F466804
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 588 | 450 | 1177 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300046558|Ga0495633_0021561|Ga0495633_0021561_87_767 |
| Length | 226 |
| Sequence | MHVYPACGDHGGERAMMRFVITGTDTGIGKTVFSAALAGALSGYYWKPVQAGLDEETDSQIVSRLSGLPPERILPEAYRLRTPASPHLAARIDHVTIAPEMLVAPVTNAPLIIEGAGGLLVPLTKTEVFADVFARWQIPVILCARTGLGTINHTLLSLEALRRRSIPVFGVAFIGDEAAETQRIIAAMGHVRILGRLPRLDPLTPDLLRQAFHDNFPLSPFQEVIA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 65 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 75 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 87 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 88 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 89 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 90 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 145 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 146 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 147 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 148 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 154 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 155 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 160 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 162 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 163 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 164 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 166 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 172 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 173 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 174 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 175 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 176 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 177 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 178 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 179 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 180 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 181 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 184 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 185 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 186 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 187 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 216 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 219 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 220 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 221 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 224 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 229 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 230 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 231 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 232 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 233 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 234 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 235 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 236 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 237 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 238 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 239 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 250 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 251 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 252 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 253 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 254 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 256 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 257 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 258 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 259 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 260 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 261 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 262 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 263 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 264 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 265 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 266 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 267 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 268 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 269 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 270 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 271 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 272 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 273 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 274 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 275 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 276 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 277 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 278 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 279 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 280 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 281 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 282 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 283 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 284 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 285 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 286 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 287 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 288 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 289 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 290 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 291 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 292 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 293 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 294 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 295 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 296 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 297 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 298 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 299 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 300 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 301 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 302 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 303 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 304 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 305 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 306 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 307 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 308 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 309 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 310 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 311 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 312 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 313 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 314 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 315 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 316 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 317 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 318 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 319 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 320 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 321 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 322 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 323 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 324 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 325 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 326 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 327 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 328 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 329 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 330 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 331 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 332 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 333 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 334 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 335 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 336 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 337 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 338 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 339 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 340 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 341 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 342 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 343 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 344 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 345 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 346 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 347 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 348 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 349 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 350 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 351 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 352 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 353 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 354 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 355 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 356 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 357 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 358 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 359 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 360 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 361 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 362 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 363 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 364 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 365 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 366 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 367 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 368 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 369 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 370 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 371 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 372 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 373 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 374 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 375 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 376 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 377 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 378 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 379 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 380 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 381 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 382 | 2904699407 | |||
| 383 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 384 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 385 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 386 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 387 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 388 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 389 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 390 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 391 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 392 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 393 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 394 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 395 | 2922425934 | |||
| 396 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 397 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 398 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 399 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 400 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 401 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 402 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 403 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 404 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 405 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 406 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 407 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 408 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 409 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 410 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 411 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 412 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 413 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 414 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 415 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 416 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 417 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 418 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 419 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 420 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 421 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 422 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 423 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 424 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 425 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 426 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 427 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 428 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 429 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 430 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 431 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 432 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 433 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 434 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 435 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 436 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 437 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 438 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 439 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 440 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 441 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 442 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 443 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 444 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 445 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 446 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 447 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 448 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 449 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 450 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 67.75 |
| Metatranscriptomes | 0 |
| Isolates | 32.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.69 |
| Nodule | 20.75 |
| Rhizoplane | 4.93 |
| Rhizosphere | 39.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495633_0021561 | 3300046558 | Bacteria | 3221 |
| 2 | SwRhRL2b_contig_544056 | 2162886007 | Bacteria | 7056 |
| 3 | LJNas_1000298 | 3300000546 | Bacteria | 8722 |
| 4 | JGI24740J21852_10000308 | 3300001979 | Bacteria | 20760 |
| 5 | JGI24739J22299_10006801 | 3300001989 | Bacteria | 4303 |
| 6 | JGI24737J22298_10001465 | 3300001990 | Bacteria | 8407 |
| 7 | JGI24735J21928_10001446 | 3300002067 | Bacteria | 8392 |
| 8 | JGI24738J21930_10001077 | 3300002075 | Bacteria | 7736 |
| 9 | JGI25158J39367_1003058 | 3300002739 | Bacteria | 2631 |
| 10 | JGI25152J39213_1006345 | 3300002773 | Bacteria | 3247 |
| 11 | JGI25152J39213_1030113 | 3300002773 | Bacteria | 846 |
| 12 | JGI25150J39212_1028387 | 3300002774 | Bacteria | 793 |
| 13 | JGI25159J45721_1000005 | 3300002987 | Bacteria | 214315 |
| 14 | JGI25151J46595_10024486 | 3300003187 | Bacteria | 2469 |
| 15 | JGI25151J46595_10031690 | 3300003187 | Bacteria | 2061 |
| 16 | JGI25165J46597_1000104 | 3300003214 | Bacteria | 152363 |
| 17 | JGI25153J46596_10076674 | 3300003215 | Bacteria | 846 |
| 18 | JGI25153J46596_10076677 | 3300003215 | Bacteria | 846 |
| 19 | rootH2_10053744 | 3300003320 | Bacteria | 1752 |
| 20 | rootH2_10053745 | 3300003320 | Bacteria | 1037 |
| 21 | rootH1_10009808 | 3300003323 | Bacteria | 4490 |
| 22 | rootH1_10009809 | 3300003316 | Bacteria | 30543 |
| 23 | rootH1_10009809 | 3300003323 | Bacteria | 2798 |
| 24 | JGI25160J50197_1000005 | 3300003354 | Bacteria | 417280 |
| 25 | JGI25160J50197_1000103 | 3300003354 | Bacteria | 80968 |
| 26 | JGI25161J50226_1000090 | 3300003374 | Bacteria | 73647 |
| 27 | JGI25161J50226_1001080 | 3300003374 | Bacteria | 9210 |
| 28 | Ga0055526_1005069 | 3300003771 | Bacteria | 7690 |
| 29 | Ga0055526_1026927 | 3300003771 | Bacteria | 1795 |
| 30 | Ga0055524_1001390 | 3300003775 | Bacteria | 13972 |
| 31 | Ga0055524_1012397 | 3300003775 | Bacteria | 3273 |
| 32 | Ga0055524_1025325 | 3300003775 | Bacteria | 1861 |
| 33 | Ga0055536_1000819 | 3300003781 | Bacteria | 20515 |
| 34 | Ga0055528_1000900 | 3300003790 | Bacteria | 20037 |
| 35 | Ga0055528_1004834 | 3300003790 | Bacteria | 6405 |
| 36 | Ga0055531_10003162 | 3300003794 | Bacteria | 10588 |
| 37 | Ga0055531_10045753 | 3300003794 | Bacteria | 1211 |
| 38 | Ga0055543_1000087 | 3300004625 | Bacteria | 81157 |
| 39 | Ga0055543_1000863 | 3300004625 | Bacteria | 14563 |
| 40 | Ga0065165_1000002 | 3300005262 | Bacteria | 444192 |
| 41 | Ga0065165_1000776 | 3300005262 | Bacteria | 42909 |
| 42 | Ga0065704_10001031 | 3300005289 | Bacteria | 10014 |
| 43 | Ga0070690_100045659 | 3300005330 | Bacteria | 2784 |
| 44 | Ga0070670_100033394 | 3300005331 | Bacteria | 4431 |
| 45 | Ga0070660_100164177 | 3300005339 | Bacteria | 1791 |
| 46 | Ga0070660_100451431 | 3300005339 | Bacteria | 1066 |
| 47 | Ga0070661_100103108 | 3300005344 | Bacteria | 2124 |
| 48 | Ga0070668_100254263 | 3300005347 | Bacteria | 1459 |
| 49 | Ga0070668_100736862 | 3300005347 | Bacteria | 871 |
| 50 | Ga0070669_100146472 | 3300005353 | Bacteria | 1825 |
| 51 | Ga0070671_100004846 | 3300005355 | Bacteria | 10698 |
| 52 | Ga0070671_100271287 | 3300005355 | Bacteria | 1442 |
| 53 | Ga0070688_100101093 | 3300005365 | Bacteria | 1901 |
| 54 | Ga0070659_100022429 | 3300005366 | Bacteria | 4820 |
| 55 | Ga0070667_100064738 | 3300005367 | Bacteria | 3103 |
| 56 | Ga0070667_100261955 | 3300005367 | Bacteria | 1548 |
| 57 | Ga0070714_100045580 | 3300005435 | Bacteria | 3717 |
| 58 | Ga0070713_100023480 | 3300005436 | Bacteria | 4786 |
| 59 | Ga0070711_100374059 | 3300005439 | Bacteria | 1150 |
| 60 | Ga0070663_100026232 | 3300005455 | Bacteria | 3944 |
| 61 | Ga0070662_100038601 | 3300005457 | Bacteria | 3392 |
| 62 | Ga0070662_100634312 | 3300005457 | Bacteria | 900 |
| 63 | Ga0068867_100050994 | 3300005459 | Bacteria | 3051 |
| 64 | Ga0068853_100184628 | 3300005539 | Bacteria | 1892 |
| 65 | Ga0070686_100017785 | 3300005544 | Bacteria | 4160 |
| 66 | Ga0070665_100003281 | 3300005548 | Bacteria | 17362 |
| 67 | Ga0070665_100573167 | 3300005548 | Bacteria | 1141 |
| 68 | Ga0068855_100584955 | 3300005563 | Bacteria | 1205 |
| 69 | Ga0068855_100597632 | 3300005563 | Bacteria | 1190 |
| 70 | Ga0070664_100246013 | 3300005564 | Bacteria | 1606 |
| 71 | Ga0068857_100283466 | 3300005577 | Bacteria | 1524 |
| 72 | Ga0068856_100022327 | 3300005614 | Bacteria | 6150 |
| 73 | Ga0068856_100412253 | 3300005614 | Bacteria | 1371 |
| 74 | Ga0068859_100197678 | 3300005617 | Bacteria | 2095 |
| 75 | Ga0068866_10008562 | 3300005718 | Bacteria | 4318 |
| 76 | Ga0068863_100054416 | 3300005841 | Bacteria | 3792 |
| 77 | Ga0068860_100006693 | 3300005843 | Bacteria | 11569 |
| 78 | Ga0068862_100000291 | 3300005844 | Bacteria | 55364 |
| 79 | Ga0081540_1015015 | 3300005983 | Bacteria | 4921 |
| 80 | Ga0075365_10328249 | 3300006038 | Bacteria | 1078 |
| 81 | Ga0075363_100322228 | 3300006048 | Bacteria | 899 |
| 82 | Ga0075367_10000664 | 3300006178 | Bacteria | 13170 |
| 83 | Ga0075367_10042598 | 3300006178 | Bacteria | 2657 |
| 84 | Ga0075369_10003293 | 3300006186 | Bacteria | 5867 |
| 85 | Ga0075369_10075475 | 3300006186 | Bacteria | 1489 |
| 86 | Ga0075370_10087630 | 3300006353 | Bacteria | 1794 |
| 87 | Ga0075370_10142562 | 3300006353 | Bacteria | 1401 |
| 88 | Ga0068865_100035782 | 3300006881 | Bacteria | 3343 |
| 89 | Ga0097620_100197681 | 3300006931 | Bacteria | 2095 |
| 90 | Ga0079104_1013127 | 3300006946 | Bacteria | 2569 |
| 91 | Ga0105251_10003145 | 3300009011 | Bacteria | 12252 |
| 92 | Ga0105251_10011507 | 3300009011 | Bacteria | 5051 |
| 93 | Ga0105250_10015748 | 3300009092 | Bacteria | 3093 |
| 94 | Ga0105240_10220638 | 3300009093 | Bacteria | 2209 |
| 95 | Ga0105247_10034134 | 3300009101 | Bacteria | 3098 |
| 96 | Ga0105247_10337390 | 3300009101 | Bacteria | 1056 |
| 97 | Ga0105241_10020587 | 3300009174 | Bacteria | 4875 |
| 98 | Ga0105241_10886796 | 3300009174 | Bacteria | 827 |
| 99 | Ga0105248_10377025 | 3300009177 | Bacteria | 1597 |
| 100 | Ga0105237_10009165 | 3300009545 | Bacteria | 10629 |
| 101 | Ga0105237_10085262 | 3300009545 | Bacteria | 3149 |
| 102 | Ga0105238_10002132 | 3300009551 | Bacteria | 19985 |
| 103 | Ga0105238_10129047 | 3300009551 | Bacteria | 2507 |
| 104 | Ga0105249_10000067 | 3300009553 | Bacteria | 149492 |
| 105 | Ga0105249_10379459 | 3300009553 | Bacteria | 1439 |
| 106 | Ga0123340_1057436 | 3300009763 | Bacteria | 1214 |
| 107 | Ga0123341_1015241 | 3300009765 | Bacteria | 6858 |
| 108 | Ga0105239_10185168 | 3300010375 | Bacteria | 2330 |
| 109 | Ga0105246_10097960 | 3300011119 | Bacteria | 2129 |
| 110 | Ga0157373_10132856 | 3300013100 | Bacteria | 1750 |
| 111 | Ga0157370_10188461 | 3300013104 | Bacteria | 1915 |
| 112 | Ga0171463_1002 | 3300013249 | Bacteria | 1274851 |
| 113 | Ga0157372_10707503 | 3300013307 | Bacteria | 1172 |
| 114 | Ga0182008_10054589 | 3300014497 | Bacteria | 1976 |
| 115 | Ga0157376_10017553 | 3300014969 | Bacteria | 5463 |
| 116 | Ga0183362_10187 | 3300015683 | Bacteria | 1089 |
| 117 | Ga0163161_10016641 | 3300017792 | Bacteria | 5136 |
| 118 | Ga0163161_10229869 | 3300017792 | Bacteria | 1439 |
| 119 | Ga0214544_1000158 | 3300021320 | Bacteria | 101943 |
| 120 | Ga0214542_1001567 | 3300021321 | Bacteria | 47020 |
| 121 | Ga0214543_1000234 | 3300021327 | Bacteria | 84243 |
| 122 | Ga0213872_10001676 | 3300021361 | Bacteria | 13947 |
| 123 | Ga0209436_100556 | 3300025208 | Bacteria | 16119 |
| 124 | Ga0209147_101850 | 3300025229 | Bacteria | 6493 |
| 125 | Ga0207425_1002235 | 3300025245 | Bacteria | 7013 |
| 126 | Ga0207425_1016217 | 3300025245 | Bacteria | 1657 |
| 127 | Ga0209129_1000424 | 3300025258 | Bacteria | 32069 |
| 128 | Ga0209129_1000893 | 3300025258 | Bacteria | 18322 |
| 129 | Ga0209129_1003902 | 3300025258 | Bacteria | 6200 |
| 130 | Ga0209233_1000164 | 3300025261 | Bacteria | 152430 |
| 131 | Ga0209673_1000005 | 3300025273 | Bacteria | 692788 |
| 132 | Ga0209130_1000010 | 3300025284 | Bacteria | 444920 |
| 133 | Ga0209130_1000098 | 3300025284 | Bacteria | 142506 |
| 134 | Ga0209676_1001442 | 3300025292 | Bacteria | 22406 |
| 135 | Ga0209676_1020842 | 3300025292 | Bacteria | 2213 |
| 136 | Ga0209025_1000234 | 3300025294 | Bacteria | 130341 |
| 137 | Ga0209025_1003645 | 3300025294 | Bacteria | 14288 |
| 138 | Ga0209025_1019918 | 3300025294 | Bacteria | 3702 |
| 139 | Ga0209564_1000025 | 3300025295 | Bacteria | 520535 |
| 140 | Ga0209564_1002096 | 3300025295 | Bacteria | 17065 |
| 141 | Ga0209564_1005198 | 3300025295 | Bacteria | 7537 |
| 142 | Ga0209564_1042898 | 3300025295 | Bacteria | 1193 |
| 143 | Ga0209758_1000983 | 3300025297 | Bacteria | 38351 |
| 144 | Ga0209758_1001815 | 3300025297 | Bacteria | 23598 |
| 145 | Ga0209050_1023211 | 3300025298 | Bacteria | 2190 |
| 146 | Ga0209256_1000209 | 3300025299 | Bacteria | 110253 |
| 147 | Ga0209256_1000311 | 3300025299 | Bacteria | 84751 |
| 148 | Ga0209256_1000477 | 3300025299 | Bacteria | 59886 |
| 149 | Ga0207426_1000036 | 3300025302 | Bacteria | 444920 |
| 150 | Ga0207426_1000069 | 3300025302 | Bacteria | 334513 |
| 151 | Ga0207426_1000968 | 3300025302 | Bacteria | 28326 |
| 152 | Ga0207426_1042259 | 3300025302 | Bacteria | 1408 |
| 153 | Ga0209051_1001099 | 3300025303 | Bacteria | 24879 |
| 154 | Ga0209051_1043404 | 3300025303 | Bacteria | 1578 |
| 155 | Ga0209051_1084336 | 3300025303 | Bacteria | 905 |
| 156 | Ga0209051_1085737 | 3300025303 | Bacteria | 892 |
| 157 | Ga0209257_1018252 | 3300025304 | Bacteria | 2711 |
| 158 | Ga0209257_1018253 | 3300025304 | Bacteria | 2711 |
| 159 | Ga0209257_1029196 | 3300025304 | Bacteria | 1800 |
| 160 | Ga0207697_10237144 | 3300025315 | Bacteria | 806 |
| 161 | Ga0207656_10029806 | 3300025321 | Bacteria | 2250 |
| 162 | Ga0207713_1015851 | 3300025735 | Bacteria | 3850 |
| 163 | Ga0207642_10270110 | 3300025899 | Bacteria | 973 |
| 164 | Ga0207710_10125649 | 3300025900 | Bacteria | 1228 |
| 165 | Ga0207647_10009795 | 3300025904 | Bacteria | 6795 |
| 166 | Ga0207645_10035642 | 3300025907 | Bacteria | 3194 |
| 167 | Ga0207695_10078679 | 3300025913 | Bacteria | 3345 |
| 168 | Ga0207695_10279895 | 3300025913 | Bacteria | 1562 |
| 169 | Ga0207671_10001559 | 3300025914 | Bacteria | 26229 |
| 170 | Ga0207663_10315739 | 3300025916 | Bacteria | 1173 |
| 171 | Ga0207657_10198437 | 3300025919 | Bacteria | 1615 |
| 172 | Ga0207649_10104685 | 3300025920 | Bacteria | 1879 |
| 173 | Ga0207681_10094045 | 3300025923 | Bacteria | 2147 |
| 174 | Ga0207694_10001835 | 3300025924 | Bacteria | 17687 |
| 175 | Ga0207694_10364246 | 3300025924 | Bacteria | 1198 |
| 176 | Ga0207694_10952377 | 3300025924 | Bacteria | 726 |
| 177 | Ga0207650_10029740 | 3300025925 | Bacteria | 3929 |
| 178 | Ga0207687_10430310 | 3300025927 | Bacteria | 1091 |
| 179 | Ga0207700_10007972 | 3300025928 | Bacteria | 6522 |
| 180 | Ga0207644_10123833 | 3300025931 | Bacteria | 1971 |
| 181 | Ga0207706_10005114 | 3300025933 | Bacteria | 12242 |
| 182 | Ga0207706_10032110 | 3300025933 | Bacteria | 4675 |
| 183 | Ga0207670_10123355 | 3300025936 | Bacteria | 1887 |
| 184 | Ga0207665_10105557 | 3300025939 | Bacteria | 1973 |
| 185 | Ga0207691_10075808 | 3300025940 | Bacteria | 3032 |
| 186 | Ga0207711_10218079 | 3300025941 | Bacteria | 1744 |
| 187 | Ga0207679_10106122 | 3300025945 | Bacteria | 2207 |
| 188 | Ga0207667_10235885 | 3300025949 | Bacteria | 1872 |
| 189 | Ga0207667_10596860 | 3300025949 | Bacteria | 1114 |
| 190 | Ga0207712_10000054 | 3300025961 | Bacteria | 148878 |
| 191 | Ga0207712_10013104 | 3300025961 | Bacteria | 5312 |
| 192 | Ga0207668_10037284 | 3300025972 | Bacteria | 3252 |
| 193 | Ga0207640_10207356 | 3300025981 | Bacteria | 1490 |
| 194 | Ga0207639_10001044 | 3300026041 | Bacteria | 18817 |
| 195 | Ga0207639_10006450 | 3300026041 | Bacteria | 7978 |
| 196 | Ga0207639_10094773 | 3300026041 | Bacteria | 2397 |
| 197 | Ga0207678_10008945 | 3300026067 | Bacteria | 8818 |
| 198 | Ga0207678_10045986 | 3300026067 | Bacteria | 3775 |
| 199 | Ga0207678_10513203 | 3300026067 | Bacteria | 1046 |
| 200 | Ga0207708_10021583 | 3300026075 | Bacteria | 4857 |
| 201 | Ga0207702_10005099 | 3300026078 | Bacteria | 11548 |
| 202 | Ga0207702_10457860 | 3300026078 | Bacteria | 1239 |
| 203 | Ga0207641_10149178 | 3300026088 | Bacteria | 2116 |
| 204 | Ga0207648_10055349 | 3300026089 | Bacteria | 3463 |
| 205 | Ga0207674_10004313 | 3300026116 | Bacteria | 17140 |
| 206 | Ga0207675_100055703 | 3300026118 | Bacteria | 3689 |
| 207 | Ga0207683_10016191 | 3300026121 | Bacteria | 6348 |
| 208 | Ga0207683_10173660 | 3300026121 | Bacteria | 1952 |
| 209 | Ga0207698_10222974 | 3300026142 | Bacteria | 1705 |
| 210 | Ga0209389_1000659 | 3300027296 | Bacteria | 21422 |
| 211 | Ga0209589_1000034 | 3300027357 | Bacteria | 138086 |
| 212 | Ga0209489_100009 | 3300027361 | Bacteria | 263873 |
| 213 | Ga0209489_104793 | 3300027361 | Bacteria | 24481 |
| 214 | Ga0209700_100020 | 3300027363 | Bacteria | 235733 |
| 215 | Ga0209813_10000240 | 3300027866 | Bacteria | 16302 |
| 216 | Ga0207428_10107083 | 3300027907 | Bacteria | 2154 |
| 217 | Ga0268266_10288677 | 3300028379 | Bacteria | 1527 |
| 218 | Ga0268265_10000299 | 3300028380 | Bacteria | 55179 |
| 219 | Ga0268264_10006711 | 3300028381 | Bacteria | 9672 |
| 220 | Ga0307515_10011735 | 3300028794 | Bacteria | 16580 |
| 221 | Ga0265328_10029420 | 3300031239 | Bacteria | 2051 |
| 222 | Ga0265331_10006726 | 3300031250 | Bacteria | 6740 |
| 223 | Ga0265331_10021328 | 3300031250 | Bacteria | 3317 |
| 224 | Ga0265327_10071421 | 3300031251 | Bacteria | 1737 |
| 225 | Ga0265316_10021758 | 3300031344 | Bacteria | 5423 |
| 226 | Ga0307408_100029929 | 3300031548 | Bacteria | 3777 |
| 227 | Ga0307408_100044856 | 3300031548 | Bacteria | 3153 |
| 228 | Ga0307408_100116551 | 3300031548 | Bacteria | 2062 |
| 229 | Ga0307508_10061112 | 3300031616 | Bacteria | 3330 |
| 230 | Ga0265314_10158231 | 3300031711 | Bacteria | 1381 |
| 231 | Ga0316576_10038818 | 3300031727 | Bacteria | 3416 |
| 232 | Ga0316576_10159152 | 3300031727 | Bacteria | 1703 |
| 233 | Ga0307413_10315986 | 3300031824 | Bacteria | 1191 |
| 234 | Ga0307410_10222908 | 3300031852 | Bacteria | 1451 |
| 235 | Ga0307412_10134636 | 3300031911 | Bacteria | 1800 |
| 236 | Ga0307409_100020314 | 3300031995 | Bacteria | 4523 |
| 237 | Ga0307414_10504991 | 3300032004 | Bacteria | 1070 |
| 238 | Ga0307411_10416715 | 3300032005 | Bacteria | 1114 |
| 239 | Ga0316584_0026089 | 3300036712 | Bacteria | 4292 |
| 240 | Ga0316584_0233002 | 3300036712 | Bacteria | 1349 |
| 241 | Ga0395900_0064087 | 3300037418 | Bacteria | 3778 |
| 242 | Ga0395905_0000022 | 3300037471 | Bacteria | 321527 |
| 243 | Ga0395905_0029458 | 3300037471 | Bacteria | 5172 |
| 244 | Ga0395905_0342000 | 3300037471 | Bacteria | 1387 |
| 245 | Ga0436361_0012246 | 3300039447 | Bacteria | 21495 |
| 246 | Ga0439436_0002588 | 3300041404 | Bacteria | 5446 |
| 247 | Ga0439465_0026255 | 3300041413 | Bacteria | 1841 |
| 248 | Ga0451849_1264891 | 3300041505 | Bacteria | 8051 |
| 249 | Ga0439448_0070128 | 3300042005 | Bacteria | 1167 |
| 250 | Ga0439452_035757 | 3300042010 | Bacteria | 1194 |
| 251 | Ga0450920_018398 | 3300042122 | Bacteria | 1337 |
| 252 | Ga0450909_006233 | 3300042185 | Bacteria | 1721 |
| 253 | Ga0450918_001885 | 3300042531 | Bacteria | 4056 |
| 254 | Ga0466969_0001849 | 3300044656 | Bacteria | 11316 |
| 255 | Ga0466966_0000273 | 3300044684 | Bacteria | 33831 |
| 256 | Ga0466963_0626706 | 3300044694 | Bacteria | 759 |
| 257 | Ga0466971_0136862 | 3300044719 | Bacteria | 1139 |
| 258 | Ga0466970_0083112 | 3300044765 | Bacteria | 1732 |
| 259 | Ga0466957_0007115 | 3300044842 | Bacteria | 6328 |
| 260 | Ga0466959_0000621 | 3300045049 | Bacteria | 20577 |
| 261 | Ga0466959_0228944 | 3300045049 | Bacteria | 1287 |
| 262 | Ga0495627_000324 | 3300046453 | Bacteria | 46576 |
| 263 | Ga0495638_0000035 | 3300046460 | Bacteria | 276385 |
| 264 | Ga0495605_0001337 | 3300046474 | Bacteria | 16311 |
| 265 | Ga0495584_0022076 | 3300046491 | Bacteria | 3230 |
| 266 | Ga0495585_0006200 | 3300046492 | Bacteria | 7451 |
| 267 | Ga0495583_0001198 | 3300046506 | Bacteria | 27870 |
| 268 | Ga0495606_0347312 | 3300046507 | Bacteria | 788 |
| 269 | Ga0495610_0202935 | 3300046512 | Bacteria | 811 |
| 270 | Ga0495631_0001421 | 3300046518 | Bacteria | 14544 |
| 271 | Ga0495632_0000013 | 3300046519 | Bacteria | 247879 |
| 272 | Ga0495632_0000612 | 3300046519 | Bacteria | 32954 |
| 273 | Ga0495632_0011139 | 3300046519 | Bacteria | 5267 |
| 274 | Ga0495637_0000100 | 3300046520 | Bacteria | 65373 |
| 275 | Ga0495643_0000010 | 3300046522 | Bacteria | 341431 |
| 276 | Ga0495648_0000933 | 3300046524 | Bacteria | 30373 |
| 277 | Ga0495648_0140467 | 3300046524 | Bacteria | 1272 |
| 278 | Ga0495663_0000004 | 3300046525 | Bacteria | 355166 |
| 279 | Ga0495654_0137207 | 3300046530 | Bacteria | 1093 |
| 280 | Ga0495609_0020647 | 3300046538 | Bacteria | 3042 |
| 281 | Ga0495633_0000092 | 3300046558 | Bacteria | 121446 |
| 282 | Ga0495633_0001757 | 3300046558 | Bacteria | 16080 |
| 283 | Ga0495633_0005139 | 3300046558 | Bacteria | 8110 |
| 284 | Ga0495668_0017970 | 3300046616 | Bacteria | 4093 |
| 285 | Ga0495611_0016046 | 3300046648 | Bacteria | 3203 |
| 286 | Ga0495625_0000621 | 3300046660 | Bacteria | 51568 |
| 287 | Ga0495669_0021707 | 3300046684 | Bacteria | 2789 |
| 288 | Ga0495670_0017471 | 3300046691 | Bacteria | 3530 |
| 289 | Ga0495671_0000014 | 3300046692 | Bacteria | 341431 |
| 290 | Ga0495671_0000034 | 3300046692 | Bacteria | 195385 |
| 291 | Ga0495671_0127943 | 3300046692 | Bacteria | 1239 |
| 292 | Ga0495636_0081832 | 3300047318 | Bacteria | 1391 |
| 293 | Ga0495672_0027809 | 3300047320 | Bacteria | 3588 |
| 294 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 295 | Ga0495673_0009404 | 3300047469 | Bacteria | 5410 |
| 296 | Ga0495681_0000725 | 3300047470 | Bacteria | 25287 |
| 297 | Ga0495686_0009517 | 3300047472 | Bacteria | 6991 |
| 298 | Ga0495686_0020937 | 3300047472 | Bacteria | 4355 |
| 299 | Ga0496101_0040605 | 3300048904 | Bacteria | 3314 |
| 300 | Ga0496102_0117303 | 3300048905 | Bacteria | 2484 |
| 301 | Ga0496102_0138168 | 3300048905 | Bacteria | 2283 |
| 302 | Ga0496102_0297202 | 3300048905 | Bacteria | 1522 |
| 303 | Ga0496103_0066151 | 3300048906 | Bacteria | 2256 |
| 304 | Ga0496104_0012047 | 3300048907 | Bacteria | 7762 |
| 305 | Ga0496105_0119251 | 3300048908 | Bacteria | 2176 |
| 306 | Ga0496106_0022487 | 3300048909 | Bacteria | 4685 |
| 307 | Ga0496106_0381449 | 3300048909 | Bacteria | 1133 |
| 308 | Ga0496107_0259341 | 3300048910 | Bacteria | 1293 |
| 309 | Ga0496107_0442093 | 3300048910 | Bacteria | 966 |
| 310 | Ga0496108_0003150 | 3300048911 | Bacteria | 13268 |
| 311 | Ga0496108_0290134 | 3300048911 | Bacteria | 1424 |
| 312 | Ga0496109_0014694 | 3300048912 | Bacteria | 6814 |
| 313 | Ga0496109_0193285 | 3300048912 | Bacteria | 1912 |
| 314 | Ga0496110_0091815 | 3300048913 | Bacteria | 2717 |
| 315 | Ga0496110_0102654 | 3300048913 | Bacteria | 2564 |
| 316 | Ga0496110_0145775 | 3300048913 | Bacteria | 2141 |
| 317 | Ga0496111_0042518 | 3300048914 | Bacteria | 3263 |
| 318 | Ga0496111_0086233 | 3300048914 | Bacteria | 2297 |
| 319 | Ga0496112_0029831 | 3300048915 | Bacteria | 5277 |
| 320 | Ga0496112_0298806 | 3300048915 | Bacteria | 1556 |
| 321 | Ga0496114_0436377 | 3300048917 | Bacteria | 1160 |
| 322 | Ga0496114_0612264 | 3300048917 | Bacteria | 960 |
| 323 | Ga0496115_0256465 | 3300048918 | Bacteria | 1439 |
| 324 | Ga0496115_0399298 | 3300048918 | Bacteria | 1116 |
| 325 | Ga0496116_0045398 | 3300048919 | Bacteria | 2975 |
| 326 | Ga0496117_0255656 | 3300048920 | Bacteria | 953 |
| 327 | Ga0496118_0079710 | 3300048921 | Bacteria | 2309 |
| 328 | Ga0496119_0115741 | 3300048922 | Bacteria | 1481 |
| 329 | Ga0496120_0073387 | 3300048923 | Bacteria | 1873 |
| 330 | Ga0496121_0002040 | 3300048924 | Bacteria | 31978 |
| 331 | Ga0496121_0010693 | 3300048924 | Bacteria | 10299 |
| 332 | Ga0496121_0034219 | 3300048924 | Bacteria | 4577 |
| 333 | Ga0496121_0049074 | 3300048924 | Bacteria | 3584 |
| 334 | Ga0496121_0105607 | 3300048924 | Bacteria | 2161 |
| 335 | Ga0496121_0175099 | 3300048924 | Bacteria | 1554 |
| 336 | Ga0496121_0237098 | 3300048924 | Bacteria | 1274 |
| 337 | Ga0496121_0306178 | 3300048924 | Bacteria | 1076 |
| 338 | Ga0496122_0009972 | 3300048925 | Bacteria | 9892 |
| 339 | Ga0496123_0007161 | 3300048926 | Bacteria | 10587 |
| 340 | Ga0496123_0023520 | 3300048926 | Bacteria | 4714 |
| 341 | Ga0496124_0055771 | 3300048927 | Bacteria | 3337 |
| 342 | Ga0496124_0082461 | 3300048927 | Bacteria | 2639 |
| 343 | Ga0496125_0033622 | 3300048928 | Bacteria | 4534 |
| 344 | Ga0496125_0044638 | 3300048928 | Bacteria | 3744 |
| 345 | Ga0496125_0046461 | 3300048928 | Bacteria | 3642 |
| 346 | Ga0496125_0169553 | 3300048928 | Bacteria | 1470 |
| 347 | Ga0496125_0199392 | 3300048928 | Bacteria | 1312 |
| 348 | Ga0496126_0005920 | 3300048929 | Bacteria | 13786 |
| 349 | Ga0496126_0093300 | 3300048929 | Bacteria | 2643 |
| 350 | Ga0496126_0117057 | 3300048929 | Bacteria | 2315 |
| 351 | Ga0496126_0335357 | 3300048929 | Bacteria | 1240 |
| 352 | Ga0496126_0380056 | 3300048929 | Bacteria | 1150 |
| 353 | Ga0496126_0483895 | 3300048929 | Bacteria | 991 |
| 354 | Ga0496126_0858540 | 3300048929 | Unclassified | 692 |
| 355 | Ga0495678_007036 | 3300049459 | Bacteria | 5895 |
| 356 | Ga0495682_0038073 | 3300049460 | Bacteria | 1768 |
| 357 | Ga0501032_0000021 | 3300049569 | Bacteria | 146895 |
| 358 | Ga0501032_0092236 | 3300049569 | Bacteria | 2009 |
| 359 | Ga0501034_0000001 | 3300049571 | Bacteria | 2184493 |
| 360 | Ga0501034_0134285 | 3300049571 | Bacteria | 2456 |
| 361 | Ga0501036_0007144 | 3300049572 | Bacteria | 9094 |
| 362 | Ga0501037_0073697 | 3300049573 | Bacteria | 2482 |
| 363 | Ga0501039_0000029 | 3300049575 | Bacteria | 131786 |
| 364 | Ga0501043_0074288 | 3300049579 | Bacteria | 2670 |
| 365 | Ga0501080_0101832 | 3300049742 | Bacteria | 2665 |
| 366 | Ga0501035_0256261 | 3300049822 | Bacteria | 1484 |
| 367 | nmdc:mga03n38_115367_c1 | 3300050490 | Bacteria | 1313 |
| 368 | nmdc:mga03n38_203159_c1 | 3300050490 | Bacteria | 1026 |
| 369 | nmdc:mga0yw44_103195_c1 | 3300050492 | Bacteria | 1818 |
| 370 | nmdc:mga0yw44_15269_c1 | 3300050492 | Bacteria | 4107 |
| 371 | nmdc:mga0yw44_26034_c1 | 3300050492 | Bacteria | 3336 |
| 372 | nmdc:mga06z11_136_c1 | 3300050494 | Bacteria | 29270 |
| 373 | nmdc:mga06z11_35626_c1 | 3300050494 | Bacteria | 2451 |
| 374 | nmdc:mga06z11_45068_c1 | 3300050494 | Bacteria | 2228 |
| 375 | nmdc:mga04h51_18_c1 | 3300050495 | Bacteria | 74460 |
| 376 | nmdc:mga07m45_458638_c1 | 3300050496 | Bacteria | 739 |
| 377 | nmdc:mga07m45_93738_c1 | 3300050496 | Bacteria | 1721 |
| 378 | nmdc:mga08y16_514108_c1 | 3300050511 | Bacteria | 1215 |
| 379 | nmdc:mga0sz30_227531_c1 | 3300050516 | Bacteria | 829 |
| 380 | nmdc:mga0sz30_24246_c1 | 3300050516 | Bacteria | 2474 |
| 381 | nmdc:mga0sz30_3680_c1 | 3300050516 | Bacteria | 4272 |
| 382 | Ga0500610_0013892 | 3300053079 | Bacteria | 3762 |
| 383 | Ga0500643_066130 | 3300053087 | Bacteria | 1008 |
| 384 | Ga0500562_009017 | 3300053108 | Bacteria | 2520 |
| 385 | Ga0500592_023472 | 3300053116 | Bacteria | 994 |
| 386 | Ga0500594_0000401 | 3300053118 | Bacteria | 9623 |
| 387 | Ga0500607_000003 | 3300053121 | Bacteria | 149664 |
| 388 | Ga0500559_0000400 | 3300053136 | Bacteria | 31323 |
| 389 | Ga0500559_0006664 | 3300053136 | Bacteria | 5193 |
| 390 | Ga0500568_0004550 | 3300053139 | Bacteria | 7397 |
| 391 | Ga0500604_0007886 | 3300053151 | Bacteria | 2824 |
| 392 | Ga0500604_0036302 | 3300053151 | Bacteria | 1470 |
| 393 | Ga0500616_0009034 | 3300053153 | Bacteria | 6103 |
| 394 | Ga0500624_000003 | 3300053157 | Bacteria | 253364 |
| 395 | Ga0500637_0000045 | 3300053178 | Bacteria | 44699 |
| 396 | Ga0500637_0001763 | 3300053178 | Bacteria | 9341 |
| 397 | Ga0500645_041948 | 3300053730 | Bacteria | 1350 |
| 398 | Ga0466962_0014907 | 3300061719 | Bacteria | 3746 |
| 399 | 2507506410 | 2507262055 | Bacteria | 8048963 |
| 400 | 2508729693 | 2508501050 | Bacteria | 9633614 |
| 401 | 2509074016 | 2508501114 | Bacteria | 7082538 |
| 402 | 2509149436 | 2508501128 | Bacteria | 8613869 |
| 403 | 2511186181 | 2510917028 | Bacteria | 6185411 |
| 404 | 2512530153 | 2512047086 | Bacteria | 6850303 |
| 405 | 2512645078 | 2512564014 | Bacteria | 4639632 |
| 406 | 2513622816 | 2513237092 | Bacteria | 8341956 |
| 407 | 2513653281 | 2513237095 | Bacteria | 8976980 |
| 408 | 2513658542 | 2513237096 | Bacteria | 8722461 |
| 409 | 2513674539 | 2513237098 | Bacteria | 9902361 |
| 410 | 2513706220 | 2513237102 | Bacteria | 7703324 |
| 411 | 2513860124 | 2513237137 | Bacteria | 9558895 |
| 412 | 2513879779 | 2513237139 | Bacteria | 8737671 |
| 413 | 2513920658 | 2513237145 | Bacteria | 8979722 |
| 414 | 2513999156 | 2513237159 | Bacteria | 6810126 |
| 415 | 2514017513 | 2513237161 | Bacteria | 8871253 |
| 416 | 2516206025 | 2516143018 | Bacteria | 6951533 |
| 417 | 2517108259 | 2517093001 | Bacteria | 9002274 |
| 418 | 2517888576 | 2517572143 | Bacteria | 9484767 |
| 419 | 2524443337 | 2524023205 | Bacteria | 8918781 |
| 420 | 2524463733 | 2524023210 | Bacteria | 9029266 |
| 421 | 2524535111 | 2524023228 | Bacteria | 10118060 |
| 422 | 2528856960 | 2528768022 | Bacteria | 10457665 |
| 423 | 2585164877 | 2582581283 | Bacteria | 6030556 |
| 424 | 2585202730 | 2582581294 | Bacteria | 6626667 |
| 425 | 2585265255 | 2582581306 | Bacteria | 6450535 |
| 426 | 2585385611 | 2582581865 | Bacteria | 6644329 |
| 427 | 2585397000 | 2582581866 | Bacteria | 6859583 |
| 428 | 2585401641 | 2582581867 | Bacteria | 7184437 |
| 429 | 2585821335 | 2585427590 | Bacteria | 6824633 |
| 430 | 2588513653 | 2588253730 | Bacteria | 6881675 |
| 431 | 2600196507 | 2599185352 | Bacteria | 7228948 |
| 432 | 2617353376 | 2617270735 | Bacteria | 9163226 |
| 433 | 2643805440 | 2643221557 | Bacteria | 7184309 |
| 434 | 2644047276 | 2643221607 | Bacteria | 6314006 |
| 435 | 2644069230 | 2643221610 | Bacteria | 7480339 |
| 436 | 2644191886 | 2643221634 | Bacteria | 6705461 |
| 437 | 2644199647 | 2643221636 | Bacteria | 6583769 |
| 438 | 2644379805 | 2643221668 | Bacteria | 7306521 |
| 439 | 2644420383 | 2643221675 | Bacteria | 7473456 |
| 440 | 2644453909 | 2643221680 | Bacteria | 7473610 |
| 441 | 2644480065 | 2643221686 | Bacteria | 6310811 |
| 442 | 2644496879 | 2643221689 | Bacteria | 6042950 |
| 443 | 2644674947 | 2643221723 | Bacteria | 7095460 |
| 444 | 2644686318 | 2643221726 | Bacteria | 7455827 |
| 445 | 2657685097 | 2657244999 | Bacteria | 5946535 |
| 446 | 2671119756 | 2667528175 | Bacteria | 7532676 |
| 447 | 2739308841 | 2738543024 | Bacteria | 5603683 |
| 448 | 2745074986 | 2744054633 | Bacteria | 8678936 |
| 449 | 2770196119 | 2767802442 | Bacteria | 5747986 |
| 450 | 2774871270 | 2773857925 | Bacteria | 6472445 |
| 451 | 2776268119 | 2775506902 | Bacteria | 6208009 |
| 452 | 2776268178 | 2775506902 | Bacteria | 6208009 |
| 453 | 2776272916 | 2775506902 | Bacteria | 6208009 |
| 454 | 2776282241 | 2775506904 | Bacteria | 5954060 |
| 455 | 2776283312 | 2775506904 | Bacteria | 5954060 |
| 456 | 2776283981 | 2775506904 | Bacteria | 5954060 |
| 457 | 2792583691 | 2791355082 | Bacteria | 5973319 |
| 458 | 2804754930 | 2802429268 | Bacteria | 6094027 |
| 459 | 2805922012 | 2802429603 | Bacteria | 8777136 |
| 460 | 2818243701 | 2816332527 | Bacteria | 8933356 |
| 461 | 2824618352 | 2824617872 | Bacteria | 8814715 |
| 462 | 2824626939 | 2824626560 | Bacteria | 8813858 |
| 463 | 2824635391 | 2824635225 | Bacteria | 8785348 |
| 464 | 2824644230 | 2824644064 | Bacteria | 8743947 |
| 465 | 2824704827 | 2824704595 | Bacteria | 9667483 |
| 466 | 2824714902 | 2824714736 | Bacteria | 8717648 |
| 467 | 2824724034 | 2824723954 | Bacteria | 8758240 |
| 468 | 2824754830 | 2824753945 | Bacteria | 9787441 |
| 469 | 2824764580 | 2824763712 | Bacteria | 9792355 |
| 470 | 2824779612 | 2824773399 | Bacteria | 8360218 |
| 471 | 2838124946 | 2838122688 | Bacteria | 8803140 |
| 472 | 2840764204 | 2840764183 | Bacteria | 6358399 |
| 473 | 2840770499 | 2840764183 | Bacteria | 6358399 |
| 474 | 2841957650 | 2841949485 | Bacteria | 8680857 |
| 475 | 2841963844 | 2841957949 | Bacteria | 8652217 |
| 476 | 2841974170 | 2841966195 | Bacteria | 8673214 |
| 477 | 2841976693 | 2841974524 | Bacteria | 8931498 |
| 478 | 2841986172 | 2841983080 | Bacteria | 8395090 |
| 479 | 2842524901 | 2842521101 | Bacteria | 6569494 |
| 480 | 2844168837 | 2844163670 | Bacteria | 7266046 |
| 481 | 2847670452 | 2847670302 | Bacteria | 6165597 |
| 482 | 2847672758 | 2847670302 | Bacteria | 6165597 |
| 483 | 2847933505 | 2847930680 | Bacteria | 9342022 |
| 484 | 2847940406 | 2847939898 | Bacteria | 8606328 |
| 485 | 2852392568 | 2852387548 | Bacteria | 8025568 |
| 486 | 2856314709 | 2856314179 | Bacteria | 6477897 |
| 487 | 2856352887 | 2856349417 | Bacteria | 6230045 |
| 488 | 2871448703 | 2871444079 | Bacteria | 6423508 |
| 489 | 2871492423 | 2871488783 | Bacteria | 6929816 |
| 490 | 2874613737 | 2874612657 | Bacteria | 8252029 |
| 491 | 2874622101 | 2874620515 | Bacteria | 8290088 |
| 492 | 2876365293 | 2876363079 | Bacteria | 6544991 |
| 493 | 2876765217 | 2876761206 | Bacteria | 10111113 |
| 494 | 2878036210 | 2878035449 | Bacteria | 6555736 |
| 495 | 2878758304 | 2878753008 | Bacteria | 6922523 |
| 496 | 2879088885 | 2879083081 | Bacteria | 8587928 |
| 497 | 2881154884 | 2881147464 | Bacteria | 7779814 |
| 498 | 2881158133 | 2881155292 | Bacteria | 6461656 |
| 499 | 2881666800 | 2881665667 | Bacteria | 8175609 |
| 500 | 2881848392 | 2881845957 | Bacteria | 6611900 |
| 501 | 2881860456 | 2881853255 | Bacteria | 6698367 |
| 502 | 2881864456 | 2881861095 | Bacteria | 7128710 |
| 503 | 2882463142 | 2882456835 | Bacteria | 6863978 |
| 504 | 2882919145 | 2882912400 | Bacteria | 6801539 |
| 505 | 2885324566 | 2885318864 | Bacteria | 6729568 |
| 506 | 2885349189 | 2885342637 | Bacteria | 7011821 |
| 507 | 2885352394 | 2885350715 | Bacteria | 6787678 |
| 508 | 2885372437 | 2885366525 | Bacteria | 8326213 |
| 509 | 2885381799 | 2885374607 | Bacteria | 8927485 |
| 510 | 2885383488 | 2885383462 | Bacteria | 9473874 |
| 511 | 2888380478 | 2888378607 | Bacteria | 9652610 |
| 512 | 2888380692 | 2888378607 | Bacteria | 9652610 |
| 513 | 2903496846 | 2903492973 | Bacteria | 13473544 |
| 514 | 2903523645 | 2903521522 | Bacteria | 6525694 |
| 515 | 2903529944 | 2903528002 | Bacteria | 6586099 |
| 516 | 2903754579 | 2903748898 | Bacteria | 9972761 |
| 517 | 2904666783 | 2904666416 | Bacteria | 8226587 |
| 518 | 2904708184 | |||
| 519 | 2904713036 | 2904711408 | Bacteria | 9771557 |
| 520 | 2906414898 | 2906414383 | Bacteria | 6580790 |
| 521 | 2906637739 | 2906635258 | Bacteria | 8601019 |
| 522 | 2906650746 | 2906643746 | Bacteria | 8722424 |
| 523 | 2906668307 | 2906660503 | Bacteria | 8595048 |
| 524 | 2908747112 | 2908739725 | Bacteria | 8628932 |
| 525 | 2909046110 | 2909042592 | Bacteria | 6499737 |
| 526 | 2913300901 | 2913295892 | Bacteria | 6333755 |
| 527 | 2915653580 | 2915650412 | Bacteria | 4288180 |
| 528 | 2920761038 | 2920760137 | Bacteria | 7427611 |
| 529 | 2920827750 | 2920822456 | Bacteria | 6897201 |
| 530 | 2922161596 | 2922158528 | Bacteria | 6573167 |
| 531 | 2922434556 | |||
| 532 | 2924784400 | 2924784321 | Bacteria | 7416538 |
| 533 | 2929621646 | 2929615660 | Bacteria | 9193770 |
| 534 | 2929631950 | 2929624759 | Bacteria | 9339455 |
| 535 | 2933583331 | 2933577622 | Bacteria | 9116884 |
| 536 | 2935613975 | 2935608549 | Bacteria | 8203142 |
| 537 | 2935637590 | 2935630451 | Bacteria | 8169952 |
| 538 | 2935646764 | 2935638405 | Bacteria | 10015038 |
| 539 | 2935647712 | 2935638405 | Bacteria | 10015038 |
| 540 | 2935674538 | 2935665750 | Bacteria | 9571747 |
| 541 | 2935690669 | 2935684952 | Bacteria | 9590419 |
| 542 | 2935712409 | 2935703347 | Bacteria | 10242284 |
| 543 | 2935717635 | 2935713505 | Bacteria | 9608509 |
| 544 | 2935727215 | 2935722832 | Bacteria | 9608746 |
| 545 | 2935735985 | 2935732158 | Bacteria | 9706831 |
| 546 | 2935744744 | 2935741537 | Bacteria | 9707219 |
| 547 | 2935755678 | 2935750917 | Bacteria | 9590372 |
| 548 | 2935836046 | 2935827899 | Bacteria | 10038562 |
| 549 | 2935836407 | 2935827899 | Bacteria | 10038562 |
| 550 | 2935872855 | 2935864058 | Bacteria | 9784707 |
| 551 | 2935882169 | 2935873716 | Bacteria | 9632195 |
| 552 | 2935889047 | 2935883170 | Bacteria | 7964738 |
| 553 | 2936000027 | 2935992306 | Bacteria | 9802711 |
| 554 | 2940561041 | 2940556831 | Bacteria | 9590747 |
| 555 | 2941514173 | 2941507105 | Bacteria | 8166816 |
| 556 | 2941522134 | 2941515067 | Bacteria | 8166720 |
| 557 | 2941529872 | 2941523033 | Bacteria | 8169134 |
| 558 | 2958119939 | 2958115193 | Bacteria | 6923548 |
| 559 | 2961129473 | 2961127735 | Bacteria | 7196641 |
| 560 | 2961173504 | 2961170736 | Bacteria | 7072258 |
| 561 | 2968005901 | 2968003550 | Bacteria | 6929263 |
| 562 | 2970506096 | 2970503327 | Bacteria | 7099517 |
| 563 | 2977826836 | 2977821940 | Bacteria | 6906439 |
| 564 | 2977834572 | 2977828996 | Bacteria | 7007971 |
| 565 | 2979810818 | 2979808191 | Bacteria | 7179355 |
| 566 | 2996345585 | 2996341866 | Bacteria | 6643098 |
| 567 | 3000142330 | 3000135777 | Bacteria | 6891109 |
| 568 | 3002145730 | 3002141150 | Bacteria | 5254435 |
| 569 | 3003934867 | 3003930520 | Bacteria | 5667563 |
| 570 | 3005450717 | 3005445848 | Bacteria | 6906074 |
| 571 | 3005483673 | 3005474847 | Bacteria | 9259049 |
| 572 | 3005490718 | 3005483717 | Bacteria | 7877331 |
| 573 | 637077895 | 637000159 | Bacteria | 7596297 |
| 574 | 637080194 | 637000159 | Bacteria | 7596297 |
| 575 | 8002060711 | 8002060224 | Bacteria | 4026565 |
| 576 | 8004379818 | 8004374579 | Bacteria | 6898112 |
| 577 | 8004705249 | 8004703790 | Bacteria | 8006957 |
| 578 | 8006936532 | 8006933436 | Bacteria | 10410654 |
| 579 | 8006976498 | 8006973647 | Bacteria | 10679141 |
| 580 | 8016613177 | 8016613128 | Bacteria | 8794220 |
| 581 | 8019562125 | 8019555841 | Bacteria | 9642137 |
| 582 | 8019572191 | 8019565922 | Bacteria | 9639779 |
| 583 | 8019585718 | 8019576017 | Bacteria | 10049540 |
| 584 | 8019593656 | 8019586578 | Bacteria | 10212056 |
| 585 | 8019597769 | 8019597564 | Bacteria | 10041141 |
| 586 | 8019610616 | 8019608314 | Bacteria | 10042931 |
| 587 | 8049298054 | 8049293176 | Bacteria | 6128433 |
| 588 | 8055744153 | 8055742211 | Bacteria | 9226248 |
| 589 | 8057580913 | 8057575449 | Bacteria | 7367519 |
| 590 | Ga0495633_0021561 | |||
| 591 | SwRhRL2b_contig_544056 | |||
| 592 | LJNas_1000298 | |||
| 593 | JGI24740J21852_10000308 | |||
| 594 | JGI24739J22299_10006801 | |||
| 595 | JGI24737J22298_10001465 | |||
| 596 | JGI24735J21928_10001446 | |||
| 597 | JGI24738J21930_10001077 | |||
| 598 | JGI25158J39367_1003058 | |||
| 599 | JGI25152J39213_1006345 | |||
| 600 | JGI25152J39213_1030113 | |||
| 601 | JGI25150J39212_1028387 | |||
| 602 | JGI25159J45721_1000005 | |||
| 603 | JGI25151J46595_10024486 | |||
| 604 | JGI25151J46595_10031690 | |||
| 605 | JGI25165J46597_1000104 | |||
| 606 | JGI25153J46596_10076674 | |||
| 607 | JGI25153J46596_10076677 | |||
| 608 | rootH2_10053744 | |||
| 609 | rootH2_10053745 | |||
| 610 | rootH1_10009808 | |||
| 611 | rootH1_10009809 | |||
| 612 | JGI25160J50197_1000005 | |||
| 613 | JGI25160J50197_1000103 | |||
| 614 | JGI25161J50226_1000090 | |||
| 615 | JGI25161J50226_1001080 | |||
| 616 | Ga0055526_1005069 | |||
| 617 | Ga0055526_1026927 | |||
| 618 | Ga0055524_1001390 | |||
| 619 | Ga0055524_1012397 | |||
| 620 | Ga0055524_1025325 | |||
| 621 | Ga0055536_1000819 | |||
| 622 | Ga0055528_1000900 | |||
| 623 | Ga0055528_1004834 | |||
| 624 | Ga0055531_10003162 | |||
| 625 | Ga0055531_10045753 | |||
| 626 | Ga0055543_1000087 | |||
| 627 | Ga0055543_1000863 | |||
| 628 | Ga0065165_1000002 | |||
| 629 | Ga0065165_1000776 | |||
| 630 | Ga0065704_10001031 | |||
| 631 | Ga0070690_100045659 | |||
| 632 | Ga0070670_100033394 | |||
| 633 | Ga0070660_100164177 | |||
| 634 | Ga0070660_100451431 | |||
| 635 | Ga0070661_100103108 | |||
| 636 | Ga0070668_100254263 | |||
| 637 | Ga0070668_100736862 | |||
| 638 | Ga0070669_100146472 | |||
| 639 | Ga0070671_100004846 | |||
| 640 | Ga0070671_100271287 | |||
| 641 | Ga0070688_100101093 | |||
| 642 | Ga0070659_100022429 | |||
| 643 | Ga0070667_100064738 | |||
| 644 | Ga0070667_100261955 | |||
| 645 | Ga0070714_100045580 | |||
| 646 | Ga0070713_100023480 | |||
| 647 | Ga0070711_100374059 | |||
| 648 | Ga0070663_100026232 | |||
| 649 | Ga0070662_100038601 | |||
| 650 | Ga0070662_100634312 | |||
| 651 | Ga0068867_100050994 | |||
| 652 | Ga0068853_100184628 | |||
| 653 | Ga0070686_100017785 | |||
| 654 | Ga0070665_100003281 | |||
| 655 | Ga0070665_100573167 | |||
| 656 | Ga0068855_100584955 | |||
| 657 | Ga0068855_100597632 | |||
| 658 | Ga0070664_100246013 | |||
| 659 | Ga0068857_100283466 | |||
| 660 | Ga0068856_100022327 | |||
| 661 | Ga0068856_100412253 | |||
| 662 | Ga0068859_100197678 | |||
| 663 | Ga0068866_10008562 | |||
| 664 | Ga0068863_100054416 | |||
| 665 | Ga0068860_100006693 | |||
| 666 | Ga0068862_100000291 | |||
| 667 | Ga0081540_1015015 | |||
| 668 | Ga0075365_10328249 | |||
| 669 | Ga0075363_100322228 | |||
| 670 | Ga0075367_10000664 | |||
| 671 | Ga0075367_10042598 | |||
| 672 | Ga0075369_10003293 | |||
| 673 | Ga0075369_10075475 | |||
| 674 | Ga0075370_10087630 | |||
| 675 | Ga0075370_10142562 | |||
| 676 | Ga0068865_100035782 | |||
| 677 | Ga0097620_100197681 | |||
| 678 | Ga0079104_1013127 | |||
| 679 | Ga0105251_10003145 | |||
| 680 | Ga0105251_10011507 | |||
| 681 | Ga0105250_10015748 | |||
| 682 | Ga0105240_10220638 | |||
| 683 | Ga0105247_10034134 | |||
| 684 | Ga0105247_10337390 | |||
| 685 | Ga0105241_10020587 | |||
| 686 | Ga0105241_10886796 | |||
| 687 | Ga0105248_10377025 | |||
| 688 | Ga0105237_10009165 | |||
| 689 | Ga0105237_10085262 | |||
| 690 | Ga0105238_10002132 | |||
| 691 | Ga0105238_10129047 | |||
| 692 | Ga0105249_10000067 | |||
| 693 | Ga0105249_10379459 | |||
| 694 | Ga0123340_1057436 | |||
| 695 | Ga0123341_1015241 | |||
| 696 | Ga0105239_10185168 | |||
| 697 | Ga0105246_10097960 | |||
| 698 | Ga0157373_10132856 | |||
| 699 | Ga0157370_10188461 | |||
| 700 | Ga0171463_1002 | |||
| 701 | Ga0157372_10707503 | |||
| 702 | Ga0182008_10054589 | |||
| 703 | Ga0157376_10017553 | |||
| 704 | Ga0183362_10187 | |||
| 705 | Ga0163161_10016641 | |||
| 706 | Ga0163161_10229869 | |||
| 707 | Ga0214544_1000158 | |||
| 708 | Ga0214542_1001567 | |||
| 709 | Ga0214543_1000234 | |||
| 710 | Ga0213872_10001676 | |||
| 711 | Ga0209436_100556 | |||
| 712 | Ga0209147_101850 | |||
| 713 | Ga0207425_1002235 | |||
| 714 | Ga0207425_1016217 | |||
| 715 | Ga0209129_1000424 | |||
| 716 | Ga0209129_1000893 | |||
| 717 | Ga0209129_1003902 | |||
| 718 | Ga0209233_1000164 | |||
| 719 | Ga0209673_1000005 | |||
| 720 | Ga0209130_1000010 | |||
| 721 | Ga0209130_1000098 | |||
| 722 | Ga0209676_1001442 | |||
| 723 | Ga0209676_1020842 | |||
| 724 | Ga0209025_1000234 | |||
| 725 | Ga0209025_1003645 | |||
| 726 | Ga0209025_1019918 | |||
| 727 | Ga0209564_1000025 | |||
| 728 | Ga0209564_1002096 | |||
| 729 | Ga0209564_1005198 | |||
| 730 | Ga0209564_1042898 | |||
| 731 | Ga0209758_1000983 | |||
| 732 | Ga0209758_1001815 | |||
| 733 | Ga0209050_1023211 | |||
| 734 | Ga0209256_1000209 | |||
| 735 | Ga0209256_1000311 | |||
| 736 | Ga0209256_1000477 | |||
| 737 | Ga0207426_1000036 | |||
| 738 | Ga0207426_1000069 | |||
| 739 | Ga0207426_1000968 | |||
| 740 | Ga0207426_1042259 | |||
| 741 | Ga0209051_1001099 | |||
| 742 | Ga0209051_1043404 | |||
| 743 | Ga0209051_1084336 | |||
| 744 | Ga0209051_1085737 | |||
| 745 | Ga0209257_1018252 | |||
| 746 | Ga0209257_1018253 | |||
| 747 | Ga0209257_1029196 | |||
| 748 | Ga0207697_10237144 | |||
| 749 | Ga0207656_10029806 | |||
| 750 | Ga0207713_1015851 | |||
| 751 | Ga0207642_10270110 | |||
| 752 | Ga0207710_10125649 | |||
| 753 | Ga0207647_10009795 | |||
| 754 | Ga0207645_10035642 | |||
| 755 | Ga0207695_10078679 | |||
| 756 | Ga0207695_10279895 | |||
| 757 | Ga0207671_10001559 | |||
| 758 | Ga0207663_10315739 | |||
| 759 | Ga0207657_10198437 | |||
| 760 | Ga0207649_10104685 | |||
| 761 | Ga0207681_10094045 | |||
| 762 | Ga0207694_10001835 | |||
| 763 | Ga0207694_10364246 | |||
| 764 | Ga0207694_10952377 | |||
| 765 | Ga0207650_10029740 | |||
| 766 | Ga0207687_10430310 | |||
| 767 | Ga0207700_10007972 | |||
| 768 | Ga0207644_10123833 | |||
| 769 | Ga0207706_10005114 | |||
| 770 | Ga0207706_10032110 | |||
| 771 | Ga0207670_10123355 | |||
| 772 | Ga0207665_10105557 | |||
| 773 | Ga0207691_10075808 | |||
| 774 | Ga0207711_10218079 | |||
| 775 | Ga0207679_10106122 | |||
| 776 | Ga0207667_10235885 | |||
| 777 | Ga0207667_10596860 | |||
| 778 | Ga0207712_10000054 | |||
| 779 | Ga0207712_10013104 | |||
| 780 | Ga0207668_10037284 | |||
| 781 | Ga0207640_10207356 | |||
| 782 | Ga0207639_10001044 | |||
| 783 | Ga0207639_10006450 | |||
| 784 | Ga0207639_10094773 | |||
| 785 | Ga0207678_10008945 | |||
| 786 | Ga0207678_10045986 | |||
| 787 | Ga0207678_10513203 | |||
| 788 | Ga0207708_10021583 | |||
| 789 | Ga0207702_10005099 | |||
| 790 | Ga0207702_10457860 | |||
| 791 | Ga0207641_10149178 | |||
| 792 | Ga0207648_10055349 | |||
| 793 | Ga0207674_10004313 | |||
| 794 | Ga0207675_100055703 | |||
| 795 | Ga0207683_10016191 | |||
| 796 | Ga0207683_10173660 | |||
| 797 | Ga0207698_10222974 | |||
| 798 | Ga0209389_1000659 | |||
| 799 | Ga0209589_1000034 | |||
| 800 | Ga0209489_100009 | |||
| 801 | Ga0209489_104793 | |||
| 802 | Ga0209700_100020 | |||
| 803 | Ga0209813_10000240 | |||
| 804 | Ga0207428_10107083 | |||
| 805 | Ga0268266_10288677 | |||
| 806 | Ga0268265_10000299 | |||
| 807 | Ga0268264_10006711 | |||
| 808 | Ga0307515_10011735 | |||
| 809 | Ga0265328_10029420 | |||
| 810 | Ga0265331_10006726 | |||
| 811 | Ga0265331_10021328 | |||
| 812 | Ga0265327_10071421 | |||
| 813 | Ga0265316_10021758 | |||
| 814 | Ga0307408_100029929 | |||
| 815 | Ga0307408_100044856 | |||
| 816 | Ga0307408_100116551 | |||
| 817 | Ga0307508_10061112 | |||
| 818 | Ga0265314_10158231 | |||
| 819 | Ga0316576_10038818 | |||
| 820 | Ga0316576_10159152 | |||
| 821 | Ga0307413_10315986 | |||
| 822 | Ga0307410_10222908 | |||
| 823 | Ga0307412_10134636 | |||
| 824 | Ga0307409_100020314 | |||
| 825 | Ga0307414_10504991 | |||
| 826 | Ga0307411_10416715 | |||
| 827 | Ga0316584_0026089 | |||
| 828 | Ga0316584_0233002 | |||
| 829 | Ga0395900_0064087 | |||
| 830 | Ga0395905_0000022 | |||
| 831 | Ga0395905_0029458 | |||
| 832 | Ga0395905_0342000 | |||
| 833 | Ga0436361_0012246 | |||
| 834 | Ga0439436_0002588 | |||
| 835 | Ga0439465_0026255 | |||
| 836 | Ga0451849_1264891 | |||
| 837 | Ga0439448_0070128 | |||
| 838 | Ga0439452_035757 | |||
| 839 | Ga0450920_018398 | |||
| 840 | Ga0450909_006233 | |||
| 841 | Ga0450918_001885 | |||
| 842 | Ga0466969_0001849 | |||
| 843 | Ga0466966_0000273 | |||
| 844 | Ga0466963_0626706 | |||
| 845 | Ga0466971_0136862 | |||
| 846 | Ga0466970_0083112 | |||
| 847 | Ga0466957_0007115 | |||
| 848 | Ga0466959_0000621 | |||
| 849 | Ga0466959_0228944 | |||
| 850 | Ga0495627_000324 | |||
| 851 | Ga0495638_0000035 | |||
| 852 | Ga0495605_0001337 | |||
| 853 | Ga0495584_0022076 | |||
| 854 | Ga0495585_0006200 | |||
| 855 | Ga0495583_0001198 | |||
| 856 | Ga0495606_0347312 | |||
| 857 | Ga0495610_0202935 | |||
| 858 | Ga0495631_0001421 | |||
| 859 | Ga0495632_0000013 | |||
| 860 | Ga0495632_0000612 | |||
| 861 | Ga0495632_0011139 | |||
| 862 | Ga0495637_0000100 | |||
| 863 | Ga0495643_0000010 | |||
| 864 | Ga0495648_0000933 | |||
| 865 | Ga0495648_0140467 | |||
| 866 | Ga0495663_0000004 | |||
| 867 | Ga0495654_0137207 | |||
| 868 | Ga0495609_0020647 | |||
| 869 | Ga0495633_0000092 | |||
| 870 | Ga0495633_0001757 | |||
| 871 | Ga0495633_0005139 | |||
| 872 | Ga0495668_0017970 | |||
| 873 | Ga0495611_0016046 | |||
| 874 | Ga0495625_0000621 | |||
| 875 | Ga0495669_0021707 | |||
| 876 | Ga0495670_0017471 | |||
| 877 | Ga0495671_0000014 | |||
| 878 | Ga0495671_0000034 | |||
| 879 | Ga0495671_0127943 | |||
| 880 | Ga0495636_0081832 | |||
| 881 | Ga0495672_0027809 | |||
| 882 | Ga0495673_0000013 | |||
| 883 | Ga0495673_0009404 | |||
| 884 | Ga0495681_0000725 | |||
| 885 | Ga0495686_0009517 | |||
| 886 | Ga0495686_0020937 | |||
| 887 | Ga0496101_0040605 | |||
| 888 | Ga0496102_0117303 | |||
| 889 | Ga0496102_0138168 | |||
| 890 | Ga0496102_0297202 | |||
| 891 | Ga0496103_0066151 | |||
| 892 | Ga0496104_0012047 | |||
| 893 | Ga0496105_0119251 | |||
| 894 | Ga0496106_0022487 | |||
| 895 | Ga0496106_0381449 | |||
| 896 | Ga0496107_0259341 | |||
| 897 | Ga0496107_0442093 | |||
| 898 | Ga0496108_0003150 | |||
| 899 | Ga0496108_0290134 | |||
| 900 | Ga0496109_0014694 | |||
| 901 | Ga0496109_0193285 | |||
| 902 | Ga0496110_0091815 | |||
| 903 | Ga0496110_0102654 | |||
| 904 | Ga0496110_0145775 | |||
| 905 | Ga0496111_0042518 | |||
| 906 | Ga0496111_0086233 | |||
| 907 | Ga0496112_0029831 | |||
| 908 | Ga0496112_0298806 | |||
| 909 | Ga0496114_0436377 | |||
| 910 | Ga0496114_0612264 | |||
| 911 | Ga0496115_0256465 | |||
| 912 | Ga0496115_0399298 | |||
| 913 | Ga0496116_0045398 | |||
| 914 | Ga0496117_0255656 | |||
| 915 | Ga0496118_0079710 | |||
| 916 | Ga0496119_0115741 | |||
| 917 | Ga0496120_0073387 | |||
| 918 | Ga0496121_0002040 | |||
| 919 | Ga0496121_0010693 | |||
| 920 | Ga0496121_0034219 | |||
| 921 | Ga0496121_0049074 | |||
| 922 | Ga0496121_0105607 | |||
| 923 | Ga0496121_0175099 | |||
| 924 | Ga0496121_0237098 | |||
| 925 | Ga0496121_0306178 | |||
| 926 | Ga0496122_0009972 | |||
| 927 | Ga0496123_0007161 | |||
| 928 | Ga0496123_0023520 | |||
| 929 | Ga0496124_0055771 | |||
| 930 | Ga0496124_0082461 | |||
| 931 | Ga0496125_0033622 | |||
| 932 | Ga0496125_0044638 | |||
| 933 | Ga0496125_0046461 | |||
| 934 | Ga0496125_0169553 | |||
| 935 | Ga0496125_0199392 | |||
| 936 | Ga0496126_0005920 | |||
| 937 | Ga0496126_0093300 | |||
| 938 | Ga0496126_0117057 | |||
| 939 | Ga0496126_0335357 | |||
| 940 | Ga0496126_0380056 | |||
| 941 | Ga0496126_0483895 | |||
| 942 | Ga0496126_0858540 | |||
| 943 | Ga0495678_007036 | |||
| 944 | Ga0495682_0038073 | |||
| 945 | Ga0501032_0000021 | |||
| 946 | Ga0501032_0092236 | |||
| 947 | Ga0501034_0000001 | |||
| 948 | Ga0501034_0134285 | |||
| 949 | Ga0501036_0007144 | |||
| 950 | Ga0501037_0073697 | |||
| 951 | Ga0501039_0000029 | |||
| 952 | Ga0501043_0074288 | |||
| 953 | Ga0501080_0101832 | |||
| 954 | Ga0501035_0256261 | |||
| 955 | nmdc:mga03n38_115367_c1 | |||
| 956 | nmdc:mga03n38_203159_c1 | |||
| 957 | nmdc:mga0yw44_103195_c1 | |||
| 958 | nmdc:mga0yw44_15269_c1 | |||
| 959 | nmdc:mga0yw44_26034_c1 | |||
| 960 | nmdc:mga06z11_136_c1 | |||
| 961 | nmdc:mga06z11_35626_c1 | |||
| 962 | nmdc:mga06z11_45068_c1 | |||
| 963 | nmdc:mga04h51_18_c1 | |||
| 964 | nmdc:mga07m45_458638_c1 | |||
| 965 | nmdc:mga07m45_93738_c1 | |||
| 966 | nmdc:mga08y16_514108_c1 | |||
| 967 | nmdc:mga0sz30_227531_c1 | |||
| 968 | nmdc:mga0sz30_24246_c1 | |||
| 969 | nmdc:mga0sz30_3680_c1 | |||
| 970 | Ga0500610_0013892 | |||
| 971 | Ga0500643_066130 | |||
| 972 | Ga0500562_009017 | |||
| 973 | Ga0500592_023472 | |||
| 974 | Ga0500594_0000401 | |||
| 975 | Ga0500607_000003 | |||
| 976 | Ga0500559_0000400 | |||
| 977 | Ga0500559_0006664 | |||
| 978 | Ga0500568_0004550 | |||
| 979 | Ga0500604_0007886 | |||
| 980 | Ga0500604_0036302 | |||
| 981 | Ga0500616_0009034 | |||
| 982 | Ga0500624_000003 | |||
| 983 | Ga0500637_0000045 | |||
| 984 | Ga0500637_0001763 | |||
| 985 | Ga0500645_041948 | |||
| 986 | Ga0466962_0014907 | |||
| 987 | 2507506410 | |||
| 988 | 2508729693 | |||
| 989 | 2509074016 | |||
| 990 | 2509149436 | |||
| 991 | 2511186181 | |||
| 992 | 2512530153 | |||
| 993 | 2512645078 | |||
| 994 | 2513622816 | |||
| 995 | 2513653281 | |||
| 996 | 2513658542 | |||
| 997 | 2513674539 | |||
| 998 | 2513706220 | |||
| 999 | 2513860124 | |||
| 1000 | 2513879779 | |||
| 1001 | 2513920658 | |||
| 1002 | 2513999156 | |||
| 1003 | 2514017513 | |||
| 1004 | 2516206025 | |||
| 1005 | 2517108259 | |||
| 1006 | 2517888576 | |||
| 1007 | 2524443337 | |||
| 1008 | 2524463733 | |||
| 1009 | 2524535111 | |||
| 1010 | 2528856960 | |||
| 1011 | 2585164877 | |||
| 1012 | 2585202730 | |||
| 1013 | 2585265255 | |||
| 1014 | 2585385611 | |||
| 1015 | 2585397000 | |||
| 1016 | 2585401641 | |||
| 1017 | 2585821335 | |||
| 1018 | 2588513653 | |||
| 1019 | 2600196507 | |||
| 1020 | 2617353376 | |||
| 1021 | 2643805440 | |||
| 1022 | 2644047276 | |||
| 1023 | 2644069230 | |||
| 1024 | 2644191886 | |||
| 1025 | 2644199647 | |||
| 1026 | 2644379805 | |||
| 1027 | 2644420383 | |||
| 1028 | 2644453909 | |||
| 1029 | 2644480065 | |||
| 1030 | 2644496879 | |||
| 1031 | 2644674947 | |||
| 1032 | 2644686318 | |||
| 1033 | 2657685097 | |||
| 1034 | 2671119756 | |||
| 1035 | 2739308841 | |||
| 1036 | 2745074986 | |||
| 1037 | 2770196119 | |||
| 1038 | 2774871270 | |||
| 1039 | 2776268119 | |||
| 1040 | 2776268178 | |||
| 1041 | 2776272916 | |||
| 1042 | 2776282241 | |||
| 1043 | 2776283312 | |||
| 1044 | 2776283981 | |||
| 1045 | 2792583691 | |||
| 1046 | 2804754930 | |||
| 1047 | 2805922012 | |||
| 1048 | 2818243701 | |||
| 1049 | 2824618352 | |||
| 1050 | 2824626939 | |||
| 1051 | 2824635391 | |||
| 1052 | 2824644230 | |||
| 1053 | 2824704827 | |||
| 1054 | 2824714902 | |||
| 1055 | 2824724034 | |||
| 1056 | 2824754830 | |||
| 1057 | 2824764580 | |||
| 1058 | 2824779612 | |||
| 1059 | 2838124946 | |||
| 1060 | 2840764204 | |||
| 1061 | 2840770499 | |||
| 1062 | 2841957650 | |||
| 1063 | 2841963844 | |||
| 1064 | 2841974170 | |||
| 1065 | 2841976693 | |||
| 1066 | 2841986172 | |||
| 1067 | 2842524901 | |||
| 1068 | 2844168837 | |||
| 1069 | 2847670452 | |||
| 1070 | 2847672758 | |||
| 1071 | 2847933505 | |||
| 1072 | 2847940406 | |||
| 1073 | 2852392568 | |||
| 1074 | 2856314709 | |||
| 1075 | 2856352887 | |||
| 1076 | 2871448703 | |||
| 1077 | 2871492423 | |||
| 1078 | 2874613737 | |||
| 1079 | 2874622101 | |||
| 1080 | 2876365293 | |||
| 1081 | 2876765217 | |||
| 1082 | 2878036210 | |||
| 1083 | 2878758304 | |||
| 1084 | 2879088885 | |||
| 1085 | 2881154884 | |||
| 1086 | 2881158133 | |||
| 1087 | 2881666800 | |||
| 1088 | 2881848392 | |||
| 1089 | 2881860456 | |||
| 1090 | 2881864456 | |||
| 1091 | 2882463142 | |||
| 1092 | 2882919145 | |||
| 1093 | 2885324566 | |||
| 1094 | 2885349189 | |||
| 1095 | 2885352394 | |||
| 1096 | 2885372437 | |||
| 1097 | 2885381799 | |||
| 1098 | 2885383488 | |||
| 1099 | 2888380478 | |||
| 1100 | 2888380692 | |||
| 1101 | 2903496846 | |||
| 1102 | 2903523645 | |||
| 1103 | 2903529944 | |||
| 1104 | 2903754579 | |||
| 1105 | 2904666783 | |||
| 1106 | 2904708184 | |||
| 1107 | 2904713036 | |||
| 1108 | 2906414898 | |||
| 1109 | 2906637739 | |||
| 1110 | 2906650746 | |||
| 1111 | 2906668307 | |||
| 1112 | 2908747112 | |||
| 1113 | 2909046110 | |||
| 1114 | 2913300901 | |||
| 1115 | 2915653580 | |||
| 1116 | 2920761038 | |||
| 1117 | 2920827750 | |||
| 1118 | 2922161596 | |||
| 1119 | 2922434556 | |||
| 1120 | 2924784400 | |||
| 1121 | 2929621646 | |||
| 1122 | 2929631950 | |||
| 1123 | 2933583331 | |||
| 1124 | 2935613975 | |||
| 1125 | 2935637590 | |||
| 1126 | 2935646764 | |||
| 1127 | 2935647712 | |||
| 1128 | 2935674538 | |||
| 1129 | 2935690669 | |||
| 1130 | 2935712409 | |||
| 1131 | 2935717635 | |||
| 1132 | 2935727215 | |||
| 1133 | 2935735985 | |||
| 1134 | 2935744744 | |||
| 1135 | 2935755678 | |||
| 1136 | 2935836046 | |||
| 1137 | 2935836407 | |||
| 1138 | 2935872855 | |||
| 1139 | 2935882169 | |||
| 1140 | 2935889047 | |||
| 1141 | 2936000027 | |||
| 1142 | 2940561041 | |||
| 1143 | 2941514173 | |||
| 1144 | 2941522134 | |||
| 1145 | 2941529872 | |||
| 1146 | 2958119939 | |||
| 1147 | 2961129473 | |||
| 1148 | 2961173504 | |||
| 1149 | 2968005901 | |||
| 1150 | 2970506096 | |||
| 1151 | 2977826836 | |||
| 1152 | 2977834572 | |||
| 1153 | 2979810818 | |||
| 1154 | 2996345585 | |||
| 1155 | 3000142330 | |||
| 1156 | 3002145730 | |||
| 1157 | 3003934867 | |||
| 1158 | 3005450717 | |||
| 1159 | 3005483673 | |||
| 1160 | 3005490718 | |||
| 1161 | 637077895 | |||
| 1162 | 637080194 | |||
| 1163 | 8002060711 | |||
| 1164 | 8004379818 | |||
| 1165 | 8004705249 | |||
| 1166 | 8006936532 | |||
| 1167 | 8006976498 | |||
| 1168 | 8016613177 | |||
| 1169 | 8019562125 | |||
| 1170 | 8019572191 | |||
| 1171 | 8019585718 | |||
| 1172 | 8019593656 | |||
| 1173 | 8019597769 | |||
| 1174 | 8019610616 | |||
| 1175 | 8049298054 | |||
| 1176 | 8055744153 | |||
| 1177 | 8057580913 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6e06-assembly2.cif.gz_D | crystal structure of mycobacterium tuberculosis dethiobiotin synthetase in complex with cytidine triphosphate solved by precipitant-ligand exchange (crystals grown in citrate precipitant) | 0.8698 | 2 | 203 |
| 1dae-assembly1.cif.gz_A | dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid | 0.8655 | 1 | 192 |
| 1a82-assembly1.cif.gz_A | dethiobiotin synthetase from escherichia coli, complex with substrates atp and diaminopelargonic acid | 0.8613 | 1 | 203 |
| 6e06-assembly2.cif.gz_D | crystal structure of mycobacterium tuberculosis dethiobiotin synthetase in complex with cytidine triphosphate solved by precipitant-ligand exchange (crystals grown in citrate precipitant) | 0.8579 | 2 | 203 |
| 3fmf-assembly2.cif.gz_C | crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate | 0.8562 | 1 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PS31_1_209_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9339 | 1 | 198 | 3.40.50.300 |
| af_A0A1D8PS31_1_209_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9031 | 1 | 198 | 3.40.50.300 |
| af_P53630_6_233_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8881 | 1 | 203 | 3.40.50.300 |
| af_P53630_6_233_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8799 | 1 | 203 | 3.40.50.300 |
| af_Q58695_1_213_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8764 | 4 | 181 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A090DLV9-F1-model_v4 | ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) | 0.9899 | 16 | 189 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |
| AF-A0A7R6X6S8-F1-model_v4 | ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) | 0.9895 | 1 | 203 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |
| AF-A0A090DP39-F1-model_v4 | ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) | 0.989 | 1 | 189 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |
| AF-A0A434R3N8-F1-model_v4 | Dethiobiotin synthase (EC 6.3.3.3) | 0.9888 | 1 | 176 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |
| AF-A0A2S9QBU3-F1-model_v4 | ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) | 0.9876 | 2 | 201 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |