metagRoot

F466816

General Info

Members	Datasets	Scaffolds	Average Seq Length
588	299	585	251

Family's Representative Sequence

Representative Sequence	3300050511\|nmdc:mga08y16_1262563_c1\|nmdc:mga08y16_1262563_c1_29_697
Length	222
Sequence	LQAAKIAIEAGADGITAHLREDRRHIRDDDIARLKAELGKPLNLEMAATDEMVAIAIKTRPHAACLVPERREERTTEGGLDVAGQREQLAPAVARLRRAGIRVSLFIAADPAQIEAAAAVGAPVIEIHTGAWCDALAERRAAAQAEWERIESGARLARRLGLEVHAGHGLNYATAEAIAALPEIVELNIGHFLVGEAVYGGLARSVQAMRAAMDRGRAKVAR

Samples

	Sample ID	Description	Type	Environment
1	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
2	2643221547	Pseudolabrys sp. Root1462	Isolate	Unclassified
3	2842694124	Methylopila sp. R-72369	Isolate	Unclassified
4	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
5	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
6	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
7	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
8	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
9	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
10	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
11	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
12	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
13	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
14	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
15	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
16	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
17	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
18	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
19	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
20	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
21	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
22	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
23	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
24	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
25	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
26	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
27	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
28	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
29	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
30	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
31	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
32	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
33	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
34	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
35	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
36	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
37	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
38	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
39	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
40	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
41	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
42	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
43	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
44	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
45	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
46	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
47	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
48	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
49	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
50	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
51	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
52	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
53	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
54	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
55	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
56	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
57	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
58	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
59	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
60	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
61	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
62	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
63	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
64	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
65	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
66	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
67	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
69	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
70	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
71	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
72	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
73	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
74	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
75	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
76	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
77	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
78	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
79	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
80	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
81	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
82	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
83	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
84	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
85	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
86	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
87	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
88	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
89	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
90	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
91	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
92	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
137	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
138	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
139	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
140	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
141	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
142	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
143	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
144	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
145	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
146	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
147	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
148	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
149	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
150	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
151	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
152	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
153	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
154	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
155	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
156	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
157	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
158	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
159	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
160	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
161	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
162	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
163	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
164	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
165	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
166	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
167	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
168	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
169	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
170	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
171	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
172	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
173	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
174	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
175	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
176	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
177	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
178	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
179	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
180	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
181	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
182	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
183	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
184	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
185	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
186	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
187	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
188	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
189	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
190	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
191	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
192	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
193	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
194	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
195	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
196	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
197	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
198	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
199	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
200	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
201	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
202	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
203	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
204	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
205	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
206	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
207	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
208	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
209	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
210	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
211	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
212	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
213	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
214	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
215	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
216	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
217	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
218	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
219	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
220	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
221	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
222	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
223	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
224	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
225	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
226	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
227	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
228	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
229	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
230	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
231	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
232	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
233	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
234	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
235	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
236	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
237	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
238	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
239	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
240	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
241	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
242	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
243	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
244	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
245	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
246	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
247	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
248	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
249	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
250	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
251	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
252	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
253	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
254	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
255	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
256	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
257	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
258	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
259	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
260	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
261	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
262	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
263	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
264	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
265	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
266	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
267	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
268	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
269	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
270	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
271	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
272	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
273	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
274	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
275	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
276	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
277	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
278	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
279	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
280	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
281	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
282	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
283	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
284	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
285	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
286	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
287	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
288	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
289	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
290	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
291	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
292	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
293	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
294	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
295	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
296	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
297	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
298	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
299	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.49
Metatranscriptomes	0
Isolates	0.51

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.72
Nodule	0
Rhizoplane	8.16
Rhizosphere	87.76
Stem	0
Stem Tuber	0
Unclassified	1.36

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25405J52794_10000800	3300003911	Bacteria	4864
2	Ga0070658_10188437	3300005327	Bacteria	1738
3	Ga0070683_100070886	3300005329	Bacteria	3251
4	Ga0070683_100099908	3300005329	Bacteria	2731
5	Ga0070666_10011375	3300005335	Bacteria	5582
6	Ga0070680_100004867	3300005336	Bacteria	10108
7	Ga0070682_100349270	3300005337	Bacteria	1102
8	Ga0068868_100023450	3300005338	Bacteria	4670
9	Ga0070660_100032134	3300005339	Bacteria	3948
10	Ga0070660_100405492	3300005339	Bacteria	1128
11	Ga0070689_100009567	3300005340	Bacteria	6875
12	Ga0070689_100393047	3300005340	Bacteria	1171
13	Ga0070671_100018495	3300005355	Bacteria	5661
14	Ga0070674_100412187	3300005356	Bacteria	1106
15	Ga0070673_100181383	3300005364	Bacteria	1803
16	Ga0070688_100004816	3300005365	Bacteria	7056
17	Ga0070659_100231424	3300005366	Bacteria	1527
18	Ga0070709_10001542	3300005434	Bacteria	12436
19	Ga0070709_10005230	3300005434	Bacteria	7021
20	Ga0070709_10083478	3300005434	Bacteria	2090
21	Ga0070709_10118900	3300005434	Bacteria	1788
22	Ga0070714_100000559	3300005435	Bacteria	26789
23	Ga0070714_100056948	3300005435	Bacteria	3344
24	Ga0070713_100001362	3300005436	Bacteria	15628
25	Ga0070713_100004605	3300005436	Bacteria	9295
26	Ga0070713_100573671	3300005436	Bacteria	1070
27	Ga0070710_10005369	3300005437	Bacteria	6080
28	Ga0070710_10282857	3300005437	Bacteria	1077
29	Ga0070711_100033678	3300005439	Bacteria	3412
30	Ga0070711_100164009	3300005439	Bacteria	1687
31	Ga0070711_100178727	3300005439	Bacteria	1623
32	Ga0070705_100014364	3300005440	Bacteria	4071
33	Ga0070705_100364063	3300005440	Bacteria	1059
34	Ga0070678_100012718	3300005456	Bacteria	5246
35	Ga0070678_100067594	3300005456	Bacteria	2661
36	Ga0070681_10002364	3300005458	Bacteria	17222
37	Ga0070681_10072782	3300005458	Bacteria	3399
38	Ga0070681_10193174	3300005458	Bacteria	1955
39	Ga0070681_10290320	3300005458	Bacteria	1545
40	Ga0070685_10004064	3300005466	Bacteria	7390
41	Ga0070699_100012701	3300005518	Bacteria	7260
42	Ga0070679_100124940	3300005530	Bacteria	2556
43	Ga0070679_100223319	3300005530	Bacteria	1844
44	Ga0070679_100543405	3300005530	Bacteria	1106
45	Ga0070684_100347842	3300005535	Bacteria	1363
46	Ga0070684_100934828	3300005535	Bacteria	813
47	Ga0070697_100001287	3300005536	Bacteria	18887
48	Ga0070686_100042775	3300005544	Bacteria	2839
49	Ga0070695_100052788	3300005545	Bacteria	2613
50	Ga0070693_100465846	3300005547	Bacteria	890
51	Ga0070704_100019574	3300005549	Bacteria	4351
52	Ga0068855_100063428	3300005563	Bacteria	4312
53	Ga0068855_100129124	3300005563	Bacteria	2887
54	Ga0068852_100209287	3300005616	Bacteria	1849
55	Ga0068864_100016492	3300005618	Bacteria	6148
56	Ga0068861_100637039	3300005719	Bacteria	983
57	Ga0068851_10137669	3300005834	Bacteria	1325
58	Ga0068860_100083855	3300005843	Bacteria	3032
59	Ga0081455_10002008	3300005937	Bacteria	24313
60	Ga0081540_1002145	3300005983	Bacteria	16405
61	Ga0070717_10000682	3300006028	Bacteria	21865
62	Ga0070717_10001577	3300006028	Bacteria	15764
63	Ga0075365_10073540	3300006038	Bacteria	2304
64	Ga0075368_10028979	3300006042	Bacteria	2140
65	Ga0070715_10000454	3300006163	Bacteria	10581
66	Ga0070715_10090426	3300006163	Bacteria	1407
67	Ga0070716_100014295	3300006173	Bacteria	4064
68	Ga0070716_100093485	3300006173	Bacteria	1826
69	Ga0070712_100027864	3300006175	Bacteria	3775
70	Ga0070712_100098916	3300006175	Bacteria	2152
71	Ga0070712_100294492	3300006175	Bacteria	1311
72	Ga0070712_100311797	3300006175	Bacteria	1277
73	Ga0070712_100530894	3300006175	Bacteria	989
74	Ga0070712_100611674	3300006175	Bacteria	923
75	Ga0075367_10016210	3300006178	Bacteria	4068
76	Ga0075369_10026897	3300006186	Bacteria	2401
77	Ga0075366_10054551	3300006195	Bacteria	2374
78	Ga0075370_10087724	3300006353	Bacteria	1793
79	Ga0068871_100082011	3300006358	Bacteria	2673
80	Ga0075428_100107733	3300006844	Bacteria	3037
81	Ga0075430_100003454	3300006846	Bacteria	13221
82	Ga0075430_100249393	3300006846	Bacteria	1471
83	Ga0075431_100087926	3300006847	Bacteria	3206
84	Ga0075431_100939701	3300006847	Bacteria	833
85	Ga0075433_10136948	3300006852	Bacteria	2177
86	Ga0075434_100025598	3300006871	Bacteria	5773
87	Ga0075434_100171071	3300006871	Bacteria	2192
88	Ga0075434_100225920	3300006871	Bacteria	1892
89	Ga0075436_100005894	3300006914	Bacteria	8414
90	Ga0075436_100048855	3300006914	Bacteria	2919
91	Ga0075436_100091790	3300006914	Bacteria	2111
92	Ga0075435_100064586	3300007076	Bacteria	2974
93	Ga0099794_10008039	3300007265	Bacteria	4364
94	Ga0105251_10022324	3300009011	Bacteria	3287
95	Ga0105240_10060369	3300009093	Bacteria	4727
96	Ga0105240_10270934	3300009093	Bacteria	1955
97	Ga0105240_10647764	3300009093	Bacteria	1158
98	Ga0111539_11069313	3300009094	Bacteria	938
99	Ga0105245_10189471	3300009098	Bacteria	1969
100	Ga0105247_10052193	3300009101	Bacteria	2521
101	Ga0114129_10301176	3300009147	Bacteria	2137
102	Ga0114129_10416380	3300009147	Bacteria	1768
103	Ga0105243_10087097	3300009148	Bacteria	2563
104	Ga0105243_10279394	3300009148	Bacteria	1503
105	Ga0105241_10132541	3300009174	Bacteria	2020
106	Ga0105242_10018737	3300009176	Bacteria	5415
107	Ga0105242_10025599	3300009176	Bacteria	4671
108	Ga0105248_10059782	3300009177	Bacteria	4281
109	Ga0105237_10061713	3300009545	Bacteria	3747
110	Ga0105238_10060359	3300009551	Bacteria	3797
111	Ga0105249_10002447	3300009553	Bacteria	16119
112	Ga0099796_10000676	3300010159	Bacteria	5984
113	Ga0105239_10330254	3300010375	Bacteria	1720
114	Ga0105246_10460478	3300011119	Bacteria	1071
115	Ga0157373_10062214	3300013100	Bacteria	2643
116	Ga0157371_10037573	3300013102	Bacteria	3465
117	Ga0157370_10040663	3300013104	Bacteria	4489
118	Ga0157369_10108649	3300013105	Bacteria	2950
119	Ga0157369_10135175	3300013105	Bacteria	2611
120	Ga0157374_10038478	3300013296	Bacteria	4397
121	Ga0163162_10779514	3300013306	Bacteria	1074
122	Ga0157372_10040754	3300013307	Bacteria	5132
123	Ga0157372_10501149	3300013307	Bacteria	1416
124	Ga0157375_10148155	3300013308	Bacteria	2480
125	Ga0163163_10004442	3300014325	Bacteria	11963
126	Ga0163163_10160575	3300014325	Bacteria	2293
127	Ga0163163_10184672	3300014325	Bacteria	2133
128	Ga0157380_10132788	3300014326	Bacteria	2127
129	Ga0157379_10006702	3300014968	Bacteria	9947
130	Ga0157376_10127036	3300014969	Bacteria	2269
131	Ga0157376_10289323	3300014969	Bacteria	1546
132	Ga0163161_10382861	3300017792	Bacteria	1125
133	Ga0209758_1000362	3300025297	Bacteria	80796
134	Ga0209758_1024489	3300025297	Bacteria	2687
135	Ga0207653_10078361	3300025885	Bacteria	1140
136	Ga0207692_10001903	3300025898	Bacteria	7936
137	Ga0207692_10001984	3300025898	Bacteria	7809
138	Ga0207692_10185858	3300025898	Bacteria	1213
139	Ga0207710_10029677	3300025900	Bacteria	2382
140	Ga0207688_10101061	3300025901	Bacteria	1665
141	Ga0207685_10000129	3300025905	Bacteria	11233
142	Ga0207685_10012698	3300025905	Bacteria	2580
143	Ga0207685_10104683	3300025905	Bacteria	1216
144	Ga0207699_10001379	3300025906	Bacteria	11559
145	Ga0207699_10002260	3300025906	Bacteria	9089
146	Ga0207705_10166353	3300025909	Bacteria	1659
147	Ga0207684_10199146	3300025910	Bacteria	1728
148	Ga0207707_10137342	3300025912	Bacteria	2137
149	Ga0207707_10146921	3300025912	Bacteria	2061
150	Ga0207707_10475862	3300025912	Bacteria	1067
151	Ga0207695_10057842	3300025913	Bacteria	4027
152	Ga0207695_10275198	3300025913	Bacteria	1578
153	Ga0207693_10012558	3300025915	Bacteria	6841
154	Ga0207693_10021552	3300025915	Bacteria	5120
155	Ga0207693_10022132	3300025915	Bacteria	5054
156	Ga0207693_10049882	3300025915	Bacteria	3287
157	Ga0207693_10126403	3300025915	Bacteria	2010
158	Ga0207663_10168014	3300025916	Bacteria	1555
159	Ga0207663_10205325	3300025916	Bacteria	1424
160	Ga0207660_10010007	3300025917	Bacteria	6143
161	Ga0207660_10435253	3300025917	Bacteria	1059
162	Ga0207657_10045769	3300025919	Bacteria	3837
163	Ga0207657_10049049	3300025919	Bacteria	3682
164	Ga0207657_10065752	3300025919	Bacteria	3090
165	Ga0207657_10106568	3300025919	Bacteria	2319
166	Ga0207652_10157024	3300025921	Bacteria	2038
167	Ga0207652_10167764	3300025921	Bacteria	1969
168	Ga0207652_10193995	3300025921	Bacteria	1827
169	Ga0207652_10279215	3300025921	Bacteria	1507
170	Ga0207694_10119594	3300025924	Bacteria	2102
171	Ga0207687_10091146	3300025927	Bacteria	2223
172	Ga0207700_10133216	3300025928	Bacteria	2032
173	Ga0207700_10164091	3300025928	Bacteria	1847
174	Ga0207664_10086609	3300025929	Bacteria	2559
175	Ga0207664_10179412	3300025929	Bacteria	1817
176	Ga0207644_10063441	3300025931	Bacteria	2682
177	Ga0207644_10474069	3300025931	Bacteria	1030
178	Ga0207690_10130825	3300025932	Bacteria	1837
179	Ga0207690_10152384	3300025932	Bacteria	1715
180	Ga0207706_10004929	3300025933	Bacteria	12468
181	Ga0207706_10428849	3300025933	Bacteria	1145
182	Ga0207686_10007788	3300025934	Bacteria	5774
183	Ga0207686_10543243	3300025934	Bacteria	907
184	Ga0207670_10019607	3300025936	Bacteria	4134
185	Ga0207670_10499269	3300025936	Bacteria	988
186	Ga0207704_10025075	3300025938	Bacteria	3248
187	Ga0207704_10309837	3300025938	Bacteria	1213
188	Ga0207665_10002006	3300025939	Bacteria	13719
189	Ga0207665_10024282	3300025939	Bacteria	3997
190	Ga0207665_10040061	3300025939	Bacteria	3125
191	Ga0207665_10415942	3300025939	Bacteria	1026
192	Ga0207691_10113278	3300025940	Bacteria	2410
193	Ga0207661_10098844	3300025944	Bacteria	2446
194	Ga0207679_10076526	3300025945	Bacteria	2543
195	Ga0207667_10083821	3300025949	Bacteria	3300
196	Ga0207651_10179439	3300025960	Bacteria	1678
197	Ga0207668_10597335	3300025972	Bacteria	961
198	Ga0207658_10084660	3300025986	Bacteria	2440
199	Ga0207703_10032051	3300026035	Bacteria	4158
200	Ga0207678_10042784	3300026067	Bacteria	3922
201	Ga0207702_10035042	3300026078	Bacteria	4196
202	Ga0207702_10325287	3300026078	Bacteria	1465
203	Ga0207641_10144674	3300026088	Bacteria	2148
204	Ga0207641_10594153	3300026088	Bacteria	1083
205	Ga0207676_10005475	3300026095	Bacteria	8987
206	Ga0207674_10403832	3300026116	Bacteria	1320
207	Ga0207675_100764401	3300026118	Bacteria	978
208	Ga0207683_10006058	3300026121	Bacteria	10354
209	Ga0207683_10023054	3300026121	Bacteria	5350
210	Ga0207698_10222073	3300026142	Bacteria	1708
211	Ga0207698_10329825	3300026142	Bacteria	1433
212	Ga0207698_10732242	3300026142	Bacteria	986
213	Ga0268266_10118284	3300028379	Bacteria	2355
214	Ga0268264_10183651	3300028381	Bacteria	1901
215	Ga0265338_10032074	3300028800	Bacteria	5135
216	Ga0265332_10000601	3300031238	Bacteria	23600
217	Ga0265328_10004169	3300031239	Bacteria	6301
218	Ga0265325_10035403	3300031241	Bacteria	2652
219	Ga0265325_10040490	3300031241	Bacteria	2447
220	Ga0265329_10020973	3300031242	Bacteria	2200
221	Ga0265340_10001354	3300031247	Bacteria	14043
222	Ga0265340_10021751	3300031247	Bacteria	3286
223	Ga0265339_10001986	3300031249	Bacteria	15032
224	Ga0265339_10040103	3300031249	Bacteria	2603
225	Ga0265331_10002977	3300031250	Bacteria	11147
226	Ga0265331_10020302	3300031250	Bacteria	3414
227	Ga0265327_10085859	3300031251	Bacteria	1545
228	Ga0265313_10000981	3300031595	Bacteria	28118
229	Ga0265313_10014177	3300031595	Bacteria	4728
230	Ga0265313_10036956	3300031595	Bacteria	2448
231	Ga0316575_10098445	3300031665	Bacteria	1187
232	Ga0316579_10058415	3300031691	Bacteria	1812
233	Ga0316579_10058965	3300031691	Bacteria	1804
234	Ga0265314_10023087	3300031711	Bacteria	4753
235	Ga0265342_10000011	3300031712	Bacteria	208435
236	Ga0265342_10000503	3300031712	Bacteria	41900
237	Ga0265342_10022579	3300031712	Bacteria	3998
238	Ga0307415_100355513	3300032126	Bacteria	1235
239	Ga0316583_10043281	3300032133	Bacteria	1591
240	Ga0373930_0056739	3300034816	Bacteria	866
241	Ga0373950_0003249	3300034818	Bacteria	2307
242	Ga0373926_0003400	3300035083	Bacteria	5128
243	Ga0373934_0042218	3300035086	Bacteria	1801
244	Ga0373934_0184541	3300035086	Bacteria	857
245	Ga0373944_0002324	3300035089	Bacteria	4843
246	Ga0373944_0029896	3300035089	Bacteria	1631
247	Ga0373923_0046808	3300035111	Bacteria	1800
248	Ga0373923_0180719	3300035111	Bacteria	969
249	Ga0373932_0003783	3300035112	Bacteria	3608
250	Ga0373936_0010493	3300035113	Bacteria	3495
251	Ga0373945_0004935	3300035116	Bacteria	4253
252	Ga0373945_0011565	3300035116	Bacteria	2920
253	Ga0373954_0006600	3300035118	Bacteria	5063
254	Ga0373956_0001794	3300035119	Bacteria	8852
255	Ga0373943_0007338	3300035170	Bacteria	4948
256	Ga0373943_0065508	3300035170	Bacteria	1827
257	Ga0373955_0093209	3300035172	Bacteria	1719
258	Ga0373924_0101597	3300035410	Bacteria	1237
259	Ga0373935_0029354	3300035692	Bacteria	3403
260	Ga0373935_0083358	3300035692	Bacteria	2081
261	Ga0373927_0031995	3300035695	Bacteria	3426
262	Ga0373927_0155675	3300035695	Bacteria	1496
263	Ga0373927_0325985	3300035695	Bacteria	1011
264	Ga0373933_0003183	3300035724	Bacteria	9168
265	Ga0373947_0027508	3300035725	Bacteria	3328
266	Ga0373947_0076215	3300035725	Bacteria	2066
267	Ga0373937_0004648	3300036401	Bacteria	11660
268	Ga0373937_0007053	3300036401	Bacteria	9701
269	Ga0373937_0017400	3300036401	Bacteria	6403
270	Ga0373937_0049497	3300036401	Bacteria	3848
271	Ga0373937_0252020	3300036401	Bacteria	1664
272	Ga0373925_0051141	3300037068	Bacteria	3084
273	Ga0373925_0073532	3300037068	Bacteria	2587
274	Ga0373925_0270013	3300037068	Bacteria	1368
275	Ga0395899_0032806	3300037312	Bacteria	3902
276	Ga0395900_0010480	3300037418	Bacteria	9481
277	Ga0395898_0008835	3300037466	Bacteria	10617
278	Ga0395898_0044396	3300037466	Bacteria	4375
279	Ga0436364_1338680	3300037853	Bacteria	1803
280	Ga0395901_0023626	3300038443	Bacteria	6303
281	Ga0395901_0045658	3300038443	Bacteria	4548
282	Ga0436365_0699064	3300039437	Bacteria	3405
283	Ga0436365_0994980	3300039437	Bacteria	1791
284	Ga0436365_1200914	3300039437	Bacteria	722
285	Ga0436360_0782729	3300039438	Bacteria	1908
286	Ga0436361_0045550	3300039447	Bacteria	6059
287	Ga0436361_0266411	3300039447	Bacteria	1515
288	Ga0466964_0287998	3300044706	Bacteria	823
289	Ga0466968_0100723	3300044735	Bacteria	1289
290	Ga0466968_0276598	3300044735	Bacteria	802
291	Ga0466957_0046779	3300044842	Bacteria	2628
292	Ga0466957_0248902	3300044842	Bacteria	1181
293	Ga0466958_0254146	3300045836	Bacteria	1124
294	Ga0466967_0071995	3300045976	Bacteria	3096
295	Ga0466967_0311172	3300045976	Bacteria	1517
296	Ga0495617_009990	3300046452	Bacteria	3254
297	Ga0495592_0007012	3300046454	Bacteria	8423
298	Ga0495592_0284737	3300046454	Bacteria	1080
299	Ga0495591_034046	3300046458	Bacteria	1503
300	Ga0495629_0020810	3300046459	Bacteria	4683
301	Ga0495641_0020735	3300046461	Bacteria	3323
302	Ga0495651_0001089	3300046462	Bacteria	20919
303	Ga0495651_0024220	3300046462	Bacteria	4723
304	Ga0495651_0348292	3300046462	Bacteria	980
305	Ga0495653_0031611	3300046463	Bacteria	4206
306	Ga0495582_0008446	3300046473	Bacteria	5682
307	Ga0495582_0095042	3300046473	Bacteria	1664
308	Ga0495639_0061463	3300046475	Bacteria	1722
309	Ga0495662_0006899	3300046476	Bacteria	5642
310	Ga0495662_0073994	3300046476	Bacteria	1653
311	Ga0495664_0002242	3300046477	Bacteria	10354
312	Ga0495664_0019816	3300046477	Bacteria	3872
313	Ga0495664_0055102	3300046477	Bacteria	2366
314	Ga0495584_0020989	3300046491	Bacteria	3317
315	Ga0495584_0039601	3300046491	Bacteria	2381
316	Ga0495607_0007291	3300046501	Bacteria	7669
317	Ga0495628_0123606	3300046516	Bacteria	1983
318	Ga0495628_0577153	3300046516	Bacteria	805
319	Ga0495630_0036374	3300046517	Bacteria	3681
320	Ga0495630_0074735	3300046517	Bacteria	2553
321	Ga0495630_0089625	3300046517	Bacteria	2323
322	Ga0495630_0159306	3300046517	Bacteria	1718
323	Ga0495637_0018062	3300046520	Bacteria	3275
324	Ga0495644_0000599	3300046523	Bacteria	15123
325	Ga0495666_0010368	3300046526	Bacteria	4644
326	Ga0495666_0011638	3300046526	Bacteria	4386
327	Ga0495665_0006584	3300046531	Bacteria	6275
328	Ga0495640_0015781	3300046533	Bacteria	5669
329	Ga0495640_0065948	3300046533	Bacteria	2442
330	Ga0495586_0148351	3300046535	Bacteria	1319
331	Ga0495586_0220725	3300046535	Bacteria	1077
332	Ga0495587_0005203	3300046536	Bacteria	8503
333	Ga0495609_0096372	3300046538	Bacteria	1284
334	Ga0495621_0021737	3300046539	Bacteria	2118
335	Ga0495645_0004692	3300046543	Bacteria	9327
336	Ga0495645_0189714	3300046543	Bacteria	1402
337	Ga0495622_0001890	3300046557	Bacteria	10297
338	Ga0495633_0004624	3300046558	Bacteria	8670
339	Ga0495667_0004099	3300046559	Bacteria	9790
340	Ga0495667_0005855	3300046559	Bacteria	8330
341	Ga0495667_0134210	3300046559	Bacteria	1596
342	Ga0495667_0146285	3300046559	Bacteria	1522
343	Ga0495656_0000540	3300046615	Bacteria	12326
344	Ga0495634_0086823	3300046642	Bacteria	2037
345	Ga0495634_0138699	3300046642	Bacteria	1545
346	Ga0495634_0141343	3300046642	Bacteria	1528
347	Ga0495634_0145066	3300046642	Bacteria	1504
348	Ga0495611_0001929	3300046648	Bacteria	9856
349	Ga0495635_0283003	3300046663	Bacteria	1114
350	Ga0495659_0000299	3300046664	Bacteria	19677
351	Ga0495588_0097155	3300046674	Bacteria	1545
352	Ga0495623_0009573	3300046679	Bacteria	6293
353	Ga0495647_0043387	3300046681	Bacteria	1720
354	Ga0495647_0074677	3300046681	Bacteria	1363
355	Ga0495658_0003748	3300046683	Bacteria	7521
356	Ga0495658_0114284	3300046683	Bacteria	1626
357	Ga0495658_0157722	3300046683	Bacteria	1397
358	Ga0495613_0027480	3300046689	Bacteria	4233
359	Ga0495613_0164282	3300046689	Bacteria	1578
360	Ga0495613_0342327	3300046689	Bacteria	1028
361	Ga0495624_0011685	3300046690	Bacteria	6031
362	Ga0495624_0046338	3300046690	Bacteria	2765
363	Ga0495624_0077234	3300046690	Bacteria	2065
364	Ga0495624_0333616	3300046690	Bacteria	913
365	Ga0495670_0063908	3300046691	Bacteria	1853
366	Ga0495600_0002294	3300046809	Bacteria	10907
367	Ga0495600_0003761	3300046809	Bacteria	8981
368	Ga0495581_0059518	3300047315	Bacteria	2207
369	Ga0495604_0019596	3300047317	Bacteria	5414
370	Ga0495604_0046641	3300047317	Bacteria	3378
371	Ga0495604_0255983	3300047317	Bacteria	1192
372	Ga0495674_0058621	3300047319	Bacteria	3365
373	Ga0495674_0101935	3300047319	Bacteria	2441
374	Ga0495674_0129400	3300047319	Bacteria	2128
375	Ga0495674_0399035	3300047319	Bacteria	1110
376	Ga0495676_0079923	3300047321	Bacteria	2484
377	Ga0495676_0162867	3300047321	Bacteria	1576
378	Ga0495680_0011192	3300047322	Bacteria	7966
379	Ga0495680_0031096	3300047322	Bacteria	4349
380	Ga0495680_0075759	3300047322	Bacteria	2552
381	Ga0495677_0056074	3300047445	Bacteria	1455
382	Ga0495679_012129	3300047446	Bacteria	3294
383	Ga0495684_0198153	3300047471	Bacteria	1481
384	Ga0495593_0009422	3300047673	Bacteria	5666
385	Ga0495593_0033732	3300047673	Bacteria	2787
386	Ga0495593_0061814	3300047673	Bacteria	1959
387	Ga0495602_0084927	3300048088	Bacteria	2647
388	Ga0495602_0368550	3300048088	Bacteria	1032
389	Ga0495614_0007505	3300048089	Bacteria	4854
390	Ga0495614_0031475	3300048089	Bacteria	2283
391	Ga0495614_0214712	3300048089	Bacteria	873
392	Ga0496100_0009110	3300048903	Bacteria	5566
393	Ga0496101_0066591	3300048904	Bacteria	2628
394	Ga0496101_0090099	3300048904	Bacteria	2280
395	Ga0496101_0377294	3300048904	Bacteria	1115
396	Ga0496102_0056069	3300048905	Bacteria	3594
397	Ga0496102_0082260	3300048905	Bacteria	2969
398	Ga0496102_0354390	3300048905	Bacteria	1381
399	Ga0496102_0422825	3300048905	Bacteria	1252
400	Ga0496102_0675084	3300048905	Bacteria	956
401	Ga0496103_0043466	3300048906	Bacteria	2766
402	Ga0496104_0001427	3300048907	Bacteria	20681
403	Ga0496104_0026796	3300048907	Bacteria	5327
404	Ga0496104_0031332	3300048907	Bacteria	4944
405	Ga0496104_0040854	3300048907	Bacteria	4348
406	Ga0496105_0017729	3300048908	Bacteria	5712
407	Ga0496105_0025606	3300048908	Bacteria	4804
408	Ga0496105_0034717	3300048908	Bacteria	4149
409	Ga0496106_0007080	3300048909	Bacteria	8288
410	Ga0496106_0047219	3300048909	Bacteria	3240
411	Ga0496106_0315785	3300048909	Bacteria	1254
412	Ga0496106_0635464	3300048909	Bacteria	853
413	Ga0496107_0031770	3300048910	Bacteria	3769
414	Ga0496107_0306466	3300048910	Bacteria	1182
415	Ga0496108_0002767	3300048911	Bacteria	14041
416	Ga0496108_0155927	3300048911	Bacteria	1972
417	Ga0496108_0214265	3300048911	Bacteria	1672
418	Ga0496108_0296790	3300048911	Bacteria	1407
419	Ga0496108_0413819	3300048911	Bacteria	1177
420	Ga0496109_0009037	3300048912	Bacteria	8488
421	Ga0496109_0020433	3300048912	Bacteria	5849
422	Ga0496109_0136793	3300048912	Bacteria	2289
423	Ga0496110_0089635	3300048913	Bacteria	2749
424	Ga0496110_0092686	3300048913	Bacteria	2703
425	Ga0496111_0012471	3300048914	Bacteria	5755
426	Ga0496112_0077122	3300048915	Bacteria	3295
427	Ga0496112_0363180	3300048915	Bacteria	1390
428	Ga0496112_0432362	3300048915	Bacteria	1254
429	Ga0496112_0702290	3300048915	Bacteria	939
430	Ga0496113_0044805	3300048916	Bacteria	3278
431	Ga0496113_0051584	3300048916	Bacteria	3070
432	Ga0496113_0176844	3300048916	Bacteria	1691
433	Ga0496113_0180017	3300048916	Bacteria	1676
434	Ga0496114_0044776	3300048917	Bacteria	3673
435	Ga0496114_0086765	3300048917	Bacteria	2653
436	Ga0496114_0267599	3300048917	Bacteria	1506
437	Ga0496115_0014582	3300048918	Bacteria	5950
438	Ga0496115_0043627	3300048918	Bacteria	3577
439	Ga0496115_0253096	3300048918	Bacteria	1450
440	Ga0496121_0372437	3300048924	Bacteria	944
441	Ga0496126_0578969	3300048929	Bacteria	887
442	Ga0501031_0001349	3300049568	Bacteria	15132
443	Ga0501031_0054272	3300049568	Bacteria	2611
444	Ga0501032_0013590	3300049569	Bacteria	5784
445	Ga0501032_0025970	3300049569	Bacteria	4034
446	Ga0501032_0043131	3300049569	Bacteria	3056
447	Ga0501032_0050522	3300049569	Bacteria	2804
448	Ga0501032_0287224	3300049569	Bacteria	1064
449	Ga0501033_0029483	3300049570	Bacteria	4123
450	Ga0501034_0000097	3300049571	Bacteria	161027
451	Ga0501034_0002259	3300049571	Bacteria	23638
452	Ga0501034_0011972	3300049571	Bacteria	8965
453	Ga0501034_0015146	3300049571	Bacteria	7925
454	Ga0501034_0026441	3300049571	Bacteria	5910
455	Ga0501034_0109777	3300049571	Bacteria	2749
456	Ga0501034_0339070	3300049571	Bacteria	1433
457	Ga0501036_0000954	3300049572	Bacteria	21767
458	Ga0501036_0004827	3300049572	Bacteria	10895
459	Ga0501036_0037872	3300049572	Bacteria	4079
460	Ga0501036_0121404	3300049572	Bacteria	2206
461	Ga0501036_0311950	3300049572	Bacteria	1315
462	Ga0501036_0416961	3300049572	Bacteria	1119
463	Ga0501037_0002560	3300049573	Bacteria	13145
464	Ga0501037_0003385	3300049573	Bacteria	11593
465	Ga0501037_0022801	3300049573	Bacteria	4629
466	Ga0501037_0227384	3300049573	Bacteria	1310
467	Ga0501038_0026843	3300049574	Bacteria	5127
468	Ga0501038_0032078	3300049574	Bacteria	4637
469	Ga0501038_0033722	3300049574	Bacteria	4507
470	Ga0501038_0207691	3300049574	Bacteria	1568
471	Ga0501038_0249903	3300049574	Bacteria	1405
472	Ga0501038_0275531	3300049574	Bacteria	1325
473	Ga0501039_0018390	3300049575	Bacteria	5364
474	Ga0501039_0055365	3300049575	Bacteria	3071
475	Ga0501039_0441820	3300049575	Bacteria	1021
476	Ga0501040_0042271	3300049576	Bacteria	3104
477	Ga0501043_0003445	3300049579	Bacteria	12996
478	Ga0501043_0018962	3300049579	Bacteria	5399
479	Ga0501043_0088362	3300049579	Bacteria	2436
480	Ga0501043_0186468	3300049579	Bacteria	1615
481	Ga0501043_0364389	3300049579	Bacteria	1096
482	Ga0501046_0065421	3300049580	Bacteria	2836
483	Ga0501046_0143708	3300049580	Bacteria	1803
484	Ga0501047_0000218	3300049581	Bacteria	68952
485	Ga0501047_0003809	3300049581	Bacteria	14175
486	Ga0501047_0023326	3300049581	Bacteria	5942
487	Ga0501047_0094640	3300049581	Bacteria	2866
488	Ga0501048_0000313	3300049582	Bacteria	33165
489	Ga0501048_0010967	3300049582	Bacteria	6760
490	Ga0501068_0061742	3300049584	Bacteria	2277
491	Ga0501068_0136585	3300049584	Bacteria	1535
492	Ga0501068_0222916	3300049584	Bacteria	1199
493	Ga0501069_0004074	3300049585	Bacteria	7542
494	Ga0501069_0077660	3300049585	Bacteria	1867
495	Ga0501069_0170209	3300049585	Bacteria	1257
496	Ga0501070_0008769	3300049586	Bacteria	8550
497	Ga0501070_0013530	3300049586	Bacteria	6878
498	Ga0501070_0020750	3300049586	Bacteria	5511
499	Ga0501070_0022894	3300049586	Bacteria	5230
500	Ga0501070_0025640	3300049586	Bacteria	4945
501	Ga0501070_0035106	3300049586	Bacteria	4190
502	Ga0501070_0068468	3300049586	Bacteria	2938
503	Ga0501071_0072184	3300049587	Bacteria	2517
504	Ga0501072_0023371	3300049588	Bacteria	4801
505	Ga0501072_0057296	3300049588	Bacteria	3070
506	Ga0501072_0100013	3300049588	Bacteria	2305
507	Ga0501072_0126810	3300049588	Bacteria	2034
508	Ga0501072_0521314	3300049588	Bacteria	940
509	Ga0501073_0082659	3300049589	Bacteria	2234
510	Ga0501073_0175624	3300049589	Bacteria	1482
511	Ga0501073_0272183	3300049589	Bacteria	1169
512	Ga0501073_0401077	3300049589	Bacteria	947
513	Ga0501073_0419237	3300049589	Bacteria	925
514	Ga0501074_0025868	3300049590	Bacteria	4258
515	Ga0501074_0146025	3300049590	Bacteria	1691
516	Ga0501074_0256956	3300049590	Bacteria	1242
517	Ga0501074_0425348	3300049590	Bacteria	942
518	Ga0501075_0441329	3300049591	Bacteria	993
519	Ga0501080_0001471	3300049742	Bacteria	19833
520	Ga0501080_0018890	3300049742	Bacteria	6383
521	Ga0501080_0131292	3300049742	Bacteria	2319
522	Ga0501080_0211419	3300049742	Bacteria	1777
523	Ga0501080_0355340	3300049742	Bacteria	1322
524	Ga0501080_0409909	3300049742	Bacteria	1218
525	Ga0501080_0600908	3300049742	Bacteria	977
526	Ga0501080_0787604	3300049742	Bacteria	834
527	Ga0501081_0212226	3300049743	Bacteria	1406
528	Ga0501083_0001547	3300049744	Bacteria	15730
529	Ga0501083_0013731	3300049744	Bacteria	5665
530	Ga0501083_0035874	3300049744	Bacteria	3386
531	Ga0501083_0153241	3300049744	Bacteria	1509
532	Ga0501035_0003871	3300049822	Bacteria	14283
533	Ga0501035_0004162	3300049822	Bacteria	13750
534	Ga0501035_0031432	3300049822	Bacteria	4835
535	Ga0501035_0051570	3300049822	Bacteria	3683
536	Ga0501044_0003277	3300049823	Bacteria	18223
537	Ga0501044_0028283	3300049823	Bacteria	5917
538	Ga0501044_0028487	3300049823	Bacteria	5895
539	Ga0501044_0046702	3300049823	Bacteria	4482
540	Ga0501044_0092804	3300049823	Bacteria	3045
541	Ga0501044_0139007	3300049823	Bacteria	2418
542	Ga0501044_0224836	3300049823	Bacteria	1826
543	Ga0501044_0225064	3300049823	Bacteria	1825
544	Ga0501044_0309092	3300049823	Bacteria	1508
545	Ga0501044_0883072	3300049823	Bacteria	769
546	nmdc:mga00v17_546451_c1	3300050491	Bacteria	749
547	nmdc:mga0yw44_48128_c1	3300050492	Bacteria	2570
548	nmdc:mga05p37_271264_c1	3300050507	Bacteria	2027
549	nmdc:mga05p37_316135_c1	3300050507	Bacteria	1850
550	nmdc:mga0qj67_264_c1	3300050509	Bacteria	36047
551	nmdc:mga06r32_333812_c1	3300050510	Bacteria	1501
552	nmdc:mga06r32_36391_c1	3300050510	Bacteria	4650
553	nmdc:mga06r32_71705_c1	3300050510	Bacteria	3352
554	nmdc:mga08y16_1262563_c1	3300050511	Bacteria	707
555	nmdc:mga0n895_263159_c1	3300050512	Bacteria	1750
556	nmdc:mga0n895_772812_c1	3300050512	Bacteria	952
557	nmdc:mga0rr50_35676_c1	3300050513	Bacteria	3573
558	nmdc:mga0rr50_639072_c1	3300050513	Bacteria	908
559	nmdc:mga0rr50_899031_c1	3300050513	Bacteria	755
560	nmdc:mga08x19_14_c1	3300050514	Bacteria	365567
561	nmdc:mga08x19_260510_c1	3300050514	Bacteria	1199
562	nmdc:mga08x19_62865_c1	3300050514	Bacteria	2408
563	Ga0495601_0002862	3300053077	Bacteria	9810
564	Ga0495601_0008379	3300053077	Bacteria	6107
565	Ga0495601_0010516	3300053077	Bacteria	5509
566	Ga0495601_0082047	3300053077	Bacteria	2069
567	Ga0495601_0182304	3300053077	Bacteria	1372
568	Ga0495612_0002742	3300053078	Bacteria	7294
569	Ga0495612_0013320	3300053078	Bacteria	3312
570	Ga0495595_0002949	3300053084	Bacteria	6717
571	Ga0495595_0016441	3300053084	Bacteria	3165
572	Ga0495619_0000279	3300053085	Bacteria	36643
573	Ga0495619_0034256	3300053085	Bacteria	3301
574	Ga0495619_0043918	3300053085	Bacteria	2932
575	Ga0495619_0076616	3300053085	Bacteria	2245
576	Ga0495619_0140021	3300053085	Bacteria	1665
577	Ga0495619_0503841	3300053085	Bacteria	832
578	Ga0500566_0098625	3300053094	Bacteria	1605
579	Ga0500562_014468	3300053108	Bacteria	2020
580	Ga0500642_0134265	3300053130	Bacteria	1160
581	Ga0500616_0000002	3300053153	Bacteria	1611257
582	Ga0500616_0017906	3300053153	Bacteria	4012
583	Ga0500616_0052929	3300053153	Bacteria	2132
584	Ga0501084_0104675	3300054114	Bacteria	2377
585	Ga0501082_0054742	3300060353	Bacteria	3439

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300050491	nmdc:mga00v17_546451_c1	nmdc:mga00v17_546451_c1_27_599	189
2	3300048907	Ga0496104_0031332	Ga0496104_0031332_4145_4801	218
3	3300048911	Ga0496108_0002767	Ga0496108_0002767_9708_10364	218
4	3300048915	Ga0496112_0432362	Ga0496112_0432362_583_1239	218
5	3300049822	Ga0501035_0004162	Ga0501035_0004162_51_713	218
6	3300025885	Ga0207653_10078361	Ga0207653_100783612	219
7	3300046516	Ga0495628_0577153	Ga0495628_0577153_110_769	219
8	3300050492	nmdc:mga0yw44_48128_c1	nmdc:mga0yw44_48128_c1_1882_2541	219
9	3300050513	nmdc:mga0rr50_639072_c1	nmdc:mga0rr50_639072_c1_222_881	219
10	3300050513	nmdc:mga0rr50_899031_c1	nmdc:mga0rr50_899031_c1_38_697	219
11	3300039437	Ga0436365_0699064	Ga0436365_0699064_2723_3388	221
12	3300048929	Ga0496126_0578969	Ga0496126_0578969_182_850	222
13	3300050511	nmdc:mga08y16_1262563_c1	nmdc:mga08y16_1262563_c1_29_697	222
14	3300006847	Ga0075431_100087926	Ga0075431_1000879262	223
15	3300034816	Ga0373930_0056739	Ga0373930_0056739_16_687	223
16	3300035112	Ga0373932_0003783	Ga0373932_0003783_2883_3554	223
17	3300037853	Ga0436364_1338680	Ga0436364_1338680_161_937	223
18	3300046462	Ga0495651_0348292	Ga0495651_0348292_279_950	223
19	3300046491	Ga0495584_0039601	Ga0495584_0039601_1683_2357	223
20	3300047445	Ga0495677_0056074	Ga0495677_0056074_745_1416	223
21	3300048915	Ga0496112_0702290	Ga0496112_0702290_68_739	223
22	3300049742	Ga0501080_0409909	Ga0501080_0409909_36_716	223
23	3300049823	Ga0501044_0225064	Ga0501044_0225064_30_707	223
24	3300049823	Ga0501044_0883072	Ga0501044_0883072_63_740	223
25	3300039437	Ga0436365_1200914	Ga0436365_1200914_25_705	226
26	3300048924	Ga0496121_0372437	Ga0496121_0372437_225_926	233
27	3300005440	Ga0070705_100364063	Ga0070705_1003640632	242
28	3300005536	Ga0070697_100001287	Ga0070697_10000128711	242
29	3300005545	Ga0070695_100052788	Ga0070695_1000527882	242
30	3300006914	Ga0075436_100005894	Ga0075436_1000058947	242
31	3300007076	Ga0075435_100064586	Ga0075435_1000645862	242
32	3300025910	Ga0207684_10199146	Ga0207684_101991462	242
33	3300025939	Ga0207665_10415942	Ga0207665_104159422	242
34	3300050513	nmdc:mga0rr50_35676_c1	nmdc:mga0rr50_35676_c1_962_1726	242
35	3300050514	nmdc:mga08x19_14_c1	nmdc:mga08x19_14_c1_69517_70281	242
36	3300053085	Ga0495619_0034256	Ga0495619_0034256_2528_3262	244
37	3300005434	Ga0070709_10001542	Ga0070709_1000154211	246
38	3300005435	Ga0070714_100000559	Ga0070714_1000005596	246
39	3300005436	Ga0070713_100004605	Ga0070713_1000046052	246
40	3300005437	Ga0070710_10005369	Ga0070710_100053696	246
41	3300005518	Ga0070699_100012701	Ga0070699_1000127015	246
42	3300005983	Ga0081540_1002145	Ga0081540_100214510	246
43	3300006028	Ga0070717_10001577	Ga0070717_1000157713	246
44	3300006163	Ga0070715_10000454	Ga0070715_100004549	246
45	3300006173	Ga0070716_100014295	Ga0070716_1000142952	246
46	3300006175	Ga0070712_100530894	Ga0070712_1005308942	246
47	3300006844	Ga0075428_100107733	Ga0075428_1001077332	246
48	3300006846	Ga0075430_100249393	Ga0075430_1002493931	246
49	3300006847	Ga0075431_100939701	Ga0075431_1009397011	246
50	3300006852	Ga0075433_10136948	Ga0075433_101369482	246
51	3300006871	Ga0075434_100171071	Ga0075434_1001710712	246
52	3300006871	Ga0075434_100225920	Ga0075434_1002259202	246
53	3300025898	Ga0207692_10001984	Ga0207692_100019848	246
54	3300025905	Ga0207685_10000129	Ga0207685_1000012911	246
55	3300025906	Ga0207699_10001379	Ga0207699_1000137911	246
56	3300025915	Ga0207693_10012558	Ga0207693_100125587	246
57	3300025928	Ga0207700_10164091	Ga0207700_101640912	246
58	3300025939	Ga0207665_10002006	Ga0207665_100020064	246
59	3300037466	Ga0395898_0044396	Ga0395898_0044396_2453_3199	246
60	3300038443	Ga0395901_0045658	Ga0395901_0045658_341_1087	246
61	3300044706	Ga0466964_0287998	Ga0466964_0287998_52_798	246
62	3300048909	Ga0496106_0047219	Ga0496106_0047219_1049_1795	246
63	3300048915	Ga0496112_0363180	Ga0496112_0363180_379_1125	246
64	3300048918	Ga0496115_0253096	Ga0496115_0253096_142_888	246
65	3300049588	Ga0501072_0521314	Ga0501072_0521314_136_882	246
66	3300050507	nmdc:mga05p37_316135_c1	nmdc:mga05p37_316135_c1_458_1204	246
67	3300050510	nmdc:mga06r32_36391_c1	nmdc:mga06r32_36391_c1_704_1450	246
68	3300050512	nmdc:mga0n895_263159_c1	nmdc:mga0n895_263159_c1_307_1053	246
69	3300050512	nmdc:mga0n895_772812_c1	nmdc:mga0n895_772812_c1_168_914	246
70	iso_pu_bacteria	2511231028	2511395147	246
71	iso_pu_bacteria	2842694124	2842694240	246
72	3300025915	Ga0207693_10126403	Ga0207693_101264032	247
73	3300031238	Ga0265332_10000601	Ga0265332_100006012	247
74	3300031241	Ga0265325_10040490	Ga0265325_100404901	247
75	3300031242	Ga0265329_10020973	Ga0265329_100209733	247
76	3300031247	Ga0265340_10001354	Ga0265340_1000135410	247
77	3300031249	Ga0265339_10001986	Ga0265339_100019868	247
78	3300031250	Ga0265331_10020302	Ga0265331_100203022	247
79	3300031712	Ga0265342_10000011	Ga0265342_1000001170	247
80	3300037068	Ga0373925_0051141	Ga0373925_0051141_1457_2224	247
81	3300046476	Ga0495662_0073994	Ga0495662_0073994_375_1142	247
82	3300046477	Ga0495664_0055102	Ga0495664_0055102_1303_2070	247
83	3300046517	Ga0495630_0036374	Ga0495630_0036374_498_1265	247
84	3300046535	Ga0495586_0148351	Ga0495586_0148351_310_1077	247
85	3300046642	Ga0495634_0086823	Ga0495634_0086823_1147_1914	247
86	3300047319	Ga0495674_0399035	Ga0495674_0399035_131_898	247
87	3300048904	Ga0496101_0066591	Ga0496101_0066591_291_1037	247
88	3300048905	Ga0496102_0422825	Ga0496102_0422825_209_955	247
89	3300048907	Ga0496104_0001427	Ga0496104_0001427_7163_7909	247
90	3300048909	Ga0496106_0315785	Ga0496106_0315785_121_867	247
91	3300048911	Ga0496108_0155927	Ga0496108_0155927_1111_1857	247
92	3300048916	Ga0496113_0180017	Ga0496113_0180017_145_891	247
93	3300049589	Ga0501073_0419237	Ga0501073_0419237_127_882	247
94	3300049742	Ga0501080_0018890	Ga0501080_0018890_4553_5308	247
95	3300053085	Ga0495619_0043918	Ga0495619_0043918_155_910	247
96	iso_pu_bacteria	2643221547	2643756074	247
97	3300005329	Ga0070683_100070886	Ga0070683_1000708862	248
98	3300005458	Ga0070681_10193174	Ga0070681_101931742	248
99	3300005458	Ga0070681_10290320	Ga0070681_102903202	248
100	3300005535	Ga0070684_100347842	Ga0070684_1003478422	248
101	3300005563	Ga0068855_100129124	Ga0068855_1001291242	248
102	3300005834	Ga0068851_10137669	Ga0068851_101376692	248
103	3300006175	Ga0070712_100294492	Ga0070712_1002944922	248
104	3300006175	Ga0070712_100311797	Ga0070712_1003117972	248
105	3300006175	Ga0070712_100611674	Ga0070712_1006116742	248
106	3300006914	Ga0075436_100091790	Ga0075436_1000917902	248
107	3300009093	Ga0105240_10647764	Ga0105240_106477642	248
108	3300009147	Ga0114129_10301176	Ga0114129_103011762	248
109	3300009174	Ga0105241_10132541	Ga0105241_101325412	248
110	3300013100	Ga0157373_10062214	Ga0157373_100622142	248
111	3300013105	Ga0157369_10135175	Ga0157369_101351752	248
112	3300013307	Ga0157372_10040754	Ga0157372_100407543	248
113	3300014325	Ga0163163_10004442	Ga0163163_100044425	248
114	3300025898	Ga0207692_10185858	Ga0207692_101858582	248
115	3300025912	Ga0207707_10137342	Ga0207707_101373422	248
116	3300025912	Ga0207707_10146921	Ga0207707_101469212	248
117	3300025913	Ga0207695_10275198	Ga0207695_102751981	248
118	3300025915	Ga0207693_10022132	Ga0207693_100221322	248
119	3300025915	Ga0207693_10049882	Ga0207693_100498822	248
120	3300025929	Ga0207664_10086609	Ga0207664_100866092	248
121	3300025933	Ga0207706_10428849	Ga0207706_104288491	248
122	3300025972	Ga0207668_10597335	Ga0207668_105973352	248
123	3300026078	Ga0207702_10325287	Ga0207702_103252872	248
124	3300026116	Ga0207674_10403832	Ga0207674_104038322	248
125	3300026142	Ga0207698_10329825	Ga0207698_103298252	248
126	3300026142	Ga0207698_10732242	Ga0207698_107322421	248
127	3300034818	Ga0373950_0003249	Ga0373950_0003249_1272_2021	248
128	3300036401	Ga0373937_0017400	Ga0373937_0017400_596_1351	248
129	3300039437	Ga0436365_0994980	Ga0436365_0994980_702_1454	248
130	3300039438	Ga0436360_0782729	Ga0436360_0782729_158_916	248
131	3300039447	Ga0436361_0045550	Ga0436361_0045550_1600_2358	248
132	3300039447	Ga0436361_0266411	Ga0436361_0266411_194_952	248
133	3300044735	Ga0466968_0100723	Ga0466968_0100723_393_1145	248
134	3300044735	Ga0466968_0276598	Ga0466968_0276598_16_768	248
135	3300045836	Ga0466958_0254146	Ga0466958_0254146_17_769	248
136	3300046454	Ga0495592_0284737	Ga0495592_0284737_71_829	248
137	3300046533	Ga0495640_0015781	Ga0495640_0015781_2987_3742	248
138	3300046559	Ga0495667_0146285	Ga0495667_0146285_103_858	248
139	3300046683	Ga0495658_0157722	Ga0495658_0157722_276_1031	248
140	3300047322	Ga0495680_0075759	Ga0495680_0075759_678_1433	248
141	3300048088	Ga0495602_0368550	Ga0495602_0368550_217_975	248
142	3300048905	Ga0496102_0056069	Ga0496102_0056069_2110_2862	248
143	3300048905	Ga0496102_0675084	Ga0496102_0675084_20_790	248
144	3300048908	Ga0496105_0025606	Ga0496105_0025606_3440_4192	248
145	3300048912	Ga0496109_0009037	Ga0496109_0009037_4397_5149	248
146	3300048914	Ga0496111_0012471	Ga0496111_0012471_1422_2174	248
147	3300048916	Ga0496113_0044805	Ga0496113_0044805_577_1329	248
148	3300048917	Ga0496114_0086765	Ga0496114_0086765_1087_1839	248
149	3300048917	Ga0496114_0267599	Ga0496114_0267599_503_1261	248
150	3300048918	Ga0496115_0014582	Ga0496115_0014582_2410_3162	248
151	3300049569	Ga0501032_0025970	Ga0501032_0025970_1154_1903	248
152	3300049571	Ga0501034_0002259	Ga0501034_0002259_14355_15104	248
153	3300049571	Ga0501034_0339070	Ga0501034_0339070_625_1374	248
154	3300049572	Ga0501036_0000954	Ga0501036_0000954_4696_5445	248
155	3300049572	Ga0501036_0311950	Ga0501036_0311950_187_936	248
156	3300049573	Ga0501037_0022801	Ga0501037_0022801_3650_4399	248
157	3300049574	Ga0501038_0249903	Ga0501038_0249903_35_784	248
158	3300049580	Ga0501046_0065421	Ga0501046_0065421_333_1082	248
159	3300049581	Ga0501047_0000218	Ga0501047_0000218_44989_45738	248
160	3300049581	Ga0501047_0094640	Ga0501047_0094640_482_1234	248
161	3300049582	Ga0501048_0000313	Ga0501048_0000313_23475_24224	248
162	3300049585	Ga0501069_0077660	Ga0501069_0077660_971_1723	248
163	3300049586	Ga0501070_0020750	Ga0501070_0020750_3777_4526	248
164	3300049586	Ga0501070_0068468	Ga0501070_0068468_643_1395	248
165	3300049588	Ga0501072_0057296	Ga0501072_0057296_2142_2894	248
166	3300049589	Ga0501073_0401077	Ga0501073_0401077_145_897	248
167	3300049590	Ga0501074_0025868	Ga0501074_0025868_2307_3056	248
168	3300049742	Ga0501080_0001471	Ga0501080_0001471_14243_14992	248
169	3300049742	Ga0501080_0787604	Ga0501080_0787604_20_772	248
170	3300049744	Ga0501083_0001547	Ga0501083_0001547_5584_6333	248
171	3300049823	Ga0501044_0003277	Ga0501044_0003277_10828_11577	248
172	3300049823	Ga0501044_0046702	Ga0501044_0046702_1005_1754	248
173	3300049823	Ga0501044_0139007	Ga0501044_0139007_1103_1855	248
174	3300050510	nmdc:mga06r32_333812_c1	nmdc:mga06r32_333812_c1_60_815	248
175	3300050514	nmdc:mga08x19_62865_c1	nmdc:mga08x19_62865_c1_490_1245	248
176	3300053077	Ga0495601_0008379	Ga0495601_0008379_3074_3829	248
177	3300053085	Ga0495619_0000279	Ga0495619_0000279_25535_26290	248
178	3300005337	Ga0070682_100349270	Ga0070682_1003492702	249
179	3300005436	Ga0070713_100573671	Ga0070713_1005736711	249
180	3300005549	Ga0070704_100019574	Ga0070704_1000195745	249
181	3300006353	Ga0075370_10087724	Ga0075370_100877243	249
182	3300009553	Ga0105249_10002447	Ga0105249_1000244713	249
183	3300025297	Ga0209758_1000362	Ga0209758_10003629	249
184	3300025921	Ga0207652_10279215	Ga0207652_102792152	249
185	3300031239	Ga0265328_10004169	Ga0265328_100041697	249
186	3300031250	Ga0265331_10002977	Ga0265331_100029777	249
187	3300031251	Ga0265327_10085859	Ga0265327_100858592	249
188	3300045976	Ga0466967_0311172	Ga0466967_0311172_320_1075	249
189	3300048907	Ga0496104_0040854	Ga0496104_0040854_3323_4117	249
190	3300048908	Ga0496105_0034717	Ga0496105_0034717_2421_3215	249
191	3300048910	Ga0496107_0306466	Ga0496107_0306466_86_880	249
192	3300048911	Ga0496108_0214265	Ga0496108_0214265_901_1656	249
193	3300048916	Ga0496113_0176844	Ga0496113_0176844_674_1432	249
194	3300048918	Ga0496115_0043627	Ga0496115_0043627_1370_2164	249
195	3300049568	Ga0501031_0054272	Ga0501031_0054272_966_1727	249
196	3300049569	Ga0501032_0013590	Ga0501032_0013590_2604_3365	249
197	3300049569	Ga0501032_0043131	Ga0501032_0043131_148_909	249
198	3300049569	Ga0501032_0287224	Ga0501032_0287224_175_936	249
199	3300049570	Ga0501033_0029483	Ga0501033_0029483_2826_3587	249
200	3300049571	Ga0501034_0000097	Ga0501034_0000097_15340_16101	249
201	3300049571	Ga0501034_0011972	Ga0501034_0011972_64_825	249
202	3300049571	Ga0501034_0026441	Ga0501034_0026441_4355_5116	249
203	3300049571	Ga0501034_0109777	Ga0501034_0109777_257_1018	249
204	3300049572	Ga0501036_0004827	Ga0501036_0004827_2280_3041	249
205	3300049572	Ga0501036_0121404	Ga0501036_0121404_1392_2153	249
206	3300049572	Ga0501036_0416961	Ga0501036_0416961_54_815	249
207	3300049573	Ga0501037_0003385	Ga0501037_0003385_2527_3288	249
208	3300049573	Ga0501037_0227384	Ga0501037_0227384_496_1257	249
209	3300049574	Ga0501038_0032078	Ga0501038_0032078_1273_2034	249
210	3300049574	Ga0501038_0033722	Ga0501038_0033722_2606_3367	249
211	3300049574	Ga0501038_0207691	Ga0501038_0207691_223_984	249
212	3300049574	Ga0501038_0275531	Ga0501038_0275531_54_815	249
213	3300049575	Ga0501039_0055365	Ga0501039_0055365_2257_3018	249
214	3300049575	Ga0501039_0441820	Ga0501039_0441820_54_815	249
215	3300049576	Ga0501040_0042271	Ga0501040_0042271_1679_2440	249
216	3300049579	Ga0501043_0003445	Ga0501043_0003445_4232_4993	249
217	3300049579	Ga0501043_0018962	Ga0501043_0018962_1006_1767	249
218	3300049579	Ga0501043_0088362	Ga0501043_0088362_545_1306	249
219	3300049579	Ga0501043_0364389	Ga0501043_0364389_235_996	249
220	3300049580	Ga0501046_0143708	Ga0501046_0143708_121_882	249
221	3300049581	Ga0501047_0003809	Ga0501047_0003809_5508_6269	249
222	3300049582	Ga0501048_0010967	Ga0501048_0010967_1570_2331	249
223	3300049584	Ga0501068_0061742	Ga0501068_0061742_982_1743	249
224	3300049584	Ga0501068_0136585	Ga0501068_0136585_54_815	249
225	3300049584	Ga0501068_0222916	Ga0501068_0222916_335_1093	249
226	3300049585	Ga0501069_0004074	Ga0501069_0004074_3876_4634	249
227	3300049586	Ga0501070_0008769	Ga0501070_0008769_4766_5524	249
228	3300049586	Ga0501070_0013530	Ga0501070_0013530_5246_6004	249
229	3300049586	Ga0501070_0025640	Ga0501070_0025640_388_1149	249
230	3300049586	Ga0501070_0035106	Ga0501070_0035106_1814_2575	249
231	3300049587	Ga0501071_0072184	Ga0501071_0072184_701_1462	249
232	3300049588	Ga0501072_0023371	Ga0501072_0023371_3253_4014	249
233	3300049588	Ga0501072_0126810	Ga0501072_0126810_330_1091	249
234	3300049589	Ga0501073_0082659	Ga0501073_0082659_155_916	249
235	3300049589	Ga0501073_0175624	Ga0501073_0175624_179_940	249
236	3300049590	Ga0501074_0146025	Ga0501074_0146025_285_1046	249
237	3300049590	Ga0501074_0256956	Ga0501074_0256956_197_958	249
238	3300049742	Ga0501080_0131292	Ga0501080_0131292_308_1066	249
239	3300049742	Ga0501080_0211419	Ga0501080_0211419_54_815	249
240	3300049742	Ga0501080_0355340	Ga0501080_0355340_54_815	249
241	3300049743	Ga0501081_0212226	Ga0501081_0212226_193_954	249
242	3300049744	Ga0501083_0013731	Ga0501083_0013731_376_1140	249
243	3300049744	Ga0501083_0035874	Ga0501083_0035874_1162_1923	249
244	3300049744	Ga0501083_0153241	Ga0501083_0153241_492_1253	249
245	3300049822	Ga0501035_0003871	Ga0501035_0003871_4535_5293	249
246	3300049822	Ga0501035_0031432	Ga0501035_0031432_1123_1884	249
247	3300049823	Ga0501044_0028283	Ga0501044_0028283_64_825	249
248	3300049823	Ga0501044_0028487	Ga0501044_0028487_2552_3313	249
249	3300049823	Ga0501044_0224836	Ga0501044_0224836_195_956	249
250	3300049823	Ga0501044_0309092	Ga0501044_0309092_518_1279	249
251	3300053108	Ga0500562_014468	Ga0500562_014468_879_1631	249
252	3300054114	Ga0501084_0104675	Ga0501084_0104675_1437_2201	249
253	3300003911	JGI25405J52794_10000800	JGI25405J52794_100008002	250
254	3300005327	Ga0070658_10188437	Ga0070658_101884372	250
255	3300005329	Ga0070683_100099908	Ga0070683_1000999083	250
256	3300005335	Ga0070666_10011375	Ga0070666_100113754	250
257	3300005336	Ga0070680_100004867	Ga0070680_1000048679	250
258	3300005338	Ga0068868_100023450	Ga0068868_1000234502	250
259	3300005339	Ga0070660_100032134	Ga0070660_1000321341	250
260	3300005339	Ga0070660_100405492	Ga0070660_1004054922	250
261	3300005340	Ga0070689_100009567	Ga0070689_1000095678	250
262	3300005340	Ga0070689_100393047	Ga0070689_1003930471	250
263	3300005355	Ga0070671_100018495	Ga0070671_1000184952	250
264	3300005356	Ga0070674_100412187	Ga0070674_1004121872	250
265	3300005364	Ga0070673_100181383	Ga0070673_1001813832	250
266	3300005365	Ga0070688_100004816	Ga0070688_1000048163	250
267	3300005366	Ga0070659_100231424	Ga0070659_1002314242	250
268	3300005434	Ga0070709_10005230	Ga0070709_100052306	250
269	3300005434	Ga0070709_10083478	Ga0070709_100834781	250
270	3300005434	Ga0070709_10118900	Ga0070709_101189002	250
271	3300005435	Ga0070714_100056948	Ga0070714_1000569483	250
272	3300005436	Ga0070713_100001362	Ga0070713_10000136214	250
273	3300005437	Ga0070710_10282857	Ga0070710_102828572	250
274	3300005439	Ga0070711_100033678	Ga0070711_1000336783	250
275	3300005439	Ga0070711_100164009	Ga0070711_1001640092	250
276	3300005439	Ga0070711_100178727	Ga0070711_1001787272	250
277	3300005440	Ga0070705_100014364	Ga0070705_1000143642	250
278	3300005456	Ga0070678_100012718	Ga0070678_1000127187	250
279	3300005456	Ga0070678_100067594	Ga0070678_1000675943	250
280	3300005458	Ga0070681_10002364	Ga0070681_100023642	250
281	3300005458	Ga0070681_10072782	Ga0070681_100727822	250
282	3300005466	Ga0070685_10004064	Ga0070685_100040645	250
283	3300005530	Ga0070679_100124940	Ga0070679_1001249403	250
284	3300005530	Ga0070679_100223319	Ga0070679_1002233193	250
285	3300005530	Ga0070679_100543405	Ga0070679_1005434052	250
286	3300005535	Ga0070684_100934828	Ga0070684_1009348281	250
287	3300005544	Ga0070686_100042775	Ga0070686_1000427753	250
288	3300005547	Ga0070693_100465846	Ga0070693_1004658461	250
289	3300005563	Ga0068855_100063428	Ga0068855_1000634282	250
290	3300005616	Ga0068852_100209287	Ga0068852_1002092873	250
291	3300005618	Ga0068864_100016492	Ga0068864_1000164923	250
292	3300005719	Ga0068861_100637039	Ga0068861_1006370392	250
293	3300005843	Ga0068860_100083855	Ga0068860_1000838553	250
294	3300005937	Ga0081455_10002008	Ga0081455_1000200823	250
295	3300006028	Ga0070717_10000682	Ga0070717_1000068213	250
296	3300006038	Ga0075365_10073540	Ga0075365_100735402	250
297	3300006042	Ga0075368_10028979	Ga0075368_100289794	250
298	3300006163	Ga0070715_10090426	Ga0070715_100904262	250
299	3300006173	Ga0070716_100093485	Ga0070716_1000934852	250
300	3300006175	Ga0070712_100027864	Ga0070712_1000278643	250
301	3300006175	Ga0070712_100098916	Ga0070712_1000989162	250
302	3300006178	Ga0075367_10016210	Ga0075367_100162104	250
303	3300006186	Ga0075369_10026897	Ga0075369_100268972	250
304	3300006195	Ga0075366_10054551	Ga0075366_100545512	250
305	3300006358	Ga0068871_100082011	Ga0068871_1000820112	250
306	3300006846	Ga0075430_100003454	Ga0075430_1000034543	250
307	3300006871	Ga0075434_100025598	Ga0075434_1000255986	250
308	3300006914	Ga0075436_100048855	Ga0075436_1000488551	250
309	3300007265	Ga0099794_10008039	Ga0099794_100080394	250
310	3300009011	Ga0105251_10022324	Ga0105251_100223243	250
311	3300009093	Ga0105240_10060369	Ga0105240_100603695	250
312	3300009093	Ga0105240_10270934	Ga0105240_102709342	250
313	3300009094	Ga0111539_11069313	Ga0111539_110693131	250
314	3300009098	Ga0105245_10189471	Ga0105245_101894712	250
315	3300009101	Ga0105247_10052193	Ga0105247_100521933	250
316	3300009147	Ga0114129_10416380	Ga0114129_104163802	250
317	3300009148	Ga0105243_10087097	Ga0105243_100870974	250
318	3300009148	Ga0105243_10279394	Ga0105243_102793942	250
319	3300009176	Ga0105242_10018737	Ga0105242_100187376	250
320	3300009176	Ga0105242_10025599	Ga0105242_100255994	250
321	3300009177	Ga0105248_10059782	Ga0105248_100597822	250
322	3300009545	Ga0105237_10061713	Ga0105237_100617132	250
323	3300009551	Ga0105238_10060359	Ga0105238_100603591	250
324	3300010159	Ga0099796_10000676	Ga0099796_100006762	250
325	3300010375	Ga0105239_10330254	Ga0105239_103302542	250
326	3300011119	Ga0105246_10460478	Ga0105246_104604781	250
327	3300013102	Ga0157371_10037573	Ga0157371_100375733	250
328	3300013104	Ga0157370_10040663	Ga0157370_100406632	250
329	3300013105	Ga0157369_10108649	Ga0157369_101086492	250
330	3300013296	Ga0157374_10038478	Ga0157374_100384785	250
331	3300013306	Ga0163162_10779514	Ga0163162_107795141	250
332	3300013307	Ga0157372_10501149	Ga0157372_105011491	250
333	3300013308	Ga0157375_10148155	Ga0157375_101481552	250
334	3300014325	Ga0163163_10160575	Ga0163163_101605752	250
335	3300014325	Ga0163163_10184672	Ga0163163_101846722	250
336	3300014326	Ga0157380_10132788	Ga0157380_101327882	250
337	3300014968	Ga0157379_10006702	Ga0157379_100067022	250
338	3300014969	Ga0157376_10127036	Ga0157376_101270363	250
339	3300014969	Ga0157376_10289323	Ga0157376_102893232	250
340	3300017792	Ga0163161_10382861	Ga0163161_103828612	250
341	3300025297	Ga0209758_1024489	Ga0209758_10244892	250
342	3300025898	Ga0207692_10001903	Ga0207692_100019032	250
343	3300025900	Ga0207710_10029677	Ga0207710_100296773	250
344	3300025901	Ga0207688_10101061	Ga0207688_101010612	250
345	3300025905	Ga0207685_10012698	Ga0207685_100126981	250
346	3300025905	Ga0207685_10104683	Ga0207685_101046832	250
347	3300025906	Ga0207699_10002260	Ga0207699_100022605	250
348	3300025909	Ga0207705_10166353	Ga0207705_101663532	250
349	3300025912	Ga0207707_10475862	Ga0207707_104758621	250
350	3300025913	Ga0207695_10057842	Ga0207695_100578425	250
351	3300025915	Ga0207693_10021552	Ga0207693_100215522	250
352	3300025916	Ga0207663_10168014	Ga0207663_101680142	250
353	3300025916	Ga0207663_10205325	Ga0207663_102053252	250
354	3300025917	Ga0207660_10010007	Ga0207660_100100074	250
355	3300025917	Ga0207660_10435253	Ga0207660_104352532	250
356	3300025919	Ga0207657_10045769	Ga0207657_100457692	250
357	3300025919	Ga0207657_10049049	Ga0207657_100490494	250
358	3300025919	Ga0207657_10065752	Ga0207657_100657522	250
359	3300025919	Ga0207657_10106568	Ga0207657_101065683	250
360	3300025921	Ga0207652_10157024	Ga0207652_101570242	250
361	3300025921	Ga0207652_10167764	Ga0207652_101677642	250
362	3300025921	Ga0207652_10193995	Ga0207652_101939952	250
363	3300025924	Ga0207694_10119594	Ga0207694_101195943	250
364	3300025927	Ga0207687_10091146	Ga0207687_100911463	250
365	3300025928	Ga0207700_10133216	Ga0207700_101332162	250
366	3300025929	Ga0207664_10179412	Ga0207664_101794122	250
367	3300025931	Ga0207644_10063441	Ga0207644_100634413	250
368	3300025931	Ga0207644_10474069	Ga0207644_104740692	250
369	3300025932	Ga0207690_10130825	Ga0207690_101308252	250
370	3300025932	Ga0207690_10152384	Ga0207690_101523842	250
371	3300025933	Ga0207706_10004929	Ga0207706_1000492912	250
372	3300025934	Ga0207686_10007788	Ga0207686_100077882	250
373	3300025934	Ga0207686_10543243	Ga0207686_105432431	250
374	3300025936	Ga0207670_10019607	Ga0207670_100196074	250
375	3300025936	Ga0207670_10499269	Ga0207670_104992691	250
376	3300025938	Ga0207704_10025075	Ga0207704_100250753	250
377	3300025938	Ga0207704_10309837	Ga0207704_103098372	250
378	3300025939	Ga0207665_10024282	Ga0207665_100242825	250
379	3300025939	Ga0207665_10040061	Ga0207665_100400612	250
380	3300025940	Ga0207691_10113278	Ga0207691_101132783	250
381	3300025944	Ga0207661_10098844	Ga0207661_100988442	250
382	3300025945	Ga0207679_10076526	Ga0207679_100765262	250
383	3300025949	Ga0207667_10083821	Ga0207667_100838212	250
384	3300025960	Ga0207651_10179439	Ga0207651_101794392	250
385	3300025986	Ga0207658_10084660	Ga0207658_100846604	250
386	3300026035	Ga0207703_10032051	Ga0207703_100320512	250
387	3300026067	Ga0207678_10042784	Ga0207678_100427845	250
388	3300026078	Ga0207702_10035042	Ga0207702_100350422	250
389	3300026088	Ga0207641_10144674	Ga0207641_101446742	250
390	3300026088	Ga0207641_10594153	Ga0207641_105941531	250
391	3300026095	Ga0207676_10005475	Ga0207676_100054752	250
392	3300026118	Ga0207675_100764401	Ga0207675_1007644012	250
393	3300026121	Ga0207683_10006058	Ga0207683_100060585	250
394	3300026121	Ga0207683_10023054	Ga0207683_100230543	250
395	3300026142	Ga0207698_10222073	Ga0207698_102220733	250
396	3300028379	Ga0268266_10118284	Ga0268266_101182842	250
397	3300028381	Ga0268264_10183651	Ga0268264_101836512	250
398	3300028800	Ga0265338_10032074	Ga0265338_100320746	250
399	3300031241	Ga0265325_10035403	Ga0265325_100354032	250
400	3300031247	Ga0265340_10021751	Ga0265340_100217513	250
401	3300031249	Ga0265339_10040103	Ga0265339_100401032	250
402	3300031595	Ga0265313_10000981	Ga0265313_1000098113	250
403	3300031595	Ga0265313_10014177	Ga0265313_100141776	250
404	3300031595	Ga0265313_10036956	Ga0265313_100369563	250
405	3300031665	Ga0316575_10098445	Ga0316575_100984451	250
406	3300031691	Ga0316579_10058415	Ga0316579_100584151	250
407	3300031691	Ga0316579_10058965	Ga0316579_100589651	250
408	3300031711	Ga0265314_10023087	Ga0265314_100230875	250
409	3300031712	Ga0265342_10000503	Ga0265342_100005033	250
410	3300031712	Ga0265342_10022579	Ga0265342_100225794	250
411	3300032126	Ga0307415_100355513	Ga0307415_1003555132	250
412	3300032133	Ga0316583_10043281	Ga0316583_100432812	250
413	3300035083	Ga0373926_0003400	Ga0373926_0003400_1112_1864	250
414	3300035086	Ga0373934_0042218	Ga0373934_0042218_770_1531	250
415	3300035086	Ga0373934_0184541	Ga0373934_0184541_42_794	250
416	3300035089	Ga0373944_0002324	Ga0373944_0002324_3910_4662	250
417	3300035089	Ga0373944_0029896	Ga0373944_0029896_250_1011	250
418	3300035111	Ga0373923_0046808	Ga0373923_0046808_311_1063	250
419	3300035111	Ga0373923_0180719	Ga0373923_0180719_71_847	250
420	3300035113	Ga0373936_0010493	Ga0373936_0010493_2416_3168	250
421	3300035116	Ga0373945_0004935	Ga0373945_0004935_3265_4017	250
422	3300035116	Ga0373945_0011565	Ga0373945_0011565_765_1526	250
423	3300035118	Ga0373954_0006600	Ga0373954_0006600_3048_3809	250
424	3300035119	Ga0373956_0001794	Ga0373956_0001794_3001_3762	250
425	3300035170	Ga0373943_0007338	Ga0373943_0007338_2591_3343	250
426	3300035170	Ga0373943_0065508	Ga0373943_0065508_976_1779	250
427	3300035172	Ga0373955_0093209	Ga0373955_0093209_277_1035	250
428	3300035410	Ga0373924_0101597	Ga0373924_0101597_16_768	250
429	3300035692	Ga0373935_0029354	Ga0373935_0029354_1662_2414	250
430	3300035692	Ga0373935_0083358	Ga0373935_0083358_1025_1786	250
431	3300035695	Ga0373927_0031995	Ga0373927_0031995_2472_3275	250
432	3300035695	Ga0373927_0155675	Ga0373927_0155675_300_1052	250
433	3300035695	Ga0373927_0325985	Ga0373927_0325985_121_882	250
434	3300035724	Ga0373933_0003183	Ga0373933_0003183_3678_4439	250
435	3300035725	Ga0373947_0027508	Ga0373947_0027508_234_995	250
436	3300035725	Ga0373947_0076215	Ga0373947_0076215_738_1490	250
437	3300036401	Ga0373937_0004648	Ga0373937_0004648_10520_11281	250
438	3300036401	Ga0373937_0007053	Ga0373937_0007053_2682_3434	250
439	3300036401	Ga0373937_0049497	Ga0373937_0049497_3053_3811	250
440	3300036401	Ga0373937_0252020	Ga0373937_0252020_616_1377	250
441	3300037068	Ga0373925_0073532	Ga0373925_0073532_1110_1871	250
442	3300037068	Ga0373925_0270013	Ga0373925_0270013_402_1178	250
443	3300037312	Ga0395899_0032806	Ga0395899_0032806_2743_3501	250
444	3300037418	Ga0395900_0010480	Ga0395900_0010480_4420_5178	250
445	3300037466	Ga0395898_0008835	Ga0395898_0008835_4366_5124	250
446	3300038443	Ga0395901_0023626	Ga0395901_0023626_425_1183	250
447	3300044842	Ga0466957_0046779	Ga0466957_0046779_1309_2067	250
448	3300044842	Ga0466957_0248902	Ga0466957_0248902_159_917	250
449	3300045976	Ga0466967_0071995	Ga0466967_0071995_261_1019	250
450	3300046452	Ga0495617_009990	Ga0495617_009990_223_975	250
451	3300046454	Ga0495592_0007012	Ga0495592_0007012_4810_5571	250
452	3300046458	Ga0495591_034046	Ga0495591_034046_219_971	250
453	3300046459	Ga0495629_0020810	Ga0495629_0020810_1416_2168	250
454	3300046461	Ga0495641_0020735	Ga0495641_0020735_1962_2714	250
455	3300046462	Ga0495651_0001089	Ga0495651_0001089_11317_12078	250
456	3300046462	Ga0495651_0024220	Ga0495651_0024220_1813_2565	250
457	3300046463	Ga0495653_0031611	Ga0495653_0031611_2183_2935	250
458	3300046473	Ga0495582_0008446	Ga0495582_0008446_4738_5490	250
459	3300046473	Ga0495582_0095042	Ga0495582_0095042_865_1626	250
460	3300046475	Ga0495639_0061463	Ga0495639_0061463_49_801	250
461	3300046476	Ga0495662_0006899	Ga0495662_0006899_3158_3919	250
462	3300046477	Ga0495664_0002242	Ga0495664_0002242_3227_3979	250
463	3300046477	Ga0495664_0019816	Ga0495664_0019816_596_1357	250
464	3300046491	Ga0495584_0020989	Ga0495584_0020989_1043_1795	250
465	3300046501	Ga0495607_0007291	Ga0495607_0007291_4927_5679	250
466	3300046516	Ga0495628_0123606	Ga0495628_0123606_737_1489	250
467	3300046517	Ga0495630_0074735	Ga0495630_0074735_1539_2342	250
468	3300046517	Ga0495630_0089625	Ga0495630_0089625_1272_2024	250
469	3300046517	Ga0495630_0159306	Ga0495630_0159306_132_893	250
470	3300046520	Ga0495637_0018062	Ga0495637_0018062_2011_2763	250
471	3300046523	Ga0495644_0000599	Ga0495644_0000599_5867_6619	250
472	3300046526	Ga0495666_0010368	Ga0495666_0010368_3265_4017	250
473	3300046526	Ga0495666_0011638	Ga0495666_0011638_1802_2563	250
474	3300046531	Ga0495665_0006584	Ga0495665_0006584_2595_3347	250
475	3300046533	Ga0495640_0065948	Ga0495640_0065948_1239_2000	250
476	3300046535	Ga0495586_0220725	Ga0495586_0220725_23_775	250
477	3300046536	Ga0495587_0005203	Ga0495587_0005203_3564_4316	250
478	3300046538	Ga0495609_0096372	Ga0495609_0096372_193_945	250
479	3300046539	Ga0495621_0021737	Ga0495621_0021737_55_807	250
480	3300046543	Ga0495645_0004692	Ga0495645_0004692_3176_3937	250
481	3300046543	Ga0495645_0189714	Ga0495645_0189714_366_1127	250
482	3300046557	Ga0495622_0001890	Ga0495622_0001890_4469_5221	250
483	3300046558	Ga0495633_0004624	Ga0495633_0004624_5111_5863	250
484	3300046559	Ga0495667_0004099	Ga0495667_0004099_2731_3492	250
485	3300046559	Ga0495667_0005855	Ga0495667_0005855_4488_5240	250
486	3300046559	Ga0495667_0134210	Ga0495667_0134210_235_987	250
487	3300046615	Ga0495656_0000540	Ga0495656_0000540_9148_9900	250
488	3300046642	Ga0495634_0138699	Ga0495634_0138699_184_936	250
489	3300046642	Ga0495634_0141343	Ga0495634_0141343_144_947	250
490	3300046642	Ga0495634_0145066	Ga0495634_0145066_263_1024	250
491	3300046648	Ga0495611_0001929	Ga0495611_0001929_7317_8069	250
492	3300046663	Ga0495635_0283003	Ga0495635_0283003_226_987	250
493	3300046664	Ga0495659_0000299	Ga0495659_0000299_13810_14562	250
494	3300046674	Ga0495588_0097155	Ga0495588_0097155_622_1374	250
495	3300046679	Ga0495623_0009573	Ga0495623_0009573_172_933	250
496	3300046681	Ga0495647_0043387	Ga0495647_0043387_645_1406	250
497	3300046681	Ga0495647_0074677	Ga0495647_0074677_577_1329	250
498	3300046683	Ga0495658_0003748	Ga0495658_0003748_5450_6211	250
499	3300046683	Ga0495658_0114284	Ga0495658_0114284_462_1223	250
500	3300046689	Ga0495613_0027480	Ga0495613_0027480_2551_3303	250
501	3300046689	Ga0495613_0164282	Ga0495613_0164282_766_1527	250
502	3300046689	Ga0495613_0342327	Ga0495613_0342327_243_1004	250
503	3300046690	Ga0495624_0011685	Ga0495624_0011685_3018_3770	250
504	3300046690	Ga0495624_0046338	Ga0495624_0046338_850_1653	250
505	3300046690	Ga0495624_0077234	Ga0495624_0077234_208_969	250
506	3300046690	Ga0495624_0333616	Ga0495624_0333616_59_820	250
507	3300046691	Ga0495670_0063908	Ga0495670_0063908_96_848	250
508	3300046809	Ga0495600_0002294	Ga0495600_0002294_7471_8232	250
509	3300046809	Ga0495600_0003761	Ga0495600_0003761_4076_4828	250
510	3300047315	Ga0495581_0059518	Ga0495581_0059518_106_867	250
511	3300047317	Ga0495604_0019596	Ga0495604_0019596_4154_4906	250
512	3300047317	Ga0495604_0046641	Ga0495604_0046641_311_1072	250
513	3300047317	Ga0495604_0255983	Ga0495604_0255983_146_907	250
514	3300047319	Ga0495674_0058621	Ga0495674_0058621_990_1742	250
515	3300047319	Ga0495674_0101935	Ga0495674_0101935_1238_1999	250
516	3300047319	Ga0495674_0129400	Ga0495674_0129400_1125_1886	250
517	3300047321	Ga0495676_0079923	Ga0495676_0079923_484_1245	250
518	3300047321	Ga0495676_0162867	Ga0495676_0162867_558_1310	250
519	3300047322	Ga0495680_0011192	Ga0495680_0011192_6429_7181	250
520	3300047322	Ga0495680_0031096	Ga0495680_0031096_2464_3225	250
521	3300047446	Ga0495679_012129	Ga0495679_012129_18_770	250
522	3300047471	Ga0495684_0198153	Ga0495684_0198153_467_1228	250
523	3300047673	Ga0495593_0009422	Ga0495593_0009422_2524_3276	250
524	3300047673	Ga0495593_0033732	Ga0495593_0033732_1255_2016	250
525	3300047673	Ga0495593_0061814	Ga0495593_0061814_849_1619	250
526	3300048088	Ga0495602_0084927	Ga0495602_0084927_1464_2216	250
527	3300048089	Ga0495614_0007505	Ga0495614_0007505_4091_4843	250
528	3300048089	Ga0495614_0031475	Ga0495614_0031475_604_1365	250
529	3300048089	Ga0495614_0214712	Ga0495614_0214712_84_836	250
530	3300048903	Ga0496100_0009110	Ga0496100_0009110_3194_3946	250
531	3300048904	Ga0496101_0090099	Ga0496101_0090099_1371_2132	250
532	3300048904	Ga0496101_0377294	Ga0496101_0377294_310_1062	250
533	3300048905	Ga0496102_0082260	Ga0496102_0082260_1465_2226	250
534	3300048905	Ga0496102_0354390	Ga0496102_0354390_72_824	250
535	3300048906	Ga0496103_0043466	Ga0496103_0043466_979_1740	250
536	3300048907	Ga0496104_0026796	Ga0496104_0026796_2882_3643	250
537	3300048908	Ga0496105_0017729	Ga0496105_0017729_3325_4086	250
538	3300048909	Ga0496106_0007080	Ga0496106_0007080_4708_5469	250
539	3300048909	Ga0496106_0635464	Ga0496106_0635464_31_783	250
540	3300048910	Ga0496107_0031770	Ga0496107_0031770_27_788	250
541	3300048911	Ga0496108_0296790	Ga0496108_0296790_150_911	250
542	3300048911	Ga0496108_0413819	Ga0496108_0413819_42_794	250
543	3300048912	Ga0496109_0020433	Ga0496109_0020433_4226_4987	250
544	3300048912	Ga0496109_0136793	Ga0496109_0136793_1286_2038	250
545	3300048913	Ga0496110_0089635	Ga0496110_0089635_1010_1771	250
546	3300048913	Ga0496110_0092686	Ga0496110_0092686_915_1667	250
547	3300048915	Ga0496112_0077122	Ga0496112_0077122_2292_3044	250
548	3300048916	Ga0496113_0051584	Ga0496113_0051584_1325_2077	250
549	3300048917	Ga0496114_0044776	Ga0496114_0044776_1805_2566	250
550	3300049568	Ga0501031_0001349	Ga0501031_0001349_11971_12741	250
551	3300049569	Ga0501032_0050522	Ga0501032_0050522_228_1022	250
552	3300049571	Ga0501034_0015146	Ga0501034_0015146_349_1119	250
553	3300049572	Ga0501036_0037872	Ga0501036_0037872_1662_2432	250
554	3300049573	Ga0501037_0002560	Ga0501037_0002560_1076_1846	250
555	3300049574	Ga0501038_0026843	Ga0501038_0026843_2614_3384	250
556	3300049575	Ga0501039_0018390	Ga0501039_0018390_1043_1813	250
557	3300049579	Ga0501043_0186468	Ga0501043_0186468_271_1041	250
558	3300049581	Ga0501047_0023326	Ga0501047_0023326_3414_4184	250
559	3300049585	Ga0501069_0170209	Ga0501069_0170209_458_1231	250
560	3300049586	Ga0501070_0022894	Ga0501070_0022894_1792_2562	250
561	3300049588	Ga0501072_0100013	Ga0501072_0100013_830_1603	250
562	3300049589	Ga0501073_0272183	Ga0501073_0272183_131_892	250
563	3300049590	Ga0501074_0425348	Ga0501074_0425348_55_822	250
564	3300049591	Ga0501075_0441329	Ga0501075_0441329_30_791	250
565	3300049742	Ga0501080_0600908	Ga0501080_0600908_131_892	250
566	3300049822	Ga0501035_0051570	Ga0501035_0051570_2218_2988	250
567	3300049823	Ga0501044_0092804	Ga0501044_0092804_804_1571	250
568	3300050507	nmdc:mga05p37_271264_c1	nmdc:mga05p37_271264_c1_86_847	250
569	3300050509	nmdc:mga0qj67_264_c1	nmdc:mga0qj67_264_c1_24389_25168	250
570	3300050510	nmdc:mga06r32_71705_c1	nmdc:mga06r32_71705_c1_1764_2528	250
571	3300050514	nmdc:mga08x19_260510_c1	nmdc:mga08x19_260510_c1_115_867	250
572	3300053077	Ga0495601_0002862	Ga0495601_0002862_8418_9221	250
573	3300053077	Ga0495601_0010516	Ga0495601_0010516_94_855	250
574	3300053077	Ga0495601_0082047	Ga0495601_0082047_263_1024	250
575	3300053077	Ga0495601_0182304	Ga0495601_0182304_300_1052	250
576	3300053078	Ga0495612_0002742	Ga0495612_0002742_2692_3444	250
577	3300053078	Ga0495612_0013320	Ga0495612_0013320_1296_2057	250
578	3300053084	Ga0495595_0002949	Ga0495595_0002949_4661_5422	250
579	3300053084	Ga0495595_0016441	Ga0495595_0016441_600_1352	250
580	3300053085	Ga0495619_0076616	Ga0495619_0076616_313_1074	250
581	3300053085	Ga0495619_0140021	Ga0495619_0140021_786_1538	250
582	3300053085	Ga0495619_0503841	Ga0495619_0503841_12_773	250
583	3300053094	Ga0500566_0098625	Ga0500566_0098625_10_762	250
584	3300053130	Ga0500642_0134265	Ga0500642_0134265_316_1113	250
585	3300053153	Ga0500616_0000002	Ga0500616_0000002_376311_377066	250
586	3300053153	Ga0500616_0017906	Ga0500616_0017906_1724_2494	250
587	3300053153	Ga0500616_0052929	Ga0500616_0052929_813_1574	250
588	3300060353	Ga0501082_0054742	Ga0501082_0054742_1358_2131	250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03740

PdxJ

Pyridoxal phosphate biosynthesis protein PdxJ

1

213

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3f4n-assembly5.cif.gz_B	crystal structure of pyridoxal phosphate biosynthetic protein pdxj from yersinia pestis	0.9736	4	245
1ixo-assembly3.cif.gz_A-2	enzyme-analogue substrate complex of pyridoxine 5'-phosphate synthase	0.9721	3	245
3f4n-assembly2.cif.gz_C	crystal structure of pyridoxal phosphate biosynthetic protein pdxj from yersinia pestis	0.971	1	245
1ho1-assembly1.cif.gz_C	crystal structure of pyridoxine 5'-phosphate synthase	0.9709	3	245
5dlc-assembly2.cif.gz_D	x-ray crystal structure of a pyridoxine 5-prime-phosphate synthase from pseudomonas aeruginosa	0.9674	2	244

ID	Description	Score	Start	End	Superfamily
3gk0A00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9668	4	250	3.20.20.70
3gk0A00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9405	4	250	3.20.20.70
3o6cA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.9244	3	240	3.20.20.70
3o6cA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.878	3	240	3.20.20.70
4b6xB00	Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;	0.8717	158	188	1.20.58.90

ID	Description	Score	Start	End	GO Terms
AF-A0A537Y7U7-F1-model_v4	Pyridoxine 5'-phosphate synthase	1.005	154	246	GO:0005829 GO:0008615 GO:0033856
AF-A0A259JFY7-F1-model_v4	Pyridoxine 5'-phosphate synthase	1.001	131	249	GO:0005829 GO:0008615 GO:0033856
AF-A0A258DKV7-F1-model_v4	Pyridoxine 5'-phosphate synthase	0.998	179	249	GO:0005829 GO:0008615 GO:0033856
AF-A0A259BJH5-F1-model_v4	Pyridoxine 5'-phosphate synthase	0.9955	149	249	GO:0005829 GO:0008615 GO:0033856
AF-A0A537UE93-F1-model_v4	Pyridoxine 5'-phosphate synthase	0.9942	83	245	GO:0005829 GO:0008615 GO:0033856

Feature Viewer

pLDDT	pTM	Quality
94.13	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F466816

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03740

PdxJ

Pyridoxal phosphate biosynthesis protein PdxJ

1

213

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map