 Ga0500583_0043757 3300053092 Bacteria 2047
544 Ga0500651_0130948 3300053093 Bacteria 1517
545 Ga0500566_0024885 3300053094 Bacteria 3511
546 Ga0500554_001504 3300053102 Bacteria 4503
547 Ga0500555_001287 3300053103 Bacteria 7972
548 Ga0500555_002862 3300053103 Bacteria 4945
549 Ga0500556_0002900 3300053104 Bacteria 5208
550 Ga0500556_0062593 3300053104 Bacteria 1373
551 Ga0500562_010556 3300053108 Bacteria 2342
552 Ga0500569_000755 3300053109 Bacteria 5652
553 Ga0500595_023004 3300053119 Bacteria 2195
554 Ga0500614_001216 3300053123 Bacteria 6269
555 Ga0500614_002009 3300053123 Bacteria 4653
556 Ga0500618_000129 3300053125 Bacteria 62710
557 Ga0500642_0000724 3300053130 Bacteria 9727
558 Ga0500658_0006373 3300053134 Bacteria 4379
559 Ga0500559_0000008 3300053136 Bacteria 182182
560 Ga0500559_0006393 3300053136 Bacteria 5323
561 Ga0500559_0009567 3300053136 Bacteria 4187
562 Ga0500564_134710 3300053138 Bacteria 1066
563 Ga0500577_0006035 3300053142 Bacteria 3309
564 Ga0500590_004177 3300053148 Bacteria 6781
565 Ga0500616_0003742 3300053153 Bacteria 11348
566 Ga0500622_0008887 3300053156 Bacteria 5593
567 Ga0500636_0029481 3300053177 Bacteria 3242
568 Ga0500637_0033382 3300053178 Bacteria 2874
569 Ga0500625_015584 3300053729 Bacteria 3530
570 Ga0500645_001686 3300053730 Bacteria 10808
571 Ga0500645_008708 3300053730 Bacteria 3443
572 Ga0500596_000844 3300053735 Bacteria 6080
573 Ga0466962_0007852 3300061719 Bacteria 5119
574 Ga0466962_0063681 3300061719 Bacteria 1761
575 2511125110 2510917020 Bacteria 5657507
576 2512644237 2512564014 Bacteria 4639632
577 2585154183 2582581280 Bacteria 5994497
578 2585197802 2582581293 Bacteria 5907401
579 2643747471 2643221545 Bacteria 5083237
580 2643778716 2643221552 Bacteria 5708754
581 2643923439 2643221583 Bacteria 5218014
582 2643930104 2643221584 Bacteria 5511711
583 2644509520 2643221691 Bacteria 5093099
584 2819538931 2818991435 Bacteria 5433759
585 2819648531 2818991454 Bacteria 5563326
586 2819713503 2818991466 Bacteria 4748179
587 2928530252 2928526807 Bacteria 4760224
588 2928971917 2928968154 Bacteria 4633371
589 Ga0068864_100001926
590 SwRhRL2b_contig_2353265
591 JGI24739J22299_10004390
592 JGI24739J22299_10022776
593 JGI24739J22299_10060859
594 JGI24737J22298_10001315
595 JGI24737J22298_10003134
596 JGI24737J22298_10030440
597 JGI24743J22301_10033448
598 JGI24735J21928_10004071
599 JGI24735J21928_10004239
600 JGI24735J21928_10012361
601 JGI24738J21930_10001372
602 JGI24744J21845_10000256
603 rootL2_10198081
604 Ga0055542_1016692
605 Ga0055526_1001076
606 Ga0055537_1002835
607 Ga0055537_1007899
608 Ga0055524_1003448
609 Ga0055528_1003643
610 Ga0055531_10008415
611 Ga0065165_1001453
612 Ga0070658_10000037
613 Ga0070658_10000116
614 Ga0070658_10011202
615 Ga0070658_10015397
616 Ga0070658_10049332
617 Ga0070658_10065782
618 Ga0070658_10296292
619 Ga0070676_10006052
620 Ga0070676_10105682
621 Ga0070670_100000039
622 Ga0070670_100035340
623 Ga0068869_100011830
624 Ga0070666_10241688
625 Ga0070680_100001403
626 Ga0070680_100116463
627 Ga0068868_100000970
628 Ga0070660_100000994
629 Ga0070660_100001976
630 Ga0070660_100003168
631 Ga0070660_100006873
632 Ga0070660_100178891
633 Ga0070661_100124982
634 Ga0070692_10002808
635 Ga0070668_100003848
636 Ga0070668_100006150
637 Ga0070668_100586265
638 Ga0070675_100004608
639 Ga0070671_100008198
640 Ga0070671_100037285
641 Ga0070671_100268568
642 Ga0070674_100214388
643 Ga0070673_100001358
644 Ga0070659_100003495
645 Ga0070659_100010762
646 Ga0070659_100032132
647 Ga0070659_100036397
648 Ga0070659_100049741
649 Ga0070659_100516775
650 Ga0070667_100000164
651 Ga0070667_100217675
652 Ga0070714_100015674
653 Ga0070713_100059788
654 Ga0070663_100155707
655 Ga0070662_100076930
656 Ga0070662_100097065
657 Ga0070662_100459141
658 Ga0070681_10014035
659 Ga0070681_10425703
660 Ga0068867_100005413
661 Ga0070679_100056489
662 Ga0068853_100040550
663 Ga0068853_100088414
664 Ga0068853_100229788
665 Ga0068853_100418855
666 Ga0070672_100013145
667 Ga0070672_100076684
668 Ga0070693_100147219
669 Ga0070665_100000136
670 Ga0070665_100000435
671 Ga0070665_100000489
672 Ga0070665_100016248
673 Ga0070665_100020761
674 Ga0070665_100036073
675 Ga0070665_100048722
676 Ga0070665_100100502
677 Ga0070665_100137374
678 Ga0070665_100239664
679 Ga0068855_100000007
680 Ga0068855_100063223
681 Ga0068855_100256605
682 Ga0068855_100270212
683 Ga0068855_100411052
684 Ga0068855_100781177
685 Ga0070664_100328389
686 Ga0068857_100009248
687 Ga0068857_100019033
688 Ga0068854_100157372
689 Ga0068856_100038808
690 Ga0068856_100121773
691 Ga0068856_100690593
692 Ga0068852_100138959
693 Ga0068852_100329124
694 Ga0068859_100035534
695 Ga0068859_100177934
696 Ga0068864_100000068
697 Ga0068861_100000146
698 Ga0068851_10066204
699 Ga0068863_100000223
700 Ga0068863_100002510
701 Ga0068863_100060219
702 Ga0068858_100000764
703 Ga0068858_100010832
704 Ga0068860_100000625
705 Ga0068860_100150890
706 Ga0068860_100594234
707 Ga0068862_100001161
708 Ga0068862_100062737
709 Ga0068862_100094065
710 Ga0081455_10002135
711 Ga0081539_10067609
712 Ga0070717_10252251
713 Ga0075368_10007263
714 Ga0075364_10000232
715 Ga0075367_10023125
716 Ga0075366_10084013
717 Ga0075366_10148781
718 Ga0075370_10012093
719 Ga0068871_100004600
720 Ga0068865_100001283
721 Ga0097620_100035534
722 Ga0097620_100177929
723 Ga0105240_10018769
724 Ga0105240_10077350
725 Ga0105240_10094998
726 Ga0105240_10108114
727 Ga0105240_10228452
728 Ga0105245_10014270
729 Ga0105245_10044572
730 Ga0105243_10020717
731 Ga0105241_10070536
732 Ga0105241_10273443
733 Ga0105242_10010984
734 Ga0105248_10000099
735 Ga0105248_10010002
736 Ga0105248_10029787
737 Ga0105248_10034407
738 Ga0105248_10187890
739 Ga0105248_10196573
740 Ga0105237_10007063
741 Ga0105238_10003301
742 Ga0105238_10008431
743 Ga0105238_10077789
744 Ga0105238_10167960
745 Ga0105238_10223899
746 Ga0105249_10002152
747 Ga0105249_10004406
748 Ga0105249_10308981
749 Ga0105239_10075500
750 Ga0105239_10096726
751 Ga0105239_10346147
752 Ga0105246_10014523
753 Ga0157373_10008438
754 Ga0157373_10021265
755 Ga0157373_10036196
756 Ga0157373_10069890
757 Ga0157371_10105923
758 Ga0157371_10320866
759 Ga0157370_10008876
760 Ga0157369_10004923
761 Ga0157369_10006787
762 Ga0157369_10036033
763 Ga0157374_10080838
764 Ga0157378_10304540
765 Ga0157378_10562408
766 Ga0163162_10046822
767 Ga0157372_10001259
768 Ga0157372_10297229
769 Ga0163163_10125355
770 Ga0182008_10156179
771 Ga0157379_10090311
772 Ga0157379_10463008
773 Ga0157376_10003735
774 Ga0163161_10032833
775 Ga0163161_10207562
776 Ga0197907_10013985
777 Ga0206354_11031140
778 Ga0206353_10140244
779 Ga0206353_10320286
780 Ga0213873_10000027
781 Ga0213876_10000004
782 Ga0213876_10000524
783 Ga0213876_10023018
784 Ga0209147_100587
785 Ga0209148_1000061
786 Ga0209565_1000100
787 Ga0209565_1000127
788 Ga0209673_1000645
789 Ga0209673_1040053
790 Ga0209675_1005784
791 Ga0209564_1002956
792 Ga0209564_1006067
793 Ga0209564_1014974
794 Ga0209758_1000779
795 Ga0209758_1004368
796 Ga0209758_1011482
797 Ga0209050_1003868
798 Ga0209050_1029613
799 Ga0209256_1005367
800 Ga0209257_1008431
801 Ga0207688_10262749
802 Ga0207680_10044167
803 Ga0207647_10004165
804 Ga0207647_10004201
805 Ga0207647_10009213
806 Ga0207645_10009774
807 Ga0207705_10000008
808 Ga0207705_10000268
809 Ga0207705_10033836
810 Ga0207705_10050812
811 Ga0207654_10236872
812 Ga0207707_10146823
813 Ga0207695_10000961
814 Ga0207695_10036326
815 Ga0207695_10042052
816 Ga0207695_10045586
817 Ga0207660_10015901
818 Ga0207660_10037100
819 Ga0207657_10003864
820 Ga0207657_10006132
821 Ga0207657_10006527
822 Ga0207657_10011298
823 Ga0207657_10053559
824 Ga0207657_10124864
825 Ga0207657_10358580
826 Ga0207649_10021099
827 Ga0207652_10223087
828 Ga0207652_10307241
829 Ga0207681_10269605
830 Ga0207694_10002795
831 Ga0207650_10000161
832 Ga0207659_10011161
833 Ga0207687_10004703
834 Ga0207687_10026932
835 Ga0207664_10026266
836 Ga0207644_10000790
837 Ga0207644_10025112
838 Ga0207690_10001493
839 Ga0207690_10002735
840 Ga0207690_10023455
841 Ga0207690_10030833
842 Ga0207690_10160490
843 Ga0207690_10491362
844 Ga0207706_10017369
845 Ga0207706_10017733
846 Ga0207706_10029003
847 Ga0207706_10105057
848 Ga0207686_10000503
849 Ga0207709_10003879
850 Ga0207704_10000006
851 Ga0207691_10020900
852 Ga0207691_10045745
853 Ga0207711_10000117
854 Ga0207711_10006371
855 Ga0207711_10036946
856 Ga0207711_10046862
857 Ga0207711_10105948
858 Ga0207689_10011398
859 Ga0207679_10284765
860 Ga0207667_10000038
861 Ga0207667_10030568
862 Ga0207667_10203550
863 Ga0207667_10204380
864 Ga0207651_10000001
865 Ga0207712_10008409
866 Ga0207712_10151979
867 Ga0207712_10168500
868 Ga0207668_10000180
869 Ga0207668_10002043
870 Ga0207668_10005205
871 Ga0207640_10000427
872 Ga0207640_10277262
873 Ga0207640_10588366
874 Ga0207658_10000106
875 Ga0207658_10147567
876 Ga0207677_10000562
877 Ga0207677_10032755
878 Ga0207703_10000413
879 Ga0207703_10011313
880 Ga0207639_10004458
881 Ga0207639_10079422
882 Ga0207639_10083255
883 Ga0207678_10027690
884 Ga0207678_10037556
885 Ga0207678_10161656
886 Ga0207702_10599019
887 Ga0207702_10606973
888 Ga0207641_10000134
889 Ga0207641_10019352
890 Ga0207641_10042862
891 Ga0207641_10174979
892 Ga0207648_10007905
893 Ga0207676_10000744
894 Ga0207676_10001706
895 Ga0207674_10009103
896 Ga0207675_100000126
897 Ga0207683_10002975
898 Ga0207698_10032989
899 Ga0207698_10036135
900 Ga0207698_10048853
901 Ga0268266_10000003
902 Ga0268266_10000450
903 Ga0268266_10019870
904 Ga0268266_10050163
905 Ga0268266_10058849
906 Ga0268266_10059112
907 Ga0268266_10075686
908 Ga0268266_10096623
909 Ga0268265_10002588
910 Ga0268265_10047390
911 Ga0268264_10000059
912 Ga0268264_10715481
913 Ga0307515_10043113
914 Ga0265338_10025412
915 Ga0265338_10083282
916 Ga0307513_10008532
917 Ga0307413_10018210
918 Ga0307413_10070301
919 Ga0307413_10130664
920 Ga0307407_10030397
921 Ga0307409_100047147
922 Ga0307409_100082438
923 Ga0307409_100408225
924 Ga0307416_100461745
925 Ga0307414_10011678
926 Ga0307414_10053232
927 Ga0307411_10001079
928 Ga0307411_10092659
929 Ga0307415_100285091
930 Ga0307510_10163787
931 Ga0373943_0095095
932 Ga0373935_0016436
933 Ga0373927_0069184
934 Ga0373947_0057425
935 Ga0373925_0014958
936 Ga0395899_0014383
937 Ga0395899_0019846
938 Ga0395899_0092304
939 Ga0395900_0005031
940 Ga0395900_0026359
941 Ga0395900_0031253
942 Ga0395900_0063503
943 Ga0395900_0070305
944 Ga0395900_0072383
945 Ga0395900_0085522
946 Ga0395900_0142491
947 Ga0395900_0346766
948 Ga0395900_0379889
949 Ga0395898_0038175
950 Ga0395898_0040930
951 Ga0395898_0052256
952 Ga0395898_0263653
953 Ga0395898_0705083
954 Ga0395905_0005768
955 Ga0395905_0011547
956 Ga0395905_0012993
957 Ga0395905_0013025
958 Ga0395905_0014297
959 Ga0395905_0015457
960 Ga0395905_0048851
961 Ga0395905_0055648
962 Ga0395905_0066436
963 Ga0395905_0095121
964 Ga0395905_0116115
965 Ga0395905_0121404
966 Ga0395905_0146971
967 Ga0395905_0173287
968 Ga0395905_0242975
969 Ga0395905_0281723
970 Ga0395905_0356342
971 Ga0395905_0458745
972 Ga0395905_0593614
973 Ga0395901_0009568
974 Ga0395901_0013801
975 Ga0395901_0016921
976 Ga0395901_0033970
977 Ga0395901_0034571
978 Ga0395901_0034841
979 Ga0395901_0054665
980 Ga0395901_0055067
981 Ga0395901_0142155
982 Ga0395901_0166275
983 Ga0395901_0419444
984 Ga0436365_0102423
985 Ga0436365_0225691
986 Ga0436365_0429708
987 Ga0436365_1067410
988 Ga0436362_0740394
989 Ga0439439_0028760
990 Ga0439461_0000033
991 Ga0439465_0000209
992 Ga0451806_872881
993 Ga0451845_0258826
994 Ga0439431_0000358
995 Ga0439442_015424
996 Ga0439445_0067815
997 Ga0439448_0000431
998 Ga0439448_0000657
999 Ga0439432_000370
1000 Ga0439452_008123
1001 Ga0439455_0001314
1002 Ga0439462_0001366
1003 Ga0439446_0008433
1004 Ga0439458_0000258
1005 Ga0439458_0000396
1006 Ga0439458_0001933
1007 Ga0439434_0001411
1008 Ga0466972_0002432
1009 Ga0466965_0036027
1010 Ga0466966_0004705
1011 Ga0466966_0041924
1012 Ga0466961_0056008
1013 Ga0466961_0288450
1014 Ga0466963_0012898
1015 Ga0466963_0021200
1016 Ga0466963_0048984
1017 Ga0466963_0074521
1018 Ga0466964_0011559
1019 Ga0466964_0012297
1020 Ga0466971_0021426
1021 Ga0466970_0033531
1022 Ga0466970_0054842
1023 Ga0466957_0070884
1024 Ga0466957_0110915
1025 Ga0466960_0047716
1026 Ga0466959_0063100
1027 Ga0466959_0133397
1028 Ga0466958_0002033
1029 Ga0466958_0035982
1030 Ga0466967_0003464
1031 Ga0466967_0006189
1032 Ga0466967_0010339
1033 Ga0466967_0032583
1034 Ga0466967_0210409
1035 Ga0466967_0282495
1036 Ga0466967_0349712
1037 Ga0466967_0555471
1038 Ga0495617_006660
1039 Ga0495627_000452
1040 Ga0495627_000484
1041 Ga0495629_0015242
1042 Ga0495638_0000371
1043 Ga0495638_0001764
1044 Ga0495638_0003191
1045 Ga0495638_0065125
1046 Ga0495650_0000007
1047 Ga0495594_0048846
1048 Ga0495583_0000024
1049 Ga0495583_0001045
1050 Ga0495606_0007663
1051 Ga0495610_0000029
1052 Ga0495610_0000083
1053 Ga0495610_0028060
1054 Ga0495616_0001006
1055 Ga0495616_0015276
1056 Ga0495620_0048563
1057 Ga0495632_0000007
1058 Ga0495632_0015731
1059 Ga0495637_0000971
1060 Ga0495637_0007154
1061 Ga0495637_0020350
1062 Ga0495643_0000005
1063 Ga0495643_0006901
1064 Ga0495663_0000005
1065 Ga0495654_0000116
1066 Ga0495622_0005934
1067 Ga0495633_0001368
1068 Ga0495633_0007470
1069 Ga0495633_0015727
1070 Ga0495668_0063125
1071 Ga0495625_0000051
1072 Ga0495625_0012782
1073 Ga0495625_0028532
1074 Ga0495658_0190896
1075 Ga0495669_0043410
1076 Ga0495670_0078887
1077 Ga0495671_0000007
1078 Ga0495660_0029563
1079 Ga0495672_0008040
1080 Ga0495672_0205290
1081 Ga0495679_007045
1082 Ga0495673_0000082
1083 Ga0495673_0025099
1084 Ga0495673_0090049
1085 Ga0495681_0000036
1086 Ga0495681_0012249
1087 Ga0495681_0078331
1088 Ga0495686_0000091
1089 Ga0495686_0016065
1090 Ga0495686_0016391
1091 Ga0495593_0058174
1092 Ga0496102_0098908
1093 Ga0496108_0001497
1094 Ga0496110_0128998
1095 Ga0496115_0001421
1096 Ga0496115_0001934
1097 Ga0496116_0047442
1098 Ga0496117_0011255
1099 Ga0496117_0017303
1100 Ga0496118_0033750
1101 Ga0496118_0073150
1102 Ga0496121_0001604
1103 Ga0496121_0003614
1104 Ga0496121_0143625
1105 Ga0496122_0000385
1106 Ga0496122_0074400
1107 Ga0496122_0091160
1108 Ga0496123_0001451
1109 Ga0496123_0009318
1110 Ga0496123_0145316
1111 Ga0496124_0067144
1112 Ga0496125_0055350
1113 Ga0496125_0095864
1114 Ga0496125_0128725
1115 Ga0496125_0287791
1116 Ga0496126_0061088
1117 Ga0495678_007842
1118 Ga0495682_0019706
1119 Ga0501037_0161218
1120 Ga0501067_0008845
1121 Ga0501068_0050299
1122 Ga0501071_0536945
1123 Ga0501074_0032077
1124 Ga0501080_0011952
1125 nmdc:mga0k408_88523_c1
1126 nmdc:mga0k408_94355_c1
1127 nmdc:mga06z11_65687_c1
1128 nmdc:mga07m45_4197_c2
1129 Ga0500643_006999
1130 Ga0500646_0074040
1131 Ga0500583_0043757
1132 Ga0500651_0130948
1133 Ga0500566_0024885
1134 Ga0500554_001504
1135 Ga0500555_001287
1136 Ga0500555_002862
1137 Ga0500556_0002900
1138 Ga0500556_0062593
1139 Ga0500562_010556
1140 Ga0500569_000755
1141 Ga0500595_023004
1142 Ga0500614_001216
1143 Ga0500614_002009
1144 Ga0500618_000129
1145 Ga0500642_0000724
1146 Ga0500658_0006373
1147 Ga0500559_0000008
1148 Ga0500559_0006393
1149 Ga0500559_0009567
1150 Ga0500564_134710
1151 Ga0500577_0006035
1152 Ga0500590_004177
1153 Ga0500616_0003742
1154 Ga0500622_0008887
1155 Ga0500636_0029481
1156 Ga0500637_0033382
1157 Ga0500625_015584
1158 Ga0500645_001686
1159 Ga0500645_008708
1160 Ga0500596_000844
1161 Ga0466962_0007852
1162 Ga0466962_0063681
1163 2511125110
1164 2512644237
1165 2585154183
1166 2585197802
1167 2643747471
1168 2643778716
1169 2643923439
1170 2643930104
1171 2644509520
1172 2819538931
1173 2819648531
1174 2819713503
1175 2928530252
1176 2928971917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06271

RDD

RDD family

40

193

0.87

Map