F466804

General Info

Members Datasets Scaffolds Average Seq Length
588 450 1177 207

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0021561|Ga0495633_0021561_87_767
Length 226
Sequence MHVYPACGDHGGERAMMRFVITGTDTGIGKTVFSAALAGALSGYYWKPVQAGLDEETDSQIVSRLSGLPPERILPEAYRLRTPASPHLAARIDHVTIAPEMLVAPVTNAPLIIEGAGGLLVPLTKTEVFADVFARWQIPVILCARTGLGTINHTLLSLEALRRRSIPVFGVAFIGDEAAETQRIIAAMGHVRILGRLPRLDPLTPDLLRQAFHDNFPLSPFQEVIA

Samples

Sample ID Description Type Environment
1 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
75 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
87 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
88 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
145 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
146 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
147 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
177 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
178 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
179 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
195 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
196 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
197 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
202 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
212 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
240 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
241 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
256 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
257 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
258 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
259 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
260 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
261 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
262 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
263 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
264 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
265 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
266 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
267 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
268 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
270 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
271 2508501050 Microvirga lupini Lut6 Isolate Nodule
272 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
273 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
274 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
275 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
276 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
277 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
278 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
279 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
280 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
281 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
282 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
283 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
284 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
285 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
286 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
287 2516143018 Ensifer sp. BR816 Isolate Nodule
288 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
289 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
290 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
291 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
292 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
293 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
294 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
295 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
296 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
297 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
298 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
299 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
300 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
301 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
302 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
303 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
304 2643221557 Ensifer sp. Root558 Isolate Unclassified
305 2643221607 Rhizobium sp. Root73 Isolate Unclassified
306 2643221610 Ensifer sp. Root74 Isolate Unclassified
307 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
308 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
309 2643221668 Ensifer sp. Root423 Isolate Unclassified
310 2643221675 Ensifer sp. Root1298 Isolate Unclassified
311 2643221680 Ensifer sp. Root1312 Isolate Unclassified
312 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
313 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
314 2643221723 Ensifer sp. Root278 Isolate Unclassified
315 2643221726 Ensifer sp. Root954 Isolate Unclassified
316 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
317 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
318 2738543024 Aminobacter sp. AP02 Isolate Unclassified
319 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
320 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
321 2773857925 Microvirga vignae BR3299 Isolate Unclassified
322 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
323 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
324 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
325 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
326 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
327 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
328 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
329 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
330 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
331 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
332 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
333 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
334 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
335 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
336 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
337 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
338 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
339 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
340 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
341 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
342 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
343 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
344 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
345 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
346 2844163670 Ensifer sp. 1H6 Isolate Unclassified
347 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
348 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
349 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
350 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
351 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
352 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
353 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
354 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
355 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
356 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
357 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
358 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
359 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
360 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
361 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
362 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
363 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
364 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
365 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
366 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
367 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
368 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
369 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
370 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
371 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
372 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
373 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
374 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
375 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
376 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
377 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
378 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
379 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
380 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
381 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
382 2904699407
383 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
384 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
385 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
386 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
387 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
388 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
389 2909042592 Labrys sp. LIt4 Isolate Nodule
390 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
391 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
392 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
393 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
394 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
395 2922425934
396 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
397 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
398 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
399 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
400 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
401 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
402 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
403 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
404 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
405 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
406 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
407 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
408 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
409 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
410 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
411 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
412 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
413 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
414 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
415 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
416 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
417 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
418 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
419 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
420 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
421 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
422 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
423 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
424 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
425 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
426 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
427 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
428 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
429 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
430 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
431 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
432 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
433 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
434 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
435 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
436 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
437 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
438 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
439 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
440 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
441 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
442 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
443 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
444 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
445 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
446 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
447 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
448 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
449 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
450 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.75
Metatranscriptomes 0
Isolates 32.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.69
Nodule 20.75
Rhizoplane 4.93
Rhizosphere 39.12
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495633_0021561 3300046558 Bacteria 3221
2 SwRhRL2b_contig_544056 2162886007 Bacteria 7056
3 LJNas_1000298 3300000546 Bacteria 8722
4 JGI24740J21852_10000308 3300001979 Bacteria 20760
5 JGI24739J22299_10006801 3300001989 Bacteria 4303
6 JGI24737J22298_10001465 3300001990 Bacteria 8407
7 JGI24735J21928_10001446 3300002067 Bacteria 8392
8 JGI24738J21930_10001077 3300002075 Bacteria 7736
9 JGI25158J39367_1003058 3300002739 Bacteria 2631
10 JGI25152J39213_1006345 3300002773 Bacteria 3247
11 JGI25152J39213_1030113 3300002773 Bacteria 846
12 JGI25150J39212_1028387 3300002774 Bacteria 793
13 JGI25159J45721_1000005 3300002987 Bacteria 214315
14 JGI25151J46595_10024486 3300003187 Bacteria 2469
15 JGI25151J46595_10031690 3300003187 Bacteria 2061
16 JGI25165J46597_1000104 3300003214 Bacteria 152363
17 JGI25153J46596_10076674 3300003215 Bacteria 846
18 JGI25153J46596_10076677 3300003215 Bacteria 846
19 rootH2_10053744 3300003320 Bacteria 1752
20 rootH2_10053745 3300003320 Bacteria 1037
21 rootH1_10009808 3300003323 Bacteria 4490
22 rootH1_10009809 3300003316 Bacteria 30543
23 rootH1_10009809 3300003323 Bacteria 2798
24 JGI25160J50197_1000005 3300003354 Bacteria 417280
25 JGI25160J50197_1000103 3300003354 Bacteria 80968
26 JGI25161J50226_1000090 3300003374 Bacteria 73647
27 JGI25161J50226_1001080 3300003374 Bacteria 9210
28 Ga0055526_1005069 3300003771 Bacteria 7690
29 Ga0055526_1026927 3300003771 Bacteria 1795
30 Ga0055524_1001390 3300003775 Bacteria 13972
31 Ga0055524_1012397 3300003775 Bacteria 3273
32 Ga0055524_1025325 3300003775 Bacteria 1861
33 Ga0055536_1000819 3300003781 Bacteria 20515
34 Ga0055528_1000900 3300003790 Bacteria 20037
35 Ga0055528_1004834 3300003790 Bacteria 6405
36 Ga0055531_10003162 3300003794 Bacteria 10588
37 Ga0055531_10045753 3300003794 Bacteria 1211
38 Ga0055543_1000087 3300004625 Bacteria 81157
39 Ga0055543_1000863 3300004625 Bacteria 14563
40 Ga0065165_1000002 3300005262 Bacteria 444192
41 Ga0065165_1000776 3300005262 Bacteria 42909
42 Ga0065704_10001031 3300005289 Bacteria 10014
43 Ga0070690_100045659 3300005330 Bacteria 2784
44 Ga0070670_100033394 3300005331 Bacteria 4431
45 Ga0070660_100164177 3300005339 Bacteria 1791
46 Ga0070660_100451431 3300005339 Bacteria 1066
47 Ga0070661_100103108 3300005344 Bacteria 2124
48 Ga0070668_100254263 3300005347 Bacteria 1459
49 Ga0070668_100736862 3300005347 Bacteria 871
50 Ga0070669_100146472 3300005353 Bacteria 1825
51 Ga0070671_100004846 3300005355 Bacteria 10698
52 Ga0070671_100271287 3300005355 Bacteria 1442
53 Ga0070688_100101093 3300005365 Bacteria 1901
54 Ga0070659_100022429 3300005366 Bacteria 4820
55 Ga0070667_100064738 3300005367 Bacteria 3103
56 Ga0070667_100261955 3300005367 Bacteria 1548
57 Ga0070714_100045580 3300005435 Bacteria 3717
58 Ga0070713_100023480 3300005436 Bacteria 4786
59 Ga0070711_100374059 3300005439 Bacteria 1150
60 Ga0070663_100026232 3300005455 Bacteria 3944
61 Ga0070662_100038601 3300005457 Bacteria 3392
62 Ga0070662_100634312 3300005457 Bacteria 900
63 Ga0068867_100050994 3300005459 Bacteria 3051
64 Ga0068853_100184628 3300005539 Bacteria 1892
65 Ga0070686_100017785 3300005544 Bacteria 4160
66 Ga0070665_100003281 3300005548 Bacteria 17362
67 Ga0070665_100573167 3300005548 Bacteria 1141
68 Ga0068855_100584955 3300005563 Bacteria 1205
69 Ga0068855_100597632 3300005563 Bacteria 1190
70 Ga0070664_100246013 3300005564 Bacteria 1606
71 Ga0068857_100283466 3300005577 Bacteria 1524
72 Ga0068856_100022327 3300005614 Bacteria 6150
73 Ga0068856_100412253 3300005614 Bacteria 1371
74 Ga0068859_100197678 3300005617 Bacteria 2095
75 Ga0068866_10008562 3300005718 Bacteria 4318
76 Ga0068863_100054416 3300005841 Bacteria 3792
77 Ga0068860_100006693 3300005843 Bacteria 11569
78 Ga0068862_100000291 3300005844 Bacteria 55364
79 Ga0081540_1015015 3300005983 Bacteria 4921
80 Ga0075365_10328249 3300006038 Bacteria 1078
81 Ga0075363_100322228 3300006048 Bacteria 899
82 Ga0075367_10000664 3300006178 Bacteria 13170
83 Ga0075367_10042598 3300006178 Bacteria 2657
84 Ga0075369_10003293 3300006186 Bacteria 5867
85 Ga0075369_10075475 3300006186 Bacteria 1489
86 Ga0075370_10087630 3300006353 Bacteria 1794
87 Ga0075370_10142562 3300006353 Bacteria 1401
88 Ga0068865_100035782 3300006881 Bacteria 3343
89 Ga0097620_100197681 3300006931 Bacteria 2095
90 Ga0079104_1013127 3300006946 Bacteria 2569
91 Ga0105251_10003145 3300009011 Bacteria 12252
92 Ga0105251_10011507 3300009011 Bacteria 5051
93 Ga0105250_10015748 3300009092 Bacteria 3093
94 Ga0105240_10220638 3300009093 Bacteria 2209
95 Ga0105247_10034134 3300009101 Bacteria 3098
96 Ga0105247_10337390 3300009101 Bacteria 1056
97 Ga0105241_10020587 3300009174 Bacteria 4875
98 Ga0105241_10886796 3300009174 Bacteria 827
99 Ga0105248_10377025 3300009177 Bacteria 1597
100 Ga0105237_10009165 3300009545 Bacteria 10629
101 Ga0105237_10085262 3300009545 Bacteria 3149
102 Ga0105238_10002132 3300009551 Bacteria 19985
103 Ga0105238_10129047 3300009551 Bacteria 2507
104 Ga0105249_10000067 3300009553 Bacteria 149492
105 Ga0105249_10379459 3300009553 Bacteria 1439
106 Ga0123340_1057436 3300009763 Bacteria 1214
107 Ga0123341_1015241 3300009765 Bacteria 6858
108 Ga0105239_10185168 3300010375 Bacteria 2330
109 Ga0105246_10097960 3300011119 Bacteria 2129
110 Ga0157373_10132856 3300013100 Bacteria 1750
111 Ga0157370_10188461 3300013104 Bacteria 1915
112 Ga0171463_1002 3300013249 Bacteria 1274851
113 Ga0157372_10707503 3300013307 Bacteria 1172
114 Ga0182008_10054589 3300014497 Bacteria 1976
115 Ga0157376_10017553 3300014969 Bacteria 5463
116 Ga0183362_10187 3300015683 Bacteria 1089
117 Ga0163161_10016641 3300017792 Bacteria 5136
118 Ga0163161_10229869 3300017792 Bacteria 1439
119 Ga0214544_1000158 3300021320 Bacteria 101943
120 Ga0214542_1001567 3300021321 Bacteria 47020
121 Ga0214543_1000234 3300021327 Bacteria 84243
122 Ga0213872_10001676 3300021361 Bacteria 13947
123 Ga0209436_100556 3300025208 Bacteria 16119
124 Ga0209147_101850 3300025229 Bacteria 6493
125 Ga0207425_1002235 3300025245 Bacteria 7013
126 Ga0207425_1016217 3300025245 Bacteria 1657
127 Ga0209129_1000424 3300025258 Bacteria 32069
128 Ga0209129_1000893 3300025258 Bacteria 18322
129 Ga0209129_1003902 3300025258 Bacteria 6200
130 Ga0209233_1000164 3300025261 Bacteria 152430
131 Ga0209673_1000005 3300025273 Bacteria 692788
132 Ga0209130_1000010 3300025284 Bacteria 444920
133 Ga0209130_1000098 3300025284 Bacteria 142506
134 Ga0209676_1001442 3300025292 Bacteria 22406
135 Ga0209676_1020842 3300025292 Bacteria 2213
136 Ga0209025_1000234 3300025294 Bacteria 130341
137 Ga0209025_1003645 3300025294 Bacteria 14288
138 Ga0209025_1019918 3300025294 Bacteria 3702
139 Ga0209564_1000025 3300025295 Bacteria 520535
140 Ga0209564_1002096 3300025295 Bacteria 17065
141 Ga0209564_1005198 3300025295 Bacteria 7537
142 Ga0209564_1042898 3300025295 Bacteria 1193
143 Ga0209758_1000983 3300025297 Bacteria 38351
144 Ga0209758_1001815 3300025297 Bacteria 23598
145 Ga0209050_1023211 3300025298 Bacteria 2190
146 Ga0209256_1000209 3300025299 Bacteria 110253
147 Ga0209256_1000311 3300025299 Bacteria 84751
148 Ga0209256_1000477 3300025299 Bacteria 59886
149 Ga0207426_1000036 3300025302 Bacteria 444920
150 Ga0207426_1000069 3300025302 Bacteria 334513
151 Ga0207426_1000968 3300025302 Bacteria 28326
152 Ga0207426_1042259 3300025302 Bacteria 1408
153 Ga0209051_1001099 3300025303 Bacteria 24879
154 Ga0209051_1043404 3300025303 Bacteria 1578
155 Ga0209051_1084336 3300025303 Bacteria 905
156 Ga0209051_1085737 3300025303 Bacteria 892
157 Ga0209257_1018252 3300025304 Bacteria 2711
158 Ga0209257_1018253 3300025304 Bacteria 2711
159 Ga0209257_1029196 3300025304 Bacteria 1800
160 Ga0207697_10237144 3300025315 Bacteria 806
161 Ga0207656_10029806 3300025321 Bacteria 2250
162 Ga0207713_1015851 3300025735 Bacteria 3850
163 Ga0207642_10270110 3300025899 Bacteria 973
164 Ga0207710_10125649 3300025900 Bacteria 1228
165 Ga0207647_10009795 3300025904 Bacteria 6795
166 Ga0207645_10035642 3300025907 Bacteria 3194
167 Ga0207695_10078679 3300025913 Bacteria 3345
168 Ga0207695_10279895 3300025913 Bacteria 1562
169 Ga0207671_10001559 3300025914 Bacteria 26229
170 Ga0207663_10315739 3300025916 Bacteria 1173
171 Ga0207657_10198437 3300025919 Bacteria 1615
172 Ga0207649_10104685 3300025920 Bacteria 1879
173 Ga0207681_10094045 3300025923 Bacteria 2147
174 Ga0207694_10001835 3300025924 Bacteria 17687
175 Ga0207694_10364246 3300025924 Bacteria 1198
176 Ga0207694_10952377 3300025924 Bacteria 726
177 Ga0207650_10029740 3300025925 Bacteria 3929
178 Ga0207687_10430310 3300025927 Bacteria 1091
179 Ga0207700_10007972 3300025928 Bacteria 6522
180 Ga0207644_10123833 3300025931 Bacteria 1971
181 Ga0207706_10005114 3300025933 Bacteria 12242
182 Ga0207706_10032110 3300025933 Bacteria 4675
183 Ga0207670_10123355 3300025936 Bacteria 1887
184 Ga0207665_10105557 3300025939 Bacteria 1973
185 Ga0207691_10075808 3300025940 Bacteria 3032
186 Ga0207711_10218079 3300025941 Bacteria 1744
187 Ga0207679_10106122 3300025945 Bacteria 2207
188 Ga0207667_10235885 3300025949 Bacteria 1872
189 Ga0207667_10596860 3300025949 Bacteria 1114
190 Ga0207712_10000054 3300025961 Bacteria 148878
191 Ga0207712_10013104 3300025961 Bacteria 5312
192 Ga0207668_10037284 3300025972 Bacteria 3252
193 Ga0207640_10207356 3300025981 Bacteria 1490
194 Ga0207639_10001044 3300026041 Bacteria 18817
195 Ga0207639_10006450 3300026041 Bacteria 7978
196 Ga0207639_10094773 3300026041 Bacteria 2397
197 Ga0207678_10008945 3300026067 Bacteria 8818
198 Ga0207678_10045986 3300026067 Bacteria 3775
199 Ga0207678_10513203 3300026067 Bacteria 1046
200 Ga0207708_10021583 3300026075 Bacteria 4857
201 Ga0207702_10005099 3300026078 Bacteria 11548
202 Ga0207702_10457860 3300026078 Bacteria 1239
203 Ga0207641_10149178 3300026088 Bacteria 2116
204 Ga0207648_10055349 3300026089 Bacteria 3463
205 Ga0207674_10004313 3300026116 Bacteria 17140
206 Ga0207675_100055703 3300026118 Bacteria 3689
207 Ga0207683_10016191 3300026121 Bacteria 6348
208 Ga0207683_10173660 3300026121 Bacteria 1952
209 Ga0207698_10222974 3300026142 Bacteria 1705
210 Ga0209389_1000659 3300027296 Bacteria 21422
211 Ga0209589_1000034 3300027357 Bacteria 138086
212 Ga0209489_100009 3300027361 Bacteria 263873
213 Ga0209489_104793 3300027361 Bacteria 24481
214 Ga0209700_100020 3300027363 Bacteria 235733
215 Ga0209813_10000240 3300027866 Bacteria 16302
216 Ga0207428_10107083 3300027907 Bacteria 2154
217 Ga0268266_10288677 3300028379 Bacteria 1527
218 Ga0268265_10000299 3300028380 Bacteria 55179
219 Ga0268264_10006711 3300028381 Bacteria 9672
220 Ga0307515_10011735 3300028794 Bacteria 16580
221 Ga0265328_10029420 3300031239 Bacteria 2051
222 Ga0265331_10006726 3300031250 Bacteria 6740
223 Ga0265331_10021328 3300031250 Bacteria 3317
224 Ga0265327_10071421 3300031251 Bacteria 1737
225 Ga0265316_10021758 3300031344 Bacteria 5423
226 Ga0307408_100029929 3300031548 Bacteria 3777
227 Ga0307408_100044856 3300031548 Bacteria 3153
228 Ga0307408_100116551 3300031548 Bacteria 2062
229 Ga0307508_10061112 3300031616 Bacteria 3330
230 Ga0265314_10158231 3300031711 Bacteria 1381
231 Ga0316576_10038818 3300031727 Bacteria 3416
232 Ga0316576_10159152 3300031727 Bacteria 1703
233 Ga0307413_10315986 3300031824 Bacteria 1191
234 Ga0307410_10222908 3300031852 Bacteria 1451
235 Ga0307412_10134636 3300031911 Bacteria 1800
236 Ga0307409_100020314 3300031995 Bacteria 4523
237 Ga0307414_10504991 3300032004 Bacteria 1070
238 Ga0307411_10416715 3300032005 Bacteria 1114
239 Ga0316584_0026089 3300036712 Bacteria 4292
240 Ga0316584_0233002 3300036712 Bacteria 1349
241 Ga0395900_0064087 3300037418 Bacteria 3778
242 Ga0395905_0000022 3300037471 Bacteria 321527
243 Ga0395905_0029458 3300037471 Bacteria 5172
244 Ga0395905_0342000 3300037471 Bacteria 1387
245 Ga0436361_0012246 3300039447 Bacteria 21495
246 Ga0439436_0002588 3300041404 Bacteria 5446
247 Ga0439465_0026255 3300041413 Bacteria 1841
248 Ga0451849_1264891 3300041505 Bacteria 8051
249 Ga0439448_0070128 3300042005 Bacteria 1167
250 Ga0439452_035757 3300042010 Bacteria 1194
251 Ga0450920_018398 3300042122 Bacteria 1337
252 Ga0450909_006233 3300042185 Bacteria 1721
253 Ga0450918_001885 3300042531 Bacteria 4056
254 Ga0466969_0001849 3300044656 Bacteria 11316
255 Ga0466966_0000273 3300044684 Bacteria 33831
256 Ga0466963_0626706 3300044694 Bacteria 759
257 Ga0466971_0136862 3300044719 Bacteria 1139
258 Ga0466970_0083112 3300044765 Bacteria 1732
259 Ga0466957_0007115 3300044842 Bacteria 6328
260 Ga0466959_0000621 3300045049 Bacteria 20577
261 Ga0466959_0228944 3300045049 Bacteria 1287
262 Ga0495627_000324 3300046453 Bacteria 46576
263 Ga0495638_0000035 3300046460 Bacteria 276385
264 Ga0495605_0001337 3300046474 Bacteria 16311
265 Ga0495584_0022076 3300046491 Bacteria 3230
266 Ga0495585_0006200 3300046492 Bacteria 7451
267 Ga0495583_0001198 3300046506 Bacteria 27870
268 Ga0495606_0347312 3300046507 Bacteria 788
269 Ga0495610_0202935 3300046512 Bacteria 811
270 Ga0495631_0001421 3300046518 Bacteria 14544
271 Ga0495632_0000013 3300046519 Bacteria 247879
272 Ga0495632_0000612 3300046519 Bacteria 32954
273 Ga0495632_0011139 3300046519 Bacteria 5267
274 Ga0495637_0000100 3300046520 Bacteria 65373
275 Ga0495643_0000010 3300046522 Bacteria 341431
276 Ga0495648_0000933 3300046524 Bacteria 30373
277 Ga0495648_0140467 3300046524 Bacteria 1272
278 Ga0495663_0000004 3300046525 Bacteria 355166
279 Ga0495654_0137207 3300046530 Bacteria 1093
280 Ga0495609_0020647 3300046538 Bacteria 3042
281 Ga0495633_0000092 3300046558 Bacteria 121446
282 Ga0495633_0001757 3300046558 Bacteria 16080
283 Ga0495633_0005139 3300046558 Bacteria 8110
284 Ga0495668_0017970 3300046616 Bacteria 4093
285 Ga0495611_0016046 3300046648 Bacteria 3203
286 Ga0495625_0000621 3300046660 Bacteria 51568
287 Ga0495669_0021707 3300046684 Bacteria 2789
288 Ga0495670_0017471 3300046691 Bacteria 3530
289 Ga0495671_0000014 3300046692 Bacteria 341431
290 Ga0495671_0000034 3300046692 Bacteria 195385
291 Ga0495671_0127943 3300046692 Bacteria 1239
292 Ga0495636_0081832 3300047318 Bacteria 1391
293 Ga0495672_0027809 3300047320 Bacteria 3588
294 Ga0495673_0000013 3300047469 Bacteria 612902
295 Ga0495673_0009404 3300047469 Bacteria 5410
296 Ga0495681_0000725 3300047470 Bacteria 25287
297 Ga0495686_0009517 3300047472 Bacteria 6991
298 Ga0495686_0020937 3300047472 Bacteria 4355
299 Ga0496101_0040605 3300048904 Bacteria 3314
300 Ga0496102_0117303 3300048905 Bacteria 2484
301 Ga0496102_0138168 3300048905 Bacteria 2283
302 Ga0496102_0297202 3300048905 Bacteria 1522
303 Ga0496103_0066151 3300048906 Bacteria 2256
304 Ga0496104_0012047 3300048907 Bacteria 7762
305 Ga0496105_0119251 3300048908 Bacteria 2176
306 Ga0496106_0022487 3300048909 Bacteria 4685
307 Ga0496106_0381449 3300048909 Bacteria 1133
308 Ga0496107_0259341 3300048910 Bacteria 1293
309 Ga0496107_0442093 3300048910 Bacteria 966
310 Ga0496108_0003150 3300048911 Bacteria 13268
311 Ga0496108_0290134 3300048911 Bacteria 1424
312 Ga0496109_0014694 3300048912 Bacteria 6814
313 Ga0496109_0193285 3300048912 Bacteria 1912
314 Ga0496110_0091815 3300048913 Bacteria 2717
315 Ga0496110_0102654 3300048913 Bacteria 2564
316 Ga0496110_0145775 3300048913 Bacteria 2141
317 Ga0496111_0042518 3300048914 Bacteria 3263
318 Ga0496111_0086233 3300048914 Bacteria 2297
319 Ga0496112_0029831 3300048915 Bacteria 5277
320 Ga0496112_0298806 3300048915 Bacteria 1556
321 Ga0496114_0436377 3300048917 Bacteria 1160
322 Ga0496114_0612264 3300048917 Bacteria 960
323 Ga0496115_0256465 3300048918 Bacteria 1439
324 Ga0496115_0399298 3300048918 Bacteria 1116
325 Ga0496116_0045398 3300048919 Bacteria 2975
326 Ga0496117_0255656 3300048920 Bacteria 953
327 Ga0496118_0079710 3300048921 Bacteria 2309
328 Ga0496119_0115741 3300048922 Bacteria 1481
329 Ga0496120_0073387 3300048923 Bacteria 1873
330 Ga0496121_0002040 3300048924 Bacteria 31978
331 Ga0496121_0010693 3300048924 Bacteria 10299
332 Ga0496121_0034219 3300048924 Bacteria 4577
333 Ga0496121_0049074 3300048924 Bacteria 3584
334 Ga0496121_0105607 3300048924 Bacteria 2161
335 Ga0496121_0175099 3300048924 Bacteria 1554
336 Ga0496121_0237098 3300048924 Bacteria 1274
337 Ga0496121_0306178 3300048924 Bacteria 1076
338 Ga0496122_0009972 3300048925 Bacteria 9892
339 Ga0496123_0007161 3300048926 Bacteria 10587
340 Ga0496123_0023520 3300048926 Bacteria 4714
341 Ga0496124_0055771 3300048927 Bacteria 3337
342 Ga0496124_0082461 3300048927 Bacteria 2639
343 Ga0496125_0033622 3300048928 Bacteria 4534
344 Ga0496125_0044638 3300048928 Bacteria 3744
345 Ga0496125_0046461 3300048928 Bacteria 3642
346 Ga0496125_0169553 3300048928 Bacteria 1470
347 Ga0496125_0199392 3300048928 Bacteria 1312
348 Ga0496126_0005920 3300048929 Bacteria 13786
349 Ga0496126_0093300 3300048929 Bacteria 2643
350 Ga0496126_0117057 3300048929 Bacteria 2315
351 Ga0496126_0335357 3300048929 Bacteria 1240
352 Ga0496126_0380056 3300048929 Bacteria 1150
353 Ga0496126_0483895 3300048929 Bacteria 991
354 Ga0496126_0858540 3300048929 Unclassified 692
355 Ga0495678_007036 3300049459 Bacteria 5895
356 Ga0495682_0038073 3300049460 Bacteria 1768
357 Ga0501032_0000021 3300049569 Bacteria 146895
358 Ga0501032_0092236 3300049569 Bacteria 2009
359 Ga0501034_0000001 3300049571 Bacteria 2184493
360 Ga0501034_0134285 3300049571 Bacteria 2456
361 Ga0501036_0007144 3300049572 Bacteria 9094
362 Ga0501037_0073697 3300049573 Bacteria 2482
363 Ga0501039_0000029 3300049575 Bacteria 131786
364 Ga0501043_0074288 3300049579 Bacteria 2670
365 Ga0501080_0101832 3300049742 Bacteria 2665
366 Ga0501035_0256261 3300049822 Bacteria 1484
367 nmdc:mga03n38_115367_c1 3300050490 Bacteria 1313
368 nmdc:mga03n38_203159_c1 3300050490 Bacteria 1026
369 nmdc:mga0yw44_103195_c1 3300050492 Bacteria 1818
370 nmdc:mga0yw44_15269_c1 3300050492 Bacteria 4107
371 nmdc:mga0yw44_26034_c1 3300050492 Bacteria 3336
372 nmdc:mga06z11_136_c1 3300050494 Bacteria 29270
373 nmdc:mga06z11_35626_c1 3300050494 Bacteria 2451
374 nmdc:mga06z11_45068_c1 3300050494 Bacteria 2228
375 nmdc:mga04h51_18_c1 3300050495 Bacteria 74460
376 nmdc:mga07m45_458638_c1 3300050496 Bacteria 739
377 nmdc:mga07m45_93738_c1 3300050496 Bacteria 1721
378 nmdc:mga08y16_514108_c1 3300050511 Bacteria 1215
379 nmdc:mga0sz30_227531_c1 3300050516 Bacteria 829
380 nmdc:mga0sz30_24246_c1 3300050516 Bacteria 2474
381 nmdc:mga0sz30_3680_c1 3300050516 Bacteria 4272
382 Ga0500610_0013892 3300053079 Bacteria 3762
383 Ga0500643_066130 3300053087 Bacteria 1008
384 Ga0500562_009017 3300053108 Bacteria 2520
385 Ga0500592_023472 3300053116 Bacteria 994
386 Ga0500594_0000401 3300053118 Bacteria 9623
387 Ga0500607_000003 3300053121 Bacteria 149664
388 Ga0500559_0000400 3300053136 Bacteria 31323
389 Ga0500559_0006664 3300053136 Bacteria 5193
390 Ga0500568_0004550 3300053139 Bacteria 7397
391 Ga0500604_0007886 3300053151 Bacteria 2824
392 Ga0500604_0036302 3300053151 Bacteria 1470
393 Ga0500616_0009034 3300053153 Bacteria 6103
394 Ga0500624_000003 3300053157 Bacteria 253364
395 Ga0500637_0000045 3300053178 Bacteria 44699
396 Ga0500637_0001763 3300053178 Bacteria 9341
397 Ga0500645_041948 3300053730 Bacteria 1350
398 Ga0466962_0014907 3300061719 Bacteria 3746
399 2507506410 2507262055 Bacteria 8048963
400 2508729693 2508501050 Bacteria 9633614
401 2509074016 2508501114 Bacteria 7082538
402 2509149436 2508501128 Bacteria 8613869
403 2511186181 2510917028 Bacteria 6185411
404 2512530153 2512047086 Bacteria 6850303
405 2512645078 2512564014 Bacteria 4639632
406 2513622816 2513237092 Bacteria 8341956
407 2513653281 2513237095 Bacteria 8976980
408 2513658542 2513237096 Bacteria 8722461
409 2513674539 2513237098 Bacteria 9902361
410 2513706220 2513237102 Bacteria 7703324
411 2513860124 2513237137 Bacteria 9558895
412 2513879779 2513237139 Bacteria 8737671
413 2513920658 2513237145 Bacteria 8979722
414 2513999156 2513237159 Bacteria 6810126
415 2514017513 2513237161 Bacteria 8871253
416 2516206025 2516143018 Bacteria 6951533
417 2517108259 2517093001 Bacteria 9002274
418 2517888576 2517572143 Bacteria 9484767
419 2524443337 2524023205 Bacteria 8918781
420 2524463733 2524023210 Bacteria 9029266
421 2524535111 2524023228 Bacteria 10118060
422 2528856960 2528768022 Bacteria 10457665
423 2585164877 2582581283 Bacteria 6030556
424 2585202730 2582581294 Bacteria 6626667
425 2585265255 2582581306 Bacteria 6450535
426 2585385611 2582581865 Bacteria 6644329
427 2585397000 2582581866 Bacteria 6859583
428 2585401641 2582581867 Bacteria 7184437
429 2585821335 2585427590 Bacteria 6824633
430 2588513653 2588253730 Bacteria 6881675
431 2600196507 2599185352 Bacteria 7228948
432 2617353376 2617270735 Bacteria 9163226
433 2643805440 2643221557 Bacteria 7184309
434 2644047276 2643221607 Bacteria 6314006
435 2644069230 2643221610 Bacteria 7480339
436 2644191886 2643221634 Bacteria 6705461
437 2644199647 2643221636 Bacteria 6583769
438 2644379805 2643221668 Bacteria 7306521
439 2644420383 2643221675 Bacteria 7473456
440 2644453909 2643221680 Bacteria 7473610
441 2644480065 2643221686 Bacteria 6310811
442 2644496879 2643221689 Bacteria 6042950
443 2644674947 2643221723 Bacteria 7095460
444 2644686318 2643221726 Bacteria 7455827
445 2657685097 2657244999 Bacteria 5946535
446 2671119756 2667528175 Bacteria 7532676
447 2739308841 2738543024 Bacteria 5603683
448 2745074986 2744054633 Bacteria 8678936
449 2770196119 2767802442 Bacteria 5747986
450 2774871270 2773857925 Bacteria 6472445
451 2776268119 2775506902 Bacteria 6208009
452 2776268178 2775506902 Bacteria 6208009
453 2776272916 2775506902 Bacteria 6208009
454 2776282241 2775506904 Bacteria 5954060
455 2776283312 2775506904 Bacteria 5954060
456 2776283981 2775506904 Bacteria 5954060
457 2792583691 2791355082 Bacteria 5973319
458 2804754930 2802429268 Bacteria 6094027
459 2805922012 2802429603 Bacteria 8777136
460 2818243701 2816332527 Bacteria 8933356
461 2824618352 2824617872 Bacteria 8814715
462 2824626939 2824626560 Bacteria 8813858
463 2824635391 2824635225 Bacteria 8785348
464 2824644230 2824644064 Bacteria 8743947
465 2824704827 2824704595 Bacteria 9667483
466 2824714902 2824714736 Bacteria 8717648
467 2824724034 2824723954 Bacteria 8758240
468 2824754830 2824753945 Bacteria 9787441
469 2824764580 2824763712 Bacteria 9792355
470 2824779612 2824773399 Bacteria 8360218
471 2838124946 2838122688 Bacteria 8803140
472 2840764204 2840764183 Bacteria 6358399
473 2840770499 2840764183 Bacteria 6358399
474 2841957650 2841949485 Bacteria 8680857
475 2841963844 2841957949 Bacteria 8652217
476 2841974170 2841966195 Bacteria 8673214
477 2841976693 2841974524 Bacteria 8931498
478 2841986172 2841983080 Bacteria 8395090
479 2842524901 2842521101 Bacteria 6569494
480 2844168837 2844163670 Bacteria 7266046
481 2847670452 2847670302 Bacteria 6165597
482 2847672758 2847670302 Bacteria 6165597
483 2847933505 2847930680 Bacteria 9342022
484 2847940406 2847939898 Bacteria 8606328
485 2852392568 2852387548 Bacteria 8025568
486 2856314709 2856314179 Bacteria 6477897
487 2856352887 2856349417 Bacteria 6230045
488 2871448703 2871444079 Bacteria 6423508
489 2871492423 2871488783 Bacteria 6929816
490 2874613737 2874612657 Bacteria 8252029
491 2874622101 2874620515 Bacteria 8290088
492 2876365293 2876363079 Bacteria 6544991
493 2876765217 2876761206 Bacteria 10111113
494 2878036210 2878035449 Bacteria 6555736
495 2878758304 2878753008 Bacteria 6922523
496 2879088885 2879083081 Bacteria 8587928
497 2881154884 2881147464 Bacteria 7779814
498 2881158133 2881155292 Bacteria 6461656
499 2881666800 2881665667 Bacteria 8175609
500 2881848392 2881845957 Bacteria 6611900
501 2881860456 2881853255 Bacteria 6698367
502 2881864456 2881861095 Bacteria 7128710
503 2882463142 2882456835 Bacteria 6863978
504 2882919145 2882912400 Bacteria 6801539
505 2885324566 2885318864 Bacteria 6729568
506 2885349189 2885342637 Bacteria 7011821
507 2885352394 2885350715 Bacteria 6787678
508 2885372437 2885366525 Bacteria 8326213
509 2885381799 2885374607 Bacteria 8927485
510 2885383488 2885383462 Bacteria 9473874
511 2888380478 2888378607 Bacteria 9652610
512 2888380692 2888378607 Bacteria 9652610
513 2903496846 2903492973 Bacteria 13473544
514 2903523645 2903521522 Bacteria 6525694
515 2903529944 2903528002 Bacteria 6586099
516 2903754579 2903748898 Bacteria 9972761
517 2904666783 2904666416 Bacteria 8226587
518 2904708184
519 2904713036 2904711408 Bacteria 9771557
520 2906414898 2906414383 Bacteria 6580790
521 2906637739 2906635258 Bacteria 8601019
522 2906650746 2906643746 Bacteria 8722424
523 2906668307 2906660503 Bacteria 8595048
524 2908747112 2908739725 Bacteria 8628932
525 2909046110 2909042592 Bacteria 6499737
526 2913300901 2913295892 Bacteria 6333755
527 2915653580 2915650412 Bacteria 4288180
528 2920761038 2920760137 Bacteria 7427611
529 2920827750 2920822456 Bacteria 6897201
530 2922161596 2922158528 Bacteria 6573167
531 2922434556
532 2924784400 2924784321 Bacteria 7416538
533 2929621646 2929615660 Bacteria 9193770
534 2929631950 2929624759 Bacteria 9339455
535 2933583331 2933577622 Bacteria 9116884
536 2935613975 2935608549 Bacteria 8203142
537 2935637590 2935630451 Bacteria 8169952
538 2935646764 2935638405 Bacteria 10015038
539 2935647712 2935638405 Bacteria 10015038
540 2935674538 2935665750 Bacteria 9571747
541 2935690669 2935684952 Bacteria 9590419
542 2935712409 2935703347 Bacteria 10242284
543 2935717635 2935713505 Bacteria 9608509
544 2935727215 2935722832 Bacteria 9608746
545 2935735985 2935732158 Bacteria 9706831
546 2935744744 2935741537 Bacteria 9707219
547 2935755678 2935750917 Bacteria 9590372
548 2935836046 2935827899 Bacteria 10038562
549 2935836407 2935827899 Bacteria 10038562
550 2935872855 2935864058 Bacteria 9784707
551 2935882169 2935873716 Bacteria 9632195
552 2935889047 2935883170 Bacteria 7964738
553 2936000027 2935992306 Bacteria 9802711
554 2940561041 2940556831 Bacteria 9590747
555 2941514173 2941507105 Bacteria 8166816
556 2941522134 2941515067 Bacteria 8166720
557 2941529872 2941523033 Bacteria 8169134
558 2958119939 2958115193 Bacteria 6923548
559 2961129473 2961127735 Bacteria 7196641
560 2961173504 2961170736 Bacteria 7072258
561 2968005901 2968003550 Bacteria 6929263
562 2970506096 2970503327 Bacteria 7099517
563 2977826836 2977821940 Bacteria 6906439
564 2977834572 2977828996 Bacteria 7007971
565 2979810818 2979808191 Bacteria 7179355
566 2996345585 2996341866 Bacteria 6643098
567 3000142330 3000135777 Bacteria 6891109
568 3002145730 3002141150 Bacteria 5254435
569 3003934867 3003930520 Bacteria 5667563
570 3005450717 3005445848 Bacteria 6906074
571 3005483673 3005474847 Bacteria 9259049
572 3005490718 3005483717 Bacteria 7877331
573 637077895 637000159 Bacteria 7596297
574 637080194 637000159 Bacteria 7596297
575 8002060711 8002060224 Bacteria 4026565
576 8004379818 8004374579 Bacteria 6898112
577 8004705249 8004703790 Bacteria 8006957
578 8006936532 8006933436 Bacteria 10410654
579 8006976498 8006973647 Bacteria 10679141
580 8016613177 8016613128 Bacteria 8794220
581 8019562125 8019555841 Bacteria 9642137
582 8019572191 8019565922 Bacteria 9639779
583 8019585718 8019576017 Bacteria 10049540
584 8019593656 8019586578 Bacteria 10212056
585 8019597769 8019597564 Bacteria 10041141
586 8019610616 8019608314 Bacteria 10042931
587 8049298054 8049293176 Bacteria 6128433
588 8055744153 8055742211 Bacteria 9226248
589 8057580913 8057575449 Bacteria 7367519
590 Ga0495633_0021561
591 SwRhRL2b_contig_544056
592 LJNas_1000298
593 JGI24740J21852_10000308
594 JGI24739J22299_10006801
595 JGI24737J22298_10001465
596 JGI24735J21928_10001446
597 JGI24738J21930_10001077
598 JGI25158J39367_1003058
599 JGI25152J39213_1006345
600 JGI25152J39213_1030113
601 JGI25150J39212_1028387
602 JGI25159J45721_1000005
603 JGI25151J46595_10024486
604 JGI25151J46595_10031690
605 JGI25165J46597_1000104
606 JGI25153J46596_10076674
607 JGI25153J46596_10076677
608 rootH2_10053744
609 rootH2_10053745
610 rootH1_10009808
611 rootH1_10009809
612 JGI25160J50197_1000005
613 JGI25160J50197_1000103
614 JGI25161J50226_1000090
615 JGI25161J50226_1001080
616 Ga0055526_1005069
617 Ga0055526_1026927
618 Ga0055524_1001390
619 Ga0055524_1012397
620 Ga0055524_1025325
621 Ga0055536_1000819
622 Ga0055528_1000900
623 Ga0055528_1004834
624 Ga0055531_10003162
625 Ga0055531_10045753
626 Ga0055543_1000087
627 Ga0055543_1000863
628 Ga0065165_1000002
629 Ga0065165_1000776
630 Ga0065704_10001031
631 Ga0070690_100045659
632 Ga0070670_100033394
633 Ga0070660_100164177
634 Ga0070660_100451431
635 Ga0070661_100103108
636 Ga0070668_100254263
637 Ga0070668_100736862
638 Ga0070669_100146472
639 Ga0070671_100004846
640 Ga0070671_100271287
641 Ga0070688_100101093
642 Ga0070659_100022429
643 Ga0070667_100064738
644 Ga0070667_100261955
645 Ga0070714_100045580
646 Ga0070713_100023480
647 Ga0070711_100374059
648 Ga0070663_100026232
649 Ga0070662_100038601
650 Ga0070662_100634312
651 Ga0068867_100050994
652 Ga0068853_100184628
653 Ga0070686_100017785
654 Ga0070665_100003281
655 Ga0070665_100573167
656 Ga0068855_100584955
657 Ga0068855_100597632
658 Ga0070664_100246013
659 Ga0068857_100283466
660 Ga0068856_100022327
661 Ga0068856_100412253
662 Ga0068859_100197678
663 Ga0068866_10008562
664 Ga0068863_100054416
665 Ga0068860_100006693
666 Ga0068862_100000291
667 Ga0081540_1015015
668 Ga0075365_10328249
669 Ga0075363_100322228
670 Ga0075367_10000664
671 Ga0075367_10042598
672 Ga0075369_10003293
673 Ga0075369_10075475
674 Ga0075370_10087630
675 Ga0075370_10142562
676 Ga0068865_100035782
677 Ga0097620_100197681
678 Ga0079104_1013127
679 Ga0105251_10003145
680 Ga0105251_10011507
681 Ga0105250_10015748
682 Ga0105240_10220638
683 Ga0105247_10034134
684 Ga0105247_10337390
685 Ga0105241_10020587
686 Ga0105241_10886796
687 Ga0105248_10377025
688 Ga0105237_10009165
689 Ga0105237_10085262
690 Ga0105238_10002132
691 Ga0105238_10129047
692 Ga0105249_10000067
693 Ga0105249_10379459
694 Ga0123340_1057436
695 Ga0123341_1015241
696 Ga0105239_10185168
697 Ga0105246_10097960
698 Ga0157373_10132856
699 Ga0157370_10188461
700 Ga0171463_1002
701 Ga0157372_10707503
702 Ga0182008_10054589
703 Ga0157376_10017553
704 Ga0183362_10187
705 Ga0163161_10016641
706 Ga0163161_10229869
707 Ga0214544_1000158
708 Ga0214542_1001567
709 Ga0214543_1000234
710 Ga0213872_10001676
711 Ga0209436_100556
712 Ga0209147_101850
713 Ga0207425_1002235
714 Ga0207425_1016217
715 Ga0209129_1000424
716 Ga0209129_1000893
717 Ga0209129_1003902
718 Ga0209233_1000164
719 Ga0209673_1000005
720 Ga0209130_1000010
721 Ga0209130_1000098
722 Ga0209676_1001442
723 Ga0209676_1020842
724 Ga0209025_1000234
725 Ga0209025_1003645
726 Ga0209025_1019918
727 Ga0209564_1000025
728 Ga0209564_1002096
729 Ga0209564_1005198
730 Ga0209564_1042898
731 Ga0209758_1000983
732 Ga0209758_1001815
733 Ga0209050_1023211
734 Ga0209256_1000209
735 Ga0209256_1000311
736 Ga0209256_1000477
737 Ga0207426_1000036
738 Ga0207426_1000069
739 Ga0207426_1000968
740 Ga0207426_1042259
741 Ga0209051_1001099
742 Ga0209051_1043404
743 Ga0209051_1084336
744 Ga0209051_1085737
745 Ga0209257_1018252
746 Ga0209257_1018253
747 Ga0209257_1029196
748 Ga0207697_10237144
749 Ga0207656_10029806
750 Ga0207713_1015851
751 Ga0207642_10270110
752 Ga0207710_10125649
753 Ga0207647_10009795
754 Ga0207645_10035642
755 Ga0207695_10078679
756 Ga0207695_10279895
757 Ga0207671_10001559
758 Ga0207663_10315739
759 Ga0207657_10198437
760 Ga0207649_10104685
761 Ga0207681_10094045
762 Ga0207694_10001835
763 Ga0207694_10364246
764 Ga0207694_10952377
765 Ga0207650_10029740
766 Ga0207687_10430310
767 Ga0207700_10007972
768 Ga0207644_10123833
769 Ga0207706_10005114
770 Ga0207706_10032110
771 Ga0207670_10123355
772 Ga0207665_10105557
773 Ga0207691_10075808
774 Ga0207711_10218079
775 Ga0207679_10106122
776 Ga0207667_10235885
777 Ga0207667_10596860
778 Ga0207712_10000054
779 Ga0207712_10013104
780 Ga0207668_10037284
781 Ga0207640_10207356
782 Ga0207639_10001044
783 Ga0207639_10006450
784 Ga0207639_10094773
785 Ga0207678_10008945
786 Ga0207678_10045986
787 Ga0207678_10513203
788 Ga0207708_10021583
789 Ga0207702_10005099
790 Ga0207702_10457860
791 Ga0207641_10149178
792 Ga0207648_10055349
793 Ga0207674_10004313
794 Ga0207675_100055703
795 Ga0207683_10016191
796 Ga0207683_10173660
797 Ga0207698_10222974
798 Ga0209389_1000659
799 Ga0209589_1000034
800 Ga0209489_100009
801 Ga0209489_104793
802 Ga0209700_100020
803 Ga0209813_10000240
804 Ga0207428_10107083
805 Ga0268266_10288677
806 Ga0268265_10000299
807 Ga0268264_10006711
808 Ga0307515_10011735
809 Ga0265328_10029420
810 Ga0265331_10006726
811 Ga0265331_10021328
812 Ga0265327_10071421
813 Ga0265316_10021758
814 Ga0307408_100029929
815 Ga0307408_100044856
816 Ga0307408_100116551
817 Ga0307508_10061112
818 Ga0265314_10158231
819 Ga0316576_10038818
820 Ga0316576_10159152
821 Ga0307413_10315986
822 Ga0307410_10222908
823 Ga0307412_10134636
824 Ga0307409_100020314
825 Ga0307414_10504991
826 Ga0307411_10416715
827 Ga0316584_0026089
828 Ga0316584_0233002
829 Ga0395900_0064087
830 Ga0395905_0000022
831 Ga0395905_0029458
832 Ga0395905_0342000
833 Ga0436361_0012246
834 Ga0439436_0002588
835 Ga0439465_0026255
836 Ga0451849_1264891
837 Ga0439448_0070128
838 Ga0439452_035757
839 Ga0450920_018398
840 Ga0450909_006233
841 Ga0450918_001885
842 Ga0466969_0001849
843 Ga0466966_0000273
844 Ga0466963_0626706
845 Ga0466971_0136862
846 Ga0466970_0083112
847 Ga0466957_0007115
848 Ga0466959_0000621
849 Ga0466959_0228944
850 Ga0495627_000324
851 Ga0495638_0000035
852 Ga0495605_0001337
853 Ga0495584_0022076
854 Ga0495585_0006200
855 Ga0495583_0001198
856 Ga0495606_0347312
857 Ga0495610_0202935
858 Ga0495631_0001421
859 Ga0495632_0000013
860 Ga0495632_0000612
861 Ga0495632_0011139
862 Ga0495637_0000100
863 Ga0495643_0000010
864 Ga0495648_0000933
865 Ga0495648_0140467
866 Ga0495663_0000004
867 Ga0495654_0137207
868 Ga0495609_0020647
869 Ga0495633_0000092
870 Ga0495633_0001757
871 Ga0495633_0005139
872 Ga0495668_0017970
873 Ga0495611_0016046
874 Ga0495625_0000621
875 Ga0495669_0021707
876 Ga0495670_0017471
877 Ga0495671_0000014
878 Ga0495671_0000034
879 Ga0495671_0127943
880 Ga0495636_0081832
881 Ga0495672_0027809
882 Ga0495673_0000013
883 Ga0495673_0009404
884 Ga0495681_0000725
885 Ga0495686_0009517
886 Ga0495686_0020937
887 Ga0496101_0040605
888 Ga0496102_0117303
889 Ga0496102_0138168
890 Ga0496102_0297202
891 Ga0496103_0066151
892 Ga0496104_0012047
893 Ga0496105_0119251
894 Ga0496106_0022487
895 Ga0496106_0381449
896 Ga0496107_0259341
897 Ga0496107_0442093
898 Ga0496108_0003150
899 Ga0496108_0290134
900 Ga0496109_0014694
901 Ga0496109_0193285
902 Ga0496110_0091815
903 Ga0496110_0102654
904 Ga0496110_0145775
905 Ga0496111_0042518
906 Ga0496111_0086233
907 Ga0496112_0029831
908 Ga0496112_0298806
909 Ga0496114_0436377
910 Ga0496114_0612264
911 Ga0496115_0256465
912 Ga0496115_0399298
913 Ga0496116_0045398
914 Ga0496117_0255656
915 Ga0496118_0079710
916 Ga0496119_0115741
917 Ga0496120_0073387
918 Ga0496121_0002040
919 Ga0496121_0010693
920 Ga0496121_0034219
921 Ga0496121_0049074
922 Ga0496121_0105607
923 Ga0496121_0175099
924 Ga0496121_0237098
925 Ga0496121_0306178
926 Ga0496122_0009972
927 Ga0496123_0007161
928 Ga0496123_0023520
929 Ga0496124_0055771
930 Ga0496124_0082461
931 Ga0496125_0033622
932 Ga0496125_0044638
933 Ga0496125_0046461
934 Ga0496125_0169553
935 Ga0496125_0199392
936 Ga0496126_0005920
937 Ga0496126_0093300
938 Ga0496126_0117057
939 Ga0496126_0335357
940 Ga0496126_0380056
941 Ga0496126_0483895
942 Ga0496126_0858540
943 Ga0495678_007036
944 Ga0495682_0038073
945 Ga0501032_0000021
946 Ga0501032_0092236
947 Ga0501034_0000001
948 Ga0501034_0134285
949 Ga0501036_0007144
950 Ga0501037_0073697
951 Ga0501039_0000029
952 Ga0501043_0074288
953 Ga0501080_0101832
954 Ga0501035_0256261
955 nmdc:mga03n38_115367_c1
956 nmdc:mga03n38_203159_c1
957 nmdc:mga0yw44_103195_c1
958 nmdc:mga0yw44_15269_c1
959 nmdc:mga0yw44_26034_c1
960 nmdc:mga06z11_136_c1
961 nmdc:mga06z11_35626_c1
962 nmdc:mga06z11_45068_c1
963 nmdc:mga04h51_18_c1
964 nmdc:mga07m45_458638_c1
965 nmdc:mga07m45_93738_c1
966 nmdc:mga08y16_514108_c1
967 nmdc:mga0sz30_227531_c1
968 nmdc:mga0sz30_24246_c1
969 nmdc:mga0sz30_3680_c1
970 Ga0500610_0013892
971 Ga0500643_066130
972 Ga0500562_009017
973 Ga0500592_023472
974 Ga0500594_0000401
975 Ga0500607_000003
976 Ga0500559_0000400
977 Ga0500559_0006664
978 Ga0500568_0004550
979 Ga0500604_0007886
980 Ga0500604_0036302
981 Ga0500616_0009034
982 Ga0500624_000003
983 Ga0500637_0000045
984 Ga0500637_0001763
985 Ga0500645_041948
986 Ga0466962_0014907
987 2507506410
988 2508729693
989 2509074016
990 2509149436
991 2511186181
992 2512530153
993 2512645078
994 2513622816
995 2513653281
996 2513658542
997 2513674539
998 2513706220
999 2513860124
1000 2513879779
1001 2513920658
1002 2513999156
1003 2514017513
1004 2516206025
1005 2517108259
1006 2517888576
1007 2524443337
1008 2524463733
1009 2524535111
1010 2528856960
1011 2585164877
1012 2585202730
1013 2585265255
1014 2585385611
1015 2585397000
1016 2585401641
1017 2585821335
1018 2588513653
1019 2600196507
1020 2617353376
1021 2643805440
1022 2644047276
1023 2644069230
1024 2644191886
1025 2644199647
1026 2644379805
1027 2644420383
1028 2644453909
1029 2644480065
1030 2644496879
1031 2644674947
1032 2644686318
1033 2657685097
1034 2671119756
1035 2739308841
1036 2745074986
1037 2770196119
1038 2774871270
1039 2776268119
1040 2776268178
1041 2776272916
1042 2776282241
1043 2776283312
1044 2776283981
1045 2792583691
1046 2804754930
1047 2805922012
1048 2818243701
1049 2824618352
1050 2824626939
1051 2824635391
1052 2824644230
1053 2824704827
1054 2824714902
1055 2824724034
1056 2824754830
1057 2824764580
1058 2824779612
1059 2838124946
1060 2840764204
1061 2840770499
1062 2841957650
1063 2841963844
1064 2841974170
1065 2841976693
1066 2841986172
1067 2842524901
1068 2844168837
1069 2847670452
1070 2847672758
1071 2847933505
1072 2847940406
1073 2852392568
1074 2856314709
1075 2856352887
1076 2871448703
1077 2871492423
1078 2874613737
1079 2874622101
1080 2876365293
1081 2876765217
1082 2878036210
1083 2878758304
1084 2879088885
1085 2881154884
1086 2881158133
1087 2881666800
1088 2881848392
1089 2881860456
1090 2881864456
1091 2882463142
1092 2882919145
1093 2885324566
1094 2885349189
1095 2885352394
1096 2885372437
1097 2885381799
1098 2885383488
1099 2888380478
1100 2888380692
1101 2903496846
1102 2903523645
1103 2903529944
1104 2903754579
1105 2904666783
1106 2904708184
1107 2904713036
1108 2906414898
1109 2906637739
1110 2906650746
1111 2906668307
1112 2908747112
1113 2909046110
1114 2913300901
1115 2915653580
1116 2920761038
1117 2920827750
1118 2922161596
1119 2922434556
1120 2924784400
1121 2929621646
1122 2929631950
1123 2933583331
1124 2935613975
1125 2935637590
1126 2935646764
1127 2935647712
1128 2935674538
1129 2935690669
1130 2935712409
1131 2935717635
1132 2935727215
1133 2935735985
1134 2935744744
1135 2935755678
1136 2935836046
1137 2935836407
1138 2935872855
1139 2935882169
1140 2935889047
1141 2936000027
1142 2940561041
1143 2941514173
1144 2941522134
1145 2941529872
1146 2958119939
1147 2961129473
1148 2961173504
1149 2968005901
1150 2970506096
1151 2977826836
1152 2977834572
1153 2979810818
1154 2996345585
1155 3000142330
1156 3002145730
1157 3003934867
1158 3005450717
1159 3005483673
1160 3005490718
1161 637077895
1162 637080194
1163 8002060711
1164 8004379818
1165 8004705249
1166 8006936532
1167 8006976498
1168 8016613177
1169 8019562125
1170 8019572191
1171 8019585718
1172 8019593656
1173 8019597769
1174 8019610616
1175 8049298054
1176 8055744153
1177 8057580913

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13500

AAA_26

AAA domain

17

206

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e06-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis dethiobiotin synthetase in complex with cytidine triphosphate solved by precipitant-ligand exchange (crystals grown in citrate precipitant) 0.8698 2 203
1dae-assembly1.cif.gz_A dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid 0.8655 1 192
1a82-assembly1.cif.gz_A dethiobiotin synthetase from escherichia coli, complex with substrates atp and diaminopelargonic acid 0.8613 1 203
6e06-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis dethiobiotin synthetase in complex with cytidine triphosphate solved by precipitant-ligand exchange (crystals grown in citrate precipitant) 0.8579 2 203
3fmf-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate 0.8562 1 203
ID Description Score Start End Superfamily
af_A0A1D8PS31_1_209_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9339 1 198 3.40.50.300
af_A0A1D8PS31_1_209_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9031 1 198 3.40.50.300
af_P53630_6_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8881 1 203 3.40.50.300
af_P53630_6_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8799 1 203 3.40.50.300
af_Q58695_1_213_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8764 4 181 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A090DLV9-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 0.9899 16 189 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A7R6X6S8-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 0.9895 1 203 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A090DP39-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 0.989 1 189 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A434R3N8-F1-model_v4 Dethiobiotin synthase (EC 6.3.3.3) 0.9888 1 176 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A2S9QBU3-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 0.9876 2 201 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102

Map