F466792

General Info

Members Datasets Scaffolds Average Seq Length
588 276 1176 282

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0001593|Ga0395898_0001593_17224_18138
Length 304
Sequence MARSRWIVASHSYRLLNVFTRGAEVLSGNPLCVFESGAAFDDRTMQALARQFNLSETTFILPSTRATARVRIFTPSYEMPFAGHPTLGTAHVCRALGLGGNELTLEMKAGVIPVTAETDRWTLQANAPRWREVAESRETVAAMLGIEPRDIGDRPLWVSTGREQLIVPLTSEDAVRRARPQPDALARLASEGGASAAYVFAPRRSADSANASSSDGATVSRELLLSRYFYPEGPAVLEDPATGSATANLGGWYLAMDRKRPCRIEIAQGEQTGRPSLLVLSVDAERRVRVSGDVIELGRGTLTL

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
198 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
199 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
200 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
201 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
202 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
203 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
204 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 5.78
Rhizosphere 90.99
Stem 0
Stem Tuber 0
Unclassified 2.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0001593 3300037466 Bacteria 30957
2 rootH2_10286308 3300003320 Bacteria 2181
3 Ga0065712_10002825 3300005290 Bacteria 4456
4 Ga0070658_10138963 3300005327 Bacteria 2028
5 Ga0070676_10041335 3300005328 Bacteria 2673
6 Ga0070676_10156994 3300005328 Bacteria 1461
7 Ga0070690_100001193 3300005330 Bacteria 13412
8 Ga0070690_100009413 3300005330 Bacteria 5658
9 Ga0070670_100075272 3300005331 Bacteria 2900
10 Ga0070677_10179658 3300005333 Bacteria 1007
11 Ga0068869_100005130 3300005334 Bacteria 8211
12 Ga0068869_100101461 3300005334 Bacteria 2177
13 Ga0068869_100114644 3300005334 Bacteria 2054
14 Ga0070680_100037132 3300005336 Bacteria 3936
15 Ga0070682_100050890 3300005337 Bacteria 2588
16 Ga0070682_100359217 3300005337 Bacteria 1089
17 Ga0068868_100035619 3300005338 Bacteria 3848
18 Ga0070660_100126280 3300005339 Bacteria 2044
19 Ga0070660_100284971 3300005339 Bacteria 1352
20 Ga0070689_100000744 3300005340 Bacteria 19888
21 Ga0070689_100005848 3300005340 Bacteria 8451
22 Ga0070689_100033118 3300005340 Bacteria 3934
23 Ga0070689_100321052 3300005340 Bacteria 1293
24 Ga0070687_100032722 3300005343 Bacteria 2560
25 Ga0070687_100036858 3300005343 Bacteria 2440
26 Ga0070661_100003996 3300005344 Bacteria 10140
27 Ga0070661_100100745 3300005344 Bacteria 2148
28 Ga0070668_100028604 3300005347 Bacteria 4231
29 Ga0070668_100077843 3300005347 Bacteria 2593
30 Ga0070668_100534303 3300005347 Bacteria 1019
31 Ga0070669_100039703 3300005353 Bacteria 3421
32 Ga0070669_100127768 3300005353 Bacteria 1947
33 Ga0070669_100630214 3300005353 Bacteria 900
34 Ga0070675_100000303 3300005354 Bacteria 33069
35 Ga0070675_100044344 3300005354 Bacteria 3637
36 Ga0070675_100281910 3300005354 Bacteria 1460
37 Ga0070675_100322204 3300005354 Bacteria 1365
38 Ga0070671_100026469 3300005355 Bacteria 4766
39 Ga0070671_100030627 3300005355 Bacteria 4440
40 Ga0070674_100019263 3300005356 Bacteria 4333
41 Ga0070674_100026695 3300005356 Bacteria 3776
42 Ga0070674_100039433 3300005356 Bacteria 3189
43 Ga0070674_100064222 3300005356 Bacteria 2571
44 Ga0070673_100004018 3300005364 Bacteria 9258
45 Ga0070673_100007311 3300005364 Bacteria 7271
46 Ga0070673_100187099 3300005364 Bacteria 1776
47 Ga0070688_100005357 3300005365 Bacteria 6746
48 Ga0070688_100008979 3300005365 Bacteria 5446
49 Ga0070688_100030550 3300005365 Bacteria 3235
50 Ga0070659_100097320 3300005366 Bacteria 2365
51 Ga0070667_100066519 3300005367 Bacteria 3062
52 Ga0070667_100269613 3300005367 Bacteria 1526
53 Ga0070709_10030008 3300005434 Bacteria 3258
54 Ga0070709_10092717 3300005434 Bacteria 1995
55 Ga0070714_100020221 3300005435 Bacteria 5433
56 Ga0070714_100024800 3300005435 Bacteria 4942
57 Ga0070714_100185763 3300005435 Bacteria 1894
58 Ga0070713_100057818 3300005436 Bacteria 3231
59 Ga0070713_100061756 3300005436 Bacteria 3136
60 Ga0070713_100077380 3300005436 Bacteria 2828
61 Ga0070710_10014997 3300005437 Bacteria 3912
62 Ga0070701_10064637 3300005438 Bacteria 1940
63 Ga0070701_10171144 3300005438 Bacteria 1265
64 Ga0070711_100009230 3300005439 Bacteria 6066
65 Ga0070711_100102890 3300005439 Bacteria 2081
66 Ga0070711_100313113 3300005439 Bacteria 1252
67 Ga0070705_100004251 3300005440 Bacteria 6992
68 Ga0070705_100013904 3300005440 Bacteria 4128
69 Ga0070700_100024645 3300005441 Bacteria 3535
70 Ga0070700_100081143 3300005441 Bacteria 2095
71 Ga0070700_100271370 3300005441 Bacteria 1226
72 Ga0070700_100456881 3300005441 Bacteria 973
73 Ga0070663_100042205 3300005455 Bacteria 3204
74 Ga0070678_100016552 3300005456 Bacteria 4722
75 Ga0070678_100087717 3300005456 Bacteria 2377
76 Ga0070678_100533879 3300005456 Bacteria 1039
77 Ga0070662_100027975 3300005457 Bacteria 3920
78 Ga0070662_100047451 3300005457 Bacteria 3089
79 Ga0070681_10001993 3300005458 Bacteria 18472
80 Ga0070681_10010855 3300005458 Bacteria 9004
81 Ga0070681_10011868 3300005458 Bacteria 8639
82 Ga0070681_10043958 3300005458 Unclassified 4471
83 Ga0070681_10176242 3300005458 Bacteria 2060
84 Ga0068867_100002538 3300005459 Bacteria 12854
85 Ga0068867_100336960 3300005459 Bacteria 1255
86 Ga0068867_100623104 3300005459 Bacteria 943
87 Ga0070685_10015457 3300005466 Bacteria 4055
88 Ga0070685_10245861 3300005466 Bacteria 1183
89 Ga0070699_100314663 3300005518 Bacteria 1406
90 Ga0070679_100030604 3300005530 Bacteria 5314
91 Ga0070679_100105539 3300005530 Unclassified 2804
92 Ga0070679_100627278 3300005530 Bacteria 1018
93 Ga0070684_100000338 3300005535 Bacteria 32373
94 Ga0068853_100045423 3300005539 Bacteria 3762
95 Ga0070672_100009812 3300005543 Bacteria 6616
96 Ga0070672_100011114 3300005543 Bacteria 6270
97 Ga0070672_100045404 3300005543 Bacteria 3398
98 Ga0070672_100090356 3300005543 Bacteria 2469
99 Ga0070672_100110918 3300005543 Bacteria 2235
100 Ga0070672_100127783 3300005543 Bacteria 2087
101 Ga0070672_100465374 3300005543 Bacteria 1090
102 Ga0070686_100000735 3300005544 Bacteria 18976
103 Ga0070686_100026243 3300005544 Bacteria 3515
104 Ga0070686_100064705 3300005544 Bacteria 2373
105 Ga0070695_100066171 3300005545 Bacteria 2355
106 Ga0070696_100020424 3300005546 Bacteria 4489
107 Ga0070696_100078823 3300005546 Bacteria 2330
108 Ga0070693_100000504 3300005547 Bacteria 17510
109 Ga0070665_100022919 3300005548 Bacteria 6287
110 Ga0070665_100048285 3300005548 Bacteria 4274
111 Ga0070665_100077514 3300005548 Bacteria 3330
112 Ga0068855_100037224 3300005563 Bacteria 5788
113 Ga0068855_100054373 3300005563 Bacteria 4705
114 Ga0068855_100071753 3300005563 Bacteria 4026
115 Ga0070664_100011139 3300005564 Bacteria 7293
116 Ga0070664_100192926 3300005564 Bacteria 1815
117 Ga0068857_100015976 3300005577 Bacteria 6576
118 Ga0068857_100100816 3300005577 Bacteria 2590
119 Ga0068857_100157621 3300005577 Bacteria 2059
120 Ga0068854_100303853 3300005578 Bacteria 1292
121 Ga0068856_100235986 3300005614 Bacteria 1844
122 Ga0070702_100001498 3300005615 Bacteria 9604
123 Ga0070702_100011472 3300005615 Bacteria 4408
124 Ga0070702_100071073 3300005615 Bacteria 2056
125 Ga0068852_100009488 3300005616 Bacteria 7230
126 Ga0068852_100017625 3300005616 Bacteria 5608
127 Ga0068852_100217905 3300005616 Bacteria 1814
128 Ga0068852_100499569 3300005616 Bacteria 1211
129 Ga0068859_100003597 3300005617 Bacteria 15799
130 Ga0068859_100089140 3300005617 Bacteria 3135
131 Ga0068859_100135666 3300005617 Bacteria 2534
132 Ga0068859_100263663 3300005617 Bacteria 1814
133 Ga0068864_100009197 3300005618 Bacteria 8148
134 Ga0068864_100121343 3300005618 Bacteria 2337
135 Ga0068866_10127336 3300005718 Bacteria 1443
136 Ga0068861_100001217 3300005719 Bacteria 16025
137 Ga0068861_100006430 3300005719 Bacteria 8006
138 Ga0068861_100055309 3300005719 Bacteria 3026
139 Ga0068861_100127696 3300005719 Bacteria 2060
140 Ga0068861_100228484 3300005719 Bacteria 1577
141 Ga0068851_10003950 3300005834 Bacteria 6636
142 Ga0068870_10065744 3300005840 Bacteria 1962
143 Ga0068870_10107721 3300005840 Bacteria 1586
144 Ga0068870_10143385 3300005840 Bacteria 1400
145 Ga0068870_10257245 3300005840 Bacteria 1085
146 Ga0068863_100007337 3300005841 Bacteria 10791
147 Ga0068863_100110383 3300005841 Bacteria 2619
148 Ga0068863_100508747 3300005841 Bacteria 1186
149 Ga0068858_100011539 3300005842 Bacteria 8337
150 Ga0068860_100046709 3300005843 Bacteria 4129
151 Ga0068860_100136610 3300005843 Bacteria 2355
152 Ga0068860_100395254 3300005843 Bacteria 1367
153 Ga0068862_100001606 3300005844 Bacteria 20592
154 Ga0068862_100026099 3300005844 Bacteria 4911
155 Ga0068862_100063736 3300005844 Bacteria 3171
156 Ga0068862_100067541 3300005844 Bacteria 3082
157 Ga0068862_100154238 3300005844 Bacteria 2046
158 Ga0068862_100196520 3300005844 Bacteria 1817
159 Ga0081455_10015974 3300005937 Bacteria 7265
160 Ga0070717_10009899 3300006028 Bacteria 7181
161 Ga0070715_10003409 3300006163 Bacteria 5048
162 Ga0070716_100020502 3300006173 Bacteria 3470
163 Ga0097621_100016127 3300006237 Bacteria 5641
164 Ga0097621_100039375 3300006237 Bacteria 3796
165 Ga0097621_100294428 3300006237 Bacteria 1432
166 Ga0068871_100020125 3300006358 Bacteria 5107
167 Ga0068871_100030159 3300006358 Bacteria 4268
168 Ga0068871_100035081 3300006358 Bacteria 3984
169 Ga0068871_100074983 3300006358 Bacteria 2792
170 Ga0068871_100092495 3300006358 Bacteria 2522
171 Ga0075428_100003303 3300006844 Bacteria 17647
172 Ga0075428_100020291 3300006844 Bacteria 7360
173 Ga0075428_100025211 3300006844 Bacteria 6580
174 Ga0075428_100049414 3300006844 Bacteria 4615
175 Ga0075428_100223370 3300006844 Bacteria 2033
176 Ga0075430_100307186 3300006846 Bacteria 1312
177 Ga0075431_100017299 3300006847 Bacteria 7327
178 Ga0075431_100048587 3300006847 Bacteria 4376
179 Ga0075429_100119406 3300006880 Unclassified 2304
180 Ga0075429_100150025 3300006880 Bacteria 2041
181 Ga0068865_100027585 3300006881 Bacteria 3752
182 Ga0097620_100003597 3300006931 Bacteria 15799
183 Ga0097620_100089140 3300006931 Bacteria 3135
184 Ga0097620_100135664 3300006931 Bacteria 2534
185 Ga0097620_100263644 3300006931 Bacteria 1814
186 Ga0075435_100285679 3300007076 Bacteria 1409
187 Ga0099794_10084887 3300007265 Bacteria 1566
188 Ga0099795_10103035 3300007788 Bacteria 1122
189 Ga0105240_10018717 3300009093 Bacteria 9279
190 Ga0105240_10031534 3300009093 Bacteria 6872
191 Ga0105240_10032411 3300009093 Bacteria 6765
192 Ga0105240_10059277 3300009093 Bacteria 4778
193 Ga0105240_10077096 3300009093 Bacteria 4108
194 Ga0105240_10551249 3300009093 Bacteria 1275
195 Ga0111539_10001996 3300009094 Bacteria 27224
196 Ga0111539_10019788 3300009094 Bacteria 8300
197 Ga0111539_10062598 3300009094 Bacteria 4403
198 Ga0111539_10068098 3300009094 Bacteria 4202
199 Ga0111539_10249267 3300009094 Bacteria 2068
200 Ga0111539_10424544 3300009094 Bacteria 1548
201 Ga0105245_10008314 3300009098 Bacteria 9069
202 Ga0105245_10014927 3300009098 Bacteria 6767
203 Ga0105245_10041211 3300009098 Bacteria 4117
204 Ga0105245_10163880 3300009098 Bacteria 2111
205 Ga0114129_10000119 3300009147 Bacteria 79679
206 Ga0114129_10132976 3300009147 Bacteria 3415
207 Ga0114129_10290637 3300009147 Bacteria 2181
208 Ga0105243_10227806 3300009148 Bacteria 1651
209 Ga0105241_10053078 3300009174 Bacteria 3098
210 Ga0105242_10008595 3300009176 Bacteria 7842
211 Ga0105242_10104813 3300009176 Bacteria 2401
212 Ga0105242_10245385 3300009176 Bacteria 1612
213 Ga0105242_10513007 3300009176 Bacteria 1142
214 Ga0105242_10520280 3300009176 Bacteria 1135
215 Ga0105248_10000727 3300009177 Bacteria 37128
216 Ga0105248_10003684 3300009177 Bacteria 16977
217 Ga0105248_10072235 3300009177 Bacteria 3878
218 Ga0105248_10111424 3300009177 Bacteria 3086
219 Ga0105248_10358811 3300009177 Bacteria 1641
220 Ga0105238_10064267 3300009551 Unclassified 3670
221 Ga0105238_10090406 3300009551 Bacteria 3049
222 Ga0105249_10005523 3300009553 Bacteria 10921
223 Ga0105249_10028206 3300009553 Bacteria 5069
224 Ga0105249_10465213 3300009553 Bacteria 1305
225 Ga0105249_10760827 3300009553 Bacteria 1031
226 Ga0105239_10026216 3300010375 Bacteria 6415
227 Ga0105239_10220386 3300010375 Bacteria 2128
228 Ga0157370_10032801 3300013104 Bacteria 5069
229 Ga0157370_10035052 3300013104 Bacteria 4882
230 Ga0157369_10073817 3300013105 Bacteria 3659
231 Ga0157374_10034082 3300013296 Bacteria 4649
232 Ga0157378_10032183 3300013297 Bacteria 4633
233 Ga0157378_10046012 3300013297 Bacteria 3879
234 Ga0157378_10195450 3300013297 Bacteria 1910
235 Ga0157378_10357171 3300013297 Bacteria 1429
236 Ga0163162_10058487 3300013306 Bacteria 3884
237 Ga0163162_10239280 3300013306 Bacteria 1946
238 Ga0163162_10317730 3300013306 Bacteria 1690
239 Ga0157372_10003333 3300013307 Bacteria 17347
240 Ga0157372_10126793 3300013307 Bacteria 2935
241 Ga0157375_10012059 3300013308 Bacteria 7656
242 Ga0157375_10108894 3300013308 Bacteria 2866
243 Ga0157375_10116171 3300013308 Bacteria 2780
244 Ga0157375_10152967 3300013308 Bacteria 2444
245 Ga0157375_10504804 3300013308 Bacteria 1373
246 Ga0163163_10001047 3300014325 Bacteria 23411
247 Ga0163163_10074496 3300014325 Bacteria 3387
248 Ga0157380_10053038 3300014326 Bacteria 3213
249 Ga0157380_10077734 3300014326 Bacteria 2705
250 Ga0157380_10090743 3300014326 Bacteria 2521
251 Ga0157377_10011176 3300014745 Bacteria 4473
252 Ga0157377_10011647 3300014745 Bacteria 4396
253 Ga0157379_10041949 3300014968 Bacteria 4084
254 Ga0157379_10486771 3300014968 Bacteria 1142
255 Ga0157376_10095720 3300014969 Bacteria 2582
256 Ga0157376_10099981 3300014969 Bacteria 2532
257 Ga0157376_10128947 3300014969 Bacteria 2254
258 Ga0157376_10634714 3300014969 Bacteria 1067
259 Ga0213874_10001624 3300021377 Bacteria 4719
260 Ga0207656_10004676 3300025321 Bacteria 4797
261 Ga0207682_10001366 3300025893 Bacteria 11243
262 Ga0207682_10025686 3300025893 Bacteria 2336
263 Ga0207682_10053069 3300025893 Bacteria 1681
264 Ga0207692_10020211 3300025898 Bacteria 3024
265 Ga0207642_10094728 3300025899 Bacteria 1484
266 Ga0207685_10059528 3300025905 Bacteria 1507
267 Ga0207699_10001279 3300025906 Bacteria 11957
268 Ga0207645_10140526 3300025907 Bacteria 1573
269 Ga0207643_10004162 3300025908 Bacteria 7798
270 Ga0207643_10064766 3300025908 Bacteria 2092
271 Ga0207643_10125141 3300025908 Bacteria 1526
272 Ga0207705_10009000 3300025909 Bacteria 7274
273 Ga0207705_10145506 3300025909 Bacteria 1773
274 Ga0207707_10003060 3300025912 Bacteria 14860
275 Ga0207707_10005387 3300025912 Bacteria 11189
276 Ga0207707_10006617 3300025912 Bacteria 10113
277 Ga0207707_10019124 3300025912 Bacteria 5977
278 Ga0207707_10192834 3300025912 Bacteria 1777
279 Ga0207695_10008030 3300025913 Bacteria 13284
280 Ga0207695_10029475 3300025913 Bacteria 6062
281 Ga0207695_10051105 3300025913 Bacteria 4342
282 Ga0207693_10000554 3300025915 Bacteria 33783
283 Ga0207693_10015825 3300025915 Bacteria 6041
284 Ga0207663_10198430 3300025916 Bacteria 1446
285 Ga0207660_10220249 3300025917 Bacteria 1489
286 Ga0207662_10000322 3300025918 Bacteria 21747
287 Ga0207662_10167957 3300025918 Bacteria 1406
288 Ga0207662_10199924 3300025918 Bacteria 1293
289 Ga0207649_10010382 3300025920 Bacteria 5115
290 Ga0207652_10056903 3300025921 Bacteria 3367
291 Ga0207652_10519467 3300025921 Bacteria 1071
292 Ga0207681_10027340 3300025923 Bacteria 3687
293 Ga0207681_10081120 3300025923 Bacteria 2290
294 Ga0207694_10027126 3300025924 Bacteria 4362
295 Ga0207694_10040407 3300025924 Unclassified 3590
296 Ga0207659_10004413 3300025926 Bacteria 8504
297 Ga0207659_10031025 3300025926 Bacteria 3655
298 Ga0207687_10085070 3300025927 Bacteria 2294
299 Ga0207687_10147150 3300025927 Bacteria 1793
300 Ga0207700_10035505 3300025928 Bacteria 3592
301 Ga0207700_10087505 3300025928 Bacteria 2450
302 Ga0207664_10015382 3300025929 Bacteria 5551
303 Ga0207664_10023059 3300025929 Bacteria 4658
304 Ga0207664_10176497 3300025929 Bacteria 1832
305 Ga0207644_10040950 3300025931 Bacteria 3275
306 Ga0207690_10066080 3300025932 Bacteria 2476
307 Ga0207706_10001648 3300025933 Bacteria 22109
308 Ga0207706_10296237 3300025933 Bacteria 1410
309 Ga0207686_10185195 3300025934 Bacteria 1480
310 Ga0207709_10274571 3300025935 Bacteria 1242
311 Ga0207709_10432773 3300025935 Bacteria 1013
312 Ga0207670_10002460 3300025936 Bacteria 9714
313 Ga0207670_10040465 3300025936 Bacteria 3059
314 Ga0207670_10220936 3300025936 Bacteria 1450
315 Ga0207669_10074999 3300025937 Bacteria 2142
316 Ga0207669_10098498 3300025937 Bacteria 1925
317 Ga0207669_10482435 3300025937 Bacteria 988
318 Ga0207704_10012029 3300025938 Bacteria 4282
319 Ga0207704_10022199 3300025938 Bacteria 3395
320 Ga0207704_10392162 3300025938 Bacteria 1093
321 Ga0207665_10002548 3300025939 Bacteria 12244
322 Ga0207665_10023177 3300025939 Bacteria 4089
323 Ga0207691_10005142 3300025940 Bacteria 12631
324 Ga0207691_10005505 3300025940 Bacteria 12237
325 Ga0207691_10008332 3300025940 Bacteria 9956
326 Ga0207691_10020883 3300025940 Bacteria 6188
327 Ga0207691_10043494 3300025940 Bacteria 4140
328 Ga0207691_10101988 3300025940 Bacteria 2560
329 Ga0207691_10140642 3300025940 Bacteria 2127
330 Ga0207691_10154104 3300025940 Bacteria 2019
331 Ga0207711_10021128 3300025941 Bacteria 5437
332 Ga0207711_10057978 3300025941 Bacteria 3330
333 Ga0207689_10010211 3300025942 Bacteria 8091
334 Ga0207689_10046349 3300025942 Bacteria 3593
335 Ga0207689_10049626 3300025942 Bacteria 3462
336 Ga0207689_10050971 3300025942 Bacteria 3412
337 Ga0207661_10046440 3300025944 Bacteria 3444
338 Ga0207661_10273689 3300025944 Bacteria 1507
339 Ga0207667_10009762 3300025949 Bacteria 11287
340 Ga0207667_10049378 3300025949 Bacteria 4444
341 Ga0207667_10060845 3300025949 Bacteria 3952
342 Ga0207651_10068885 3300025960 Bacteria 2496
343 Ga0207651_10154617 3300025960 Bacteria 1790
344 Ga0207651_10239205 3300025960 Bacteria 1479
345 Ga0207651_10513082 3300025960 Bacteria 1038
346 Ga0207712_10011818 3300025961 Bacteria 5567
347 Ga0207712_10066661 3300025961 Bacteria 2574
348 Ga0207712_10276570 3300025961 Bacteria 1368
349 Ga0207668_10033548 3300025972 Bacteria 3401
350 Ga0207668_10038018 3300025972 Bacteria 3226
351 Ga0207640_10329592 3300025981 Bacteria 1219
352 Ga0207658_10024087 3300025986 Bacteria 4254
353 Ga0207677_10054779 3300026023 Bacteria 2724
354 Ga0207677_10758664 3300026023 Bacteria 865
355 Ga0207703_10006999 3300026035 Bacteria 8975
356 Ga0207703_10050035 3300026035 Bacteria 3380
357 Ga0207703_10077691 3300026035 Bacteria 2756
358 Ga0207639_10038920 3300026041 Bacteria 3540
359 Ga0207708_10005541 3300026075 Bacteria 9315
360 Ga0207708_10029898 3300026075 Bacteria 4131
361 Ga0207708_10087068 3300026075 Bacteria 2404
362 Ga0207708_10200799 3300026075 Bacteria 1591
363 Ga0207708_10242593 3300026075 Bacteria 1450
364 Ga0207708_10393083 3300026075 Bacteria 1145
365 Ga0207702_10143995 3300026078 Bacteria 2160
366 Ga0207702_10444178 3300026078 Bacteria 1257
367 Ga0207641_10017045 3300026088 Bacteria 5945
368 Ga0207641_10020331 3300026088 Bacteria 5452
369 Ga0207641_10161981 3300026088 Bacteria 2034
370 Ga0207641_10296761 3300026088 Bacteria 1525
371 Ga0207648_10004602 3300026089 Bacteria 14144
372 Ga0207648_10022150 3300026089 Bacteria 5708
373 Ga0207648_10065638 3300026089 Bacteria 3164
374 Ga0207648_10110796 3300026089 Bacteria 2410
375 Ga0207676_10004981 3300026095 Bacteria 9409
376 Ga0207676_10023885 3300026095 Bacteria 4518
377 Ga0207676_10129285 3300026095 Bacteria 2145
378 Ga0207674_10008592 3300026116 Bacteria 11771
379 Ga0207674_10017634 3300026116 Bacteria 7786
380 Ga0207674_10168430 3300026116 Bacteria 2144
381 Ga0207675_100003023 3300026118 Bacteria 16499
382 Ga0207675_100009362 3300026118 Bacteria 9181
383 Ga0207675_100028532 3300026118 Bacteria 5197
384 Ga0207675_100032704 3300026118 Bacteria 4845
385 Ga0207675_100100598 3300026118 Bacteria 2723
386 Ga0207675_100122531 3300026118 Bacteria 2461
387 Ga0207675_100563705 3300026118 Bacteria 1139
388 Ga0207683_10028583 3300026121 Bacteria 4823
389 Ga0207683_10104367 3300026121 Bacteria 2533
390 Ga0207698_10000189 3300026142 Bacteria 38225
391 Ga0207698_10002817 3300026142 Bacteria 10403
392 Ga0207698_10009215 3300026142 Bacteria 6281
393 Ga0209974_10000662 3300027876 Bacteria 11657
394 Ga0207428_10002795 3300027907 Bacteria 17332
395 Ga0207428_10009507 3300027907 Bacteria 8707
396 Ga0207428_10029202 3300027907 Bacteria 4574
397 Ga0207428_10252760 3300027907 Bacteria 1314
398 Ga0265354_1001125 3300028016 Bacteria 4095
399 Ga0268266_10057881 3300028379 Bacteria 3336
400 Ga0268266_10061957 3300028379 Bacteria 3227
401 Ga0268265_10001347 3300028380 Bacteria 20929
402 Ga0268265_10010309 3300028380 Bacteria 6309
403 Ga0268265_10078204 3300028380 Bacteria 2601
404 Ga0268265_10147675 3300028380 Bacteria 1978
405 Ga0268264_10034912 3300028381 Bacteria 4139
406 Ga0268264_10177489 3300028381 Bacteria 1931
407 Ga0307515_10096284 3300028794 Bacteria 3632
408 Ga0265762_1023182 3300030760 Bacteria 1150
409 Ga0265770_1000303 3300030878 Bacteria 6670
410 Ga0265760_10000729 3300031090 Bacteria 9376
411 Ga0307513_10013964 3300031456 Bacteria 9841
412 Ga0307513_10029914 3300031456 Bacteria 6194
413 Ga0307513_10041836 3300031456 Bacteria 5052
414 Ga0307513_10045329 3300031456 Bacteria 4807
415 Ga0307509_10077842 3300031507 Bacteria 3439
416 Ga0307408_100019409 3300031548 Bacteria 4578
417 Ga0307408_100049044 3300031548 Bacteria 3031
418 Ga0307408_100050815 3300031548 Bacteria 2983
419 Ga0307408_100103137 3300031548 Bacteria 2177
420 Ga0307408_100275418 3300031548 Bacteria 1399
421 Ga0265313_10124434 3300031595 Bacteria 1122
422 Ga0307405_10035488 3300031731 Bacteria 2978
423 Ga0307405_10112223 3300031731 Bacteria 1849
424 Ga0307413_10009445 3300031824 Bacteria 4670
425 Ga0307413_10020240 3300031824 Bacteria 3534
426 Ga0307410_10010481 3300031852 Bacteria 5252
427 Ga0307410_10027077 3300031852 Bacteria 3619
428 Ga0307410_10520538 3300031852 Bacteria 981
429 Ga0307406_10011667 3300031901 Bacteria 4988
430 Ga0307406_10025224 3300031901 Bacteria 3557
431 Ga0307407_10008414 3300031903 Bacteria 4734
432 Ga0307407_10012375 3300031903 Bacteria 4098
433 Ga0307407_10029088 3300031903 Bacteria 2963
434 Ga0307407_10251164 3300031903 Bacteria 1212
435 Ga0307412_10086071 3300031911 Unclassified 2186
436 Ga0307409_100004427 3300031995 Bacteria 7890
437 Ga0307409_100030472 3300031995 Bacteria 3876
438 Ga0307409_100094227 3300031995 Bacteria 2463
439 Ga0307416_100005134 3300032002 Bacteria 7996
440 Ga0307416_100007315 3300032002 Bacteria 7006
441 Ga0307416_100216640 3300032002 Bacteria 1832
442 Ga0307416_100426193 3300032002 Bacteria 1372
443 Ga0307414_10058712 3300032004 Bacteria 2712
444 Ga0307411_10009093 3300032005 Bacteria 5199
445 Ga0307411_10041939 3300032005 Bacteria 2916
446 Ga0307415_100009681 3300032126 Bacteria 5420
447 Ga0307415_100025640 3300032126 Bacteria 3704
448 Ga0373934_0128911 3300035086 Bacteria 1031
449 Ga0373932_0038985 3300035112 Bacteria 1361
450 Ga0373955_0062540 3300035172 Bacteria 2059
451 Ga0373927_0011405 3300035695 Bacteria 5921
452 Ga0373937_0003589 3300036401 Bacteria 13083
453 Ga0373937_0004573 3300036401 Bacteria 11734
454 Ga0373937_0126210 3300036401 Bacteria 2387
455 Ga0373925_0368707 3300037068 Bacteria 1168
456 Ga0395900_0032252 3300037418 Bacteria 5386
457 Ga0395898_0021580 3300037466 Bacteria 6527
458 Ga0395898_0469991 3300037466 Bacteria 1197
459 Ga0395905_0073993 3300037471 Bacteria 3193
460 Ga0436365_1297074 3300039437 Bacteria 5524
461 Ga0436365_1362228 3300039437 Bacteria 1051
462 Ga0436360_0724998 3300039438 Bacteria 1844
463 Ga0436360_1359960 3300039438 Bacteria 5909
464 Ga0436361_0338729 3300039447 Bacteria 4469
465 Ga0436361_0932302 3300039447 Unclassified 1124
466 Ga0436363_0380642 3300039450 Unclassified 1482
467 Ga0436363_0494610 3300039450 Bacteria 11729
468 Ga0436363_0625596 3300039450 Bacteria 4144
469 Ga0436362_0718401 3300039453 Bacteria 2868
470 Ga0451789_0524200 3300041443 Bacteria 3222
471 Ga0451791_0834899 3300041451 Bacteria 2634
472 Ga0451797_0493216 3300041453 Bacteria 1535
473 Ga0451800_0354156 3300041459 Bacteria 2050
474 Ga0451800_1642616 3300041459 Bacteria 1195
475 Ga0451802_1134248 3300041460 Bacteria 1472
476 Ga0451807_0271153 3300041486 Bacteria 5122
477 Ga0451807_0568058 3300041486 Bacteria 2713
478 Ga0451807_1014662 3300041486 Bacteria 2858
479 Ga0451807_1089986 3300041486 Bacteria 1765
480 Ga0451853_0795246 3300041512 Bacteria 1593
481 Ga0451853_1658266 3300041512 Bacteria 1289
482 Ga0439464_0026563 3300042439 Bacteria 1607
483 Ga0466969_0030744 3300044656 Bacteria 2735
484 Ga0466966_0027311 3300044684 Bacteria 3722
485 Ga0466961_0031475 3300044693 Bacteria 3410
486 Ga0466961_0214628 3300044693 Unclassified 1187
487 Ga0466964_0017284 3300044706 Bacteria 2759
488 Ga0466957_0012552 3300044842 Unclassified 4904
489 Ga0466959_0028752 3300045049 Bacteria 4120
490 Ga0466959_0079056 3300045049 Unclassified 2372
491 Ga0466959_0182720 3300045049 Bacteria 1466
492 Ga0451576_0020370 3300045051 Bacteria 7224
493 Ga0466958_0004890 3300045836 Bacteria 7137
494 Ga0466958_0095720 3300045836 Bacteria 1841
495 Ga0466958_0266874 3300045836 Unclassified 1096
496 Ga0495592_0025883 3300046454 Bacteria 4453
497 Ga0495590_0005899 3300046457 Bacteria 4806
498 Ga0495629_0287692 3300046459 Bacteria 1127
499 Ga0495638_0037057 3300046460 Bacteria 3104
500 Ga0495580_0000258 3300046472 Bacteria 42219
501 Ga0495582_0178959 3300046473 Bacteria 1208
502 Ga0495616_0001136 3300046513 Bacteria 18848
503 Ga0495630_0054089 3300046517 Bacteria 3007
504 Ga0495632_0038552 3300046519 Bacteria 2419
505 Ga0495587_0002229 3300046536 Bacteria 12956
506 Ga0495587_0010176 3300046536 Bacteria 5998
507 Ga0495645_0000294 3300046543 Bacteria 36636
508 Ga0495667_0005099 3300046559 Bacteria 8874
509 Ga0495625_0005483 3300046660 Bacteria 11556
510 Ga0495625_0035204 3300046660 Bacteria 3692
511 Ga0495635_0040682 3300046663 Bacteria 3212
512 Ga0495657_0097485 3300046675 Bacteria 1877
513 Ga0495599_0001284 3300046678 Bacteria 14260
514 Ga0495623_0020732 3300046679 Bacteria 4248
515 Ga0495623_0152342 3300046679 Bacteria 1366
516 Ga0495649_0139724 3300046694 Bacteria 1275
517 Ga0495600_0106241 3300046809 Bacteria 1829
518 Ga0495604_0063761 3300047317 Bacteria 2810
519 Ga0495604_0192267 3300047317 Bacteria 1421
520 Ga0495674_0072898 3300047319 Bacteria 2961
521 Ga0495684_0011117 3300047471 Bacteria 6959
522 Ga0495602_0130674 3300048088 Bacteria 2004
523 Ga0496100_0035938 3300048903 Bacteria 3120
524 Ga0496100_0144364 3300048903 Bacteria 1691
525 Ga0496102_0012785 3300048905 Bacteria 7267
526 Ga0496102_0127792 3300048905 Bacteria 2377
527 Ga0496103_0059343 3300048906 Bacteria 2377
528 Ga0496104_0012754 3300048907 Bacteria 7572
529 Ga0496104_0092943 3300048907 Bacteria 2884
530 Ga0496105_0005317 3300048908 Bacteria 9757
531 Ga0496105_0032926 3300048908 Bacteria 4254
532 Ga0496107_0324218 3300048910 Bacteria 1146
533 Ga0496108_0096264 3300048911 Bacteria 2521
534 Ga0496109_0050787 3300048912 Bacteria 3776
535 Ga0496110_0022135 3300048913 Bacteria 5393
536 Ga0496110_0041295 3300048913 Bacteria 4024
537 Ga0496110_0519934 3300048913 Bacteria 1083
538 Ga0496111_0184440 3300048914 Bacteria 1551
539 Ga0496112_0131635 3300048915 Bacteria 2472
540 Ga0496112_0339364 3300048915 Bacteria 1446
541 Ga0496113_0293153 3300048916 Bacteria 1302
542 Ga0496114_0004286 3300048917 Bacteria 11042
543 Ga0496114_0243734 3300048917 Bacteria 1581
544 Ga0496115_0028254 3300048918 Bacteria 4395
545 Ga0496115_0051900 3300048918 Bacteria 3288
546 Ga0496115_0438940 3300048918 Bacteria 1056
547 Ga0496118_0022504 3300048921 Bacteria 5507
548 Ga0496126_0284136 3300048929 Unclassified 1370
549 Ga0501299_013522 3300049522 Bacteria 1409
550 Ga0501032_0373932 3300049569 Bacteria 917
551 Ga0501039_0145630 3300049575 Bacteria 1862
552 Ga0501042_0014091 3300049578 Bacteria 5452
553 Ga0501068_0025220 3300049584 Bacteria 3497
554 Ga0501068_0141037 3300049584 Bacteria 1511
555 Ga0501071_0085395 3300049587 Bacteria 2314
556 Ga0501071_0097097 3300049587 Bacteria 2169
557 Ga0501075_0119053 3300049591 Bacteria 2009
558 Ga0501076_0110849 3300049592 Archaea 2218
559 Ga0501249_011311 3300049679 Bacteria 1872
560 Ga0501080_0220809 3300049742 Bacteria 1734
561 nmdc:mga0k408_13910_c1 3300050493 Bacteria 4422
562 nmdc:mga05p37_119300_c1 3300050507 Bacteria 3241
563 nmdc:mga05p37_156302_c1 3300050507 Unclassified 2787
564 nmdc:mga09592_15564_c1 3300050508 Bacteria 6216
565 nmdc:mga09592_15779_c1 3300050508 Bacteria 6172
566 nmdc:mga09592_164138_c1 3300050508 Bacteria 1919
567 nmdc:mga0qj67_23257_c1 3300050509 Bacteria 4765
568 nmdc:mga0qj67_79959_c1 3300050509 Unclassified 2619
569 nmdc:mga06r32_13403_c1 3300050510 Bacteria 7424
570 nmdc:mga06r32_3098_c1 3300050510 Bacteria 14891
571 nmdc:mga06r32_91014_c1 3300050510 Unclassified 2981
572 nmdc:mga08y16_213716_c1 3300050511 Bacteria 1997
573 nmdc:mga08y16_42298_c1 3300050511 Bacteria 4772
574 nmdc:mga08y16_50531_c1 3300050511 Bacteria 4351
575 nmdc:mga08y16_55407_c1 3300050511 Bacteria 4143
576 nmdc:mga08y16_6313_c1 3300050511 Bacteria 12430
577 nmdc:mga08y16_733945_c1 3300050511 Bacteria 985
578 nmdc:mga08y16_97862_c1 3300050511 Bacteria 3056
579 nmdc:mga0rr50_461789_c1 3300050513 Bacteria 1077
580 nmdc:mga0rr50_520476_c1 3300050513 Bacteria 1012
581 nmdc:mga08x19_244591_c1 3300050514 Bacteria 1237
582 nmdc:mga0a205_123075_c1 3300050515 Bacteria 2493
583 nmdc:mga0a205_92215_c1 3300050515 Bacteria 2927
584 Ga0495619_0005607 3300053085 Bacteria 7964
585 Ga0500637_0027094 3300053178 Bacteria 3162
586 Ga0501084_0073208 3300054114 Bacteria 2869
587 Ga0466962_0008386 3300061719 Bacteria 4952
588 Ga0530510_0199181 3300061734 Bacteria 1487
589 Ga0395898_0001593
590 rootH2_10286308
591 Ga0065712_10002825
592 Ga0070658_10138963
593 Ga0070676_10041335
594 Ga0070676_10156994
595 Ga0070690_100001193
596 Ga0070690_100009413
597 Ga0070670_100075272
598 Ga0070677_10179658
599 Ga0068869_100005130
600 Ga0068869_100101461
601 Ga0068869_100114644
602 Ga0070680_100037132
603 Ga0070682_100050890
604 Ga0070682_100359217
605 Ga0068868_100035619
606 Ga0070660_100126280
607 Ga0070660_100284971
608 Ga0070689_100000744
609 Ga0070689_100005848
610 Ga0070689_100033118
611 Ga0070689_100321052
612 Ga0070687_100032722
613 Ga0070687_100036858
614 Ga0070661_100003996
615 Ga0070661_100100745
616 Ga0070668_100028604
617 Ga0070668_100077843
618 Ga0070668_100534303
619 Ga0070669_100039703
620 Ga0070669_100127768
621 Ga0070669_100630214
622 Ga0070675_100000303
623 Ga0070675_100044344
624 Ga0070675_100281910
625 Ga0070675_100322204
626 Ga0070671_100026469
627 Ga0070671_100030627
628 Ga0070674_100019263
629 Ga0070674_100026695
630 Ga0070674_100039433
631 Ga0070674_100064222
632 Ga0070673_100004018
633 Ga0070673_100007311
634 Ga0070673_100187099
635 Ga0070688_100005357
636 Ga0070688_100008979
637 Ga0070688_100030550
638 Ga0070659_100097320
639 Ga0070667_100066519
640 Ga0070667_100269613
641 Ga0070709_10030008
642 Ga0070709_10092717
643 Ga0070714_100020221
644 Ga0070714_100024800
645 Ga0070714_100185763
646 Ga0070713_100057818
647 Ga0070713_100061756
648 Ga0070713_100077380
649 Ga0070710_10014997
650 Ga0070701_10064637
651 Ga0070701_10171144
652 Ga0070711_100009230
653 Ga0070711_100102890
654 Ga0070711_100313113
655 Ga0070705_100004251
656 Ga0070705_100013904
657 Ga0070700_100024645
658 Ga0070700_100081143
659 Ga0070700_100271370
660 Ga0070700_100456881
661 Ga0070663_100042205
662 Ga0070678_100016552
663 Ga0070678_100087717
664 Ga0070678_100533879
665 Ga0070662_100027975
666 Ga0070662_100047451
667 Ga0070681_10001993
668 Ga0070681_10010855
669 Ga0070681_10011868
670 Ga0070681_10043958
671 Ga0070681_10176242
672 Ga0068867_100002538
673 Ga0068867_100336960
674 Ga0068867_100623104
675 Ga0070685_10015457
676 Ga0070685_10245861
677 Ga0070699_100314663
678 Ga0070679_100030604
679 Ga0070679_100105539
680 Ga0070679_100627278
681 Ga0070684_100000338
682 Ga0068853_100045423
683 Ga0070672_100009812
684 Ga0070672_100011114
685 Ga0070672_100045404
686 Ga0070672_100090356
687 Ga0070672_100110918
688 Ga0070672_100127783
689 Ga0070672_100465374
690 Ga0070686_100000735
691 Ga0070686_100026243
692 Ga0070686_100064705
693 Ga0070695_100066171
694 Ga0070696_100020424
695 Ga0070696_100078823
696 Ga0070693_100000504
697 Ga0070665_100022919
698 Ga0070665_100048285
699 Ga0070665_100077514
700 Ga0068855_100037224
701 Ga0068855_100054373
702 Ga0068855_100071753
703 Ga0070664_100011139
704 Ga0070664_100192926
705 Ga0068857_100015976
706 Ga0068857_100100816
707 Ga0068857_100157621
708 Ga0068854_100303853
709 Ga0068856_100235986
710 Ga0070702_100001498
711 Ga0070702_100011472
712 Ga0070702_100071073
713 Ga0068852_100009488
714 Ga0068852_100017625
715 Ga0068852_100217905
716 Ga0068852_100499569
717 Ga0068859_100003597
718 Ga0068859_100089140
719 Ga0068859_100135666
720 Ga0068859_100263663
721 Ga0068864_100009197
722 Ga0068864_100121343
723 Ga0068866_10127336
724 Ga0068861_100001217
725 Ga0068861_100006430
726 Ga0068861_100055309
727 Ga0068861_100127696
728 Ga0068861_100228484
729 Ga0068851_10003950
730 Ga0068870_10065744
731 Ga0068870_10107721
732 Ga0068870_10143385
733 Ga0068870_10257245
734 Ga0068863_100007337
735 Ga0068863_100110383
736 Ga0068863_100508747
737 Ga0068858_100011539
738 Ga0068860_100046709
739 Ga0068860_100136610
740 Ga0068860_100395254
741 Ga0068862_100001606
742 Ga0068862_100026099
743 Ga0068862_100063736
744 Ga0068862_100067541
745 Ga0068862_100154238
746 Ga0068862_100196520
747 Ga0081455_10015974
748 Ga0070717_10009899
749 Ga0070715_10003409
750 Ga0070716_100020502
751 Ga0097621_100016127
752 Ga0097621_100039375
753 Ga0097621_100294428
754 Ga0068871_100020125
755 Ga0068871_100030159
756 Ga0068871_100035081
757 Ga0068871_100074983
758 Ga0068871_100092495
759 Ga0075428_100003303
760 Ga0075428_100020291
761 Ga0075428_100025211
762 Ga0075428_100049414
763 Ga0075428_100223370
764 Ga0075430_100307186
765 Ga0075431_100017299
766 Ga0075431_100048587
767 Ga0075429_100119406
768 Ga0075429_100150025
769 Ga0068865_100027585
770 Ga0097620_100003597
771 Ga0097620_100089140
772 Ga0097620_100135664
773 Ga0097620_100263644
774 Ga0075435_100285679
775 Ga0099794_10084887
776 Ga0099795_10103035
777 Ga0105240_10018717
778 Ga0105240_10031534
779 Ga0105240_10032411
780 Ga0105240_10059277
781 Ga0105240_10077096
782 Ga0105240_10551249
783 Ga0111539_10001996
784 Ga0111539_10019788
785 Ga0111539_10062598
786 Ga0111539_10068098
787 Ga0111539_10249267
788 Ga0111539_10424544
789 Ga0105245_10008314
790 Ga0105245_10014927
791 Ga0105245_10041211
792 Ga0105245_10163880
793 Ga0114129_10000119
794 Ga0114129_10132976
795 Ga0114129_10290637
796 Ga0105243_10227806
797 Ga0105241_10053078
798 Ga0105242_10008595
799 Ga0105242_10104813
800 Ga0105242_10245385
801 Ga0105242_10513007
802 Ga0105242_10520280
803 Ga0105248_10000727
804 Ga0105248_10003684
805 Ga0105248_10072235
806 Ga0105248_10111424
807 Ga0105248_10358811
808 Ga0105238_10064267
809 Ga0105238_10090406
810 Ga0105249_10005523
811 Ga0105249_10028206
812 Ga0105249_10465213
813 Ga0105249_10760827
814 Ga0105239_10026216
815 Ga0105239_10220386
816 Ga0157370_10032801
817 Ga0157370_10035052
818 Ga0157369_10073817
819 Ga0157374_10034082
820 Ga0157378_10032183
821 Ga0157378_10046012
822 Ga0157378_10195450
823 Ga0157378_10357171
824 Ga0163162_10058487
825 Ga0163162_10239280
826 Ga0163162_10317730
827 Ga0157372_10003333
828 Ga0157372_10126793
829 Ga0157375_10012059
830 Ga0157375_10108894
831 Ga0157375_10116171
832 Ga0157375_10152967
833 Ga0157375_10504804
834 Ga0163163_10001047
835 Ga0163163_10074496
836 Ga0157380_10053038
837 Ga0157380_10077734
838 Ga0157380_10090743
839 Ga0157377_10011176
840 Ga0157377_10011647
841 Ga0157379_10041949
842 Ga0157379_10486771
843 Ga0157376_10095720
844 Ga0157376_10099981
845 Ga0157376_10128947
846 Ga0157376_10634714
847 Ga0213874_10001624
848 Ga0207656_10004676
849 Ga0207682_10001366
850 Ga0207682_10025686
851 Ga0207682_10053069
852 Ga0207692_10020211
853 Ga0207642_10094728
854 Ga0207685_10059528
855 Ga0207699_10001279
856 Ga0207645_10140526
857 Ga0207643_10004162
858 Ga0207643_10064766
859 Ga0207643_10125141
860 Ga0207705_10009000
861 Ga0207705_10145506
862 Ga0207707_10003060
863 Ga0207707_10005387
864 Ga0207707_10006617
865 Ga0207707_10019124
866 Ga0207707_10192834
867 Ga0207695_10008030
868 Ga0207695_10029475
869 Ga0207695_10051105
870 Ga0207693_10000554
871 Ga0207693_10015825
872 Ga0207663_10198430
873 Ga0207660_10220249
874 Ga0207662_10000322
875 Ga0207662_10167957
876 Ga0207662_10199924
877 Ga0207649_10010382
878 Ga0207652_10056903
879 Ga0207652_10519467
880 Ga0207681_10027340
881 Ga0207681_10081120
882 Ga0207694_10027126
883 Ga0207694_10040407
884 Ga0207659_10004413
885 Ga0207659_10031025
886 Ga0207687_10085070
887 Ga0207687_10147150
888 Ga0207700_10035505
889 Ga0207700_10087505
890 Ga0207664_10015382
891 Ga0207664_10023059
892 Ga0207664_10176497
893 Ga0207644_10040950
894 Ga0207690_10066080
895 Ga0207706_10001648
896 Ga0207706_10296237
897 Ga0207686_10185195
898 Ga0207709_10274571
899 Ga0207709_10432773
900 Ga0207670_10002460
901 Ga0207670_10040465
902 Ga0207670_10220936
903 Ga0207669_10074999
904 Ga0207669_10098498
905 Ga0207669_10482435
906 Ga0207704_10012029
907 Ga0207704_10022199
908 Ga0207704_10392162
909 Ga0207665_10002548
910 Ga0207665_10023177
911 Ga0207691_10005142
912 Ga0207691_10005505
913 Ga0207691_10008332
914 Ga0207691_10020883
915 Ga0207691_10043494
916 Ga0207691_10101988
917 Ga0207691_10140642
918 Ga0207691_10154104
919 Ga0207711_10021128
920 Ga0207711_10057978
921 Ga0207689_10010211
922 Ga0207689_10046349
923 Ga0207689_10049626
924 Ga0207689_10050971
925 Ga0207661_10046440
926 Ga0207661_10273689
927 Ga0207667_10009762
928 Ga0207667_10049378
929 Ga0207667_10060845
930 Ga0207651_10068885
931 Ga0207651_10154617
932 Ga0207651_10239205
933 Ga0207651_10513082
934 Ga0207712_10011818
935 Ga0207712_10066661
936 Ga0207712_10276570
937 Ga0207668_10033548
938 Ga0207668_10038018
939 Ga0207640_10329592
940 Ga0207658_10024087
941 Ga0207677_10054779
942 Ga0207677_10758664
943 Ga0207703_10006999
944 Ga0207703_10050035
945 Ga0207703_10077691
946 Ga0207639_10038920
947 Ga0207708_10005541
948 Ga0207708_10029898
949 Ga0207708_10087068
950 Ga0207708_10200799
951 Ga0207708_10242593
952 Ga0207708_10393083
953 Ga0207702_10143995
954 Ga0207702_10444178
955 Ga0207641_10017045
956 Ga0207641_10020331
957 Ga0207641_10161981
958 Ga0207641_10296761
959 Ga0207648_10004602
960 Ga0207648_10022150
961 Ga0207648_10065638
962 Ga0207648_10110796
963 Ga0207676_10004981
964 Ga0207676_10023885
965 Ga0207676_10129285
966 Ga0207674_10008592
967 Ga0207674_10017634
968 Ga0207674_10168430
969 Ga0207675_100003023
970 Ga0207675_100009362
971 Ga0207675_100028532
972 Ga0207675_100032704
973 Ga0207675_100100598
974 Ga0207675_100122531
975 Ga0207675_100563705
976 Ga0207683_10028583
977 Ga0207683_10104367
978 Ga0207698_10000189
979 Ga0207698_10002817
980 Ga0207698_10009215
981 Ga0209974_10000662
982 Ga0207428_10002795
983 Ga0207428_10009507
984 Ga0207428_10029202
985 Ga0207428_10252760
986 Ga0265354_1001125
987 Ga0268266_10057881
988 Ga0268266_10061957
989 Ga0268265_10001347
990 Ga0268265_10010309
991 Ga0268265_10078204
992 Ga0268265_10147675
993 Ga0268264_10034912
994 Ga0268264_10177489
995 Ga0307515_10096284
996 Ga0265762_1023182
997 Ga0265770_1000303
998 Ga0265760_10000729
999 Ga0307513_10013964
1000 Ga0307513_10029914
1001 Ga0307513_10041836
1002 Ga0307513_10045329
1003 Ga0307509_10077842
1004 Ga0307408_100019409
1005 Ga0307408_100049044
1006 Ga0307408_100050815
1007 Ga0307408_100103137
1008 Ga0307408_100275418
1009 Ga0265313_10124434
1010 Ga0307405_10035488
1011 Ga0307405_10112223
1012 Ga0307413_10009445
1013 Ga0307413_10020240
1014 Ga0307410_10010481
1015 Ga0307410_10027077
1016 Ga0307410_10520538
1017 Ga0307406_10011667
1018 Ga0307406_10025224
1019 Ga0307407_10008414
1020 Ga0307407_10012375
1021 Ga0307407_10029088
1022 Ga0307407_10251164
1023 Ga0307412_10086071
1024 Ga0307409_100004427
1025 Ga0307409_100030472
1026 Ga0307409_100094227
1027 Ga0307416_100005134
1028 Ga0307416_100007315
1029 Ga0307416_100216640
1030 Ga0307416_100426193
1031 Ga0307414_10058712
1032 Ga0307411_10009093
1033 Ga0307411_10041939
1034 Ga0307415_100009681
1035 Ga0307415_100025640
1036 Ga0373934_0128911
1037 Ga0373932_0038985
1038 Ga0373955_0062540
1039 Ga0373927_0011405
1040 Ga0373937_0003589
1041 Ga0373937_0004573
1042 Ga0373937_0126210
1043 Ga0373925_0368707
1044 Ga0395900_0032252
1045 Ga0395898_0021580
1046 Ga0395898_0469991
1047 Ga0395905_0073993
1048 Ga0436365_1297074
1049 Ga0436365_1362228
1050 Ga0436360_0724998
1051 Ga0436360_1359960
1052 Ga0436361_0338729
1053 Ga0436361_0932302
1054 Ga0436363_0380642
1055 Ga0436363_0494610
1056 Ga0436363_0625596
1057 Ga0436362_0718401
1058 Ga0451789_0524200
1059 Ga0451791_0834899
1060 Ga0451797_0493216
1061 Ga0451800_0354156
1062 Ga0451800_1642616
1063 Ga0451802_1134248
1064 Ga0451807_0271153
1065 Ga0451807_0568058
1066 Ga0451807_1014662
1067 Ga0451807_1089986
1068 Ga0451853_0795246
1069 Ga0451853_1658266
1070 Ga0439464_0026563
1071 Ga0466969_0030744
1072 Ga0466966_0027311
1073 Ga0466961_0031475
1074 Ga0466961_0214628
1075 Ga0466964_0017284
1076 Ga0466957_0012552
1077 Ga0466959_0028752
1078 Ga0466959_0079056
1079 Ga0466959_0182720
1080 Ga0451576_0020370
1081 Ga0466958_0004890
1082 Ga0466958_0095720
1083 Ga0466958_0266874
1084 Ga0495592_0025883
1085 Ga0495590_0005899
1086 Ga0495629_0287692
1087 Ga0495638_0037057
1088 Ga0495580_0000258
1089 Ga0495582_0178959
1090 Ga0495616_0001136
1091 Ga0495630_0054089
1092 Ga0495632_0038552
1093 Ga0495587_0002229
1094 Ga0495587_0010176
1095 Ga0495645_0000294
1096 Ga0495667_0005099
1097 Ga0495625_0005483
1098 Ga0495625_0035204
1099 Ga0495635_0040682
1100 Ga0495657_0097485
1101 Ga0495599_0001284
1102 Ga0495623_0020732
1103 Ga0495623_0152342
1104 Ga0495649_0139724
1105 Ga0495600_0106241
1106 Ga0495604_0063761
1107 Ga0495604_0192267
1108 Ga0495674_0072898
1109 Ga0495684_0011117
1110 Ga0495602_0130674
1111 Ga0496100_0035938
1112 Ga0496100_0144364
1113 Ga0496102_0012785
1114 Ga0496102_0127792
1115 Ga0496103_0059343
1116 Ga0496104_0012754
1117 Ga0496104_0092943
1118 Ga0496105_0005317
1119 Ga0496105_0032926
1120 Ga0496107_0324218
1121 Ga0496108_0096264
1122 Ga0496109_0050787
1123 Ga0496110_0022135
1124 Ga0496110_0041295
1125 Ga0496110_0519934
1126 Ga0496111_0184440
1127 Ga0496112_0131635
1128 Ga0496112_0339364
1129 Ga0496113_0293153
1130 Ga0496114_0004286
1131 Ga0496114_0243734
1132 Ga0496115_0028254
1133 Ga0496115_0051900
1134 Ga0496115_0438940
1135 Ga0496118_0022504
1136 Ga0496126_0284136
1137 Ga0501299_013522
1138 Ga0501032_0373932
1139 Ga0501039_0145630
1140 Ga0501042_0014091
1141 Ga0501068_0025220
1142 Ga0501068_0141037
1143 Ga0501071_0085395
1144 Ga0501071_0097097
1145 Ga0501075_0119053
1146 Ga0501076_0110849
1147 Ga0501249_011311
1148 Ga0501080_0220809
1149 nmdc:mga0k408_13910_c1
1150 nmdc:mga05p37_119300_c1
1151 nmdc:mga05p37_156302_c1
1152 nmdc:mga09592_15564_c1
1153 nmdc:mga09592_15779_c1
1154 nmdc:mga09592_164138_c1
1155 nmdc:mga0qj67_23257_c1
1156 nmdc:mga0qj67_79959_c1
1157 nmdc:mga06r32_13403_c1
1158 nmdc:mga06r32_3098_c1
1159 nmdc:mga06r32_91014_c1
1160 nmdc:mga08y16_213716_c1
1161 nmdc:mga08y16_42298_c1
1162 nmdc:mga08y16_50531_c1
1163 nmdc:mga08y16_55407_c1
1164 nmdc:mga08y16_6313_c1
1165 nmdc:mga08y16_733945_c1
1166 nmdc:mga08y16_97862_c1
1167 nmdc:mga0rr50_461789_c1
1168 nmdc:mga0rr50_520476_c1
1169 nmdc:mga08x19_244591_c1
1170 nmdc:mga0a205_123075_c1
1171 nmdc:mga0a205_92215_c1
1172 Ga0495619_0005607
1173 Ga0500637_0027094
1174 Ga0501084_0073208
1175 Ga0466962_0008386
1176 Ga0530510_0199181

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

16

300

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iwe-assembly1.cif.gz_A-2 e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate 0.8838 2 282
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.8825 4 282
5iwe-assembly1.cif.gz_A-2 e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate 0.8808 2 282
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.8765 4 282
1qya-assembly1.cif.gz_A crystal structure of e. coli protein ydde 0.8696 2 282
ID Description Score Start End Superfamily
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9173 4 108 3.10.310.10
1s7jA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9153 2 114 3.10.310.10
1sdjA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9058 3 108 3.10.310.10
1u1vA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9055 5 110 3.10.310.10
3ednB01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8766 2 110 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A534B2B1-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9769 1 120 GO:0005737
GO:0009058
GO:0016853
AF-A0A536TF32-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9716 1 91 GO:0005737
GO:0009058
GO:0016853
AF-A0A534GRN2-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9704 1 110 GO:0005737
GO:0009058
GO:0016853
AF-A0A7W0X562-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9608 1 136 GO:0005737
GO:0009058
GO:0016853
AF-A0A3N4W6I2-F1-model_v4 deleted 0.9588 1 282

Map