F466832

General Info

Members Datasets Scaffolds Average Seq Length
589 201 589 233

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10163421|rootH2_101634212
Length 203
Sequence MSAAPPARFAAPDFLAKRIVRQGLLADPNVLSETVEALRDAQYAPVLAAARAQVETPFASSWKGSAKPDVTLVEFFDYACPYCKAAEPRLMRLVDSDKRIKLVMKEFPILTKYRAFHLAMMRREGLWGEAEVMETAKAAGVDVARARKDMAAPDVTEEIINNFNLARGIRVFQTPAYIVGTHLVTGDSADINFAREVARVKGK

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
165 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.13
Rhizosphere 92.36
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1019284 3300001915 Unclassified 1082
2 JGI24740J21852_10003330 3300001979 Bacteria 7079
3 JGI24739J22299_10004158 3300001989 Bacteria 5537
4 JGI24739J22299_10029885 3300001989 Bacteria 1891
5 JGI24737J22298_10000217 3300001990 Bacteria 18839
6 JGI24737J22298_10003877 3300001990 Bacteria 5258
7 JGI24737J22298_10007003 3300001990 Bacteria 3822
8 JGI24743J22301_10000819 3300001991 Bacteria 3932
9 JGI24738J21930_10000735 3300002075 Bacteria 9431
10 JGI24744J21845_10004598 3300002077 Bacteria 2855
11 rootH2_10163421 3300003320 Bacteria 1112
12 rootH2_10189223 3300003320 Bacteria 2277
13 rootH1_10214375 3300003323 Bacteria 1004
14 Ga0065715_10045623 3300005293 Bacteria 1781
15 Ga0070658_10006416 3300005327 Bacteria 9532
16 Ga0070658_10011760 3300005327 Bacteria 7024
17 Ga0070658_10024696 3300005327 Bacteria 4819
18 Ga0070658_10051515 3300005327 Bacteria 3336
19 Ga0070658_10102018 3300005327 Bacteria 2372
20 Ga0070658_10630332 3300005327 Bacteria 930
21 Ga0070676_10011606 3300005328 Bacteria 4792
22 Ga0070676_10029067 3300005328 Bacteria 3142
23 Ga0070690_100018793 3300005330 Bacteria 4182
24 Ga0070690_100036611 3300005330 Bacteria 3085
25 Ga0070690_100231715 3300005330 Bacteria 1299
26 Ga0070670_100022879 3300005331 Bacteria 5377
27 Ga0070670_100087427 3300005331 Bacteria 2679
28 Ga0070670_100095695 3300005331 Bacteria 2554
29 Ga0070670_100108266 3300005331 Bacteria 2394
30 Ga0070677_10005849 3300005333 Bacteria 4073
31 Ga0068869_100000206 3300005334 Bacteria 30729
32 Ga0070666_10010222 3300005335 Bacteria 5863
33 Ga0070666_10013410 3300005335 Bacteria 5200
34 Ga0070666_10024519 3300005335 Bacteria 3930
35 Ga0070666_10031387 3300005335 Bacteria 3507
36 Ga0070682_100136797 3300005337 Bacteria 1665
37 Ga0068868_100000357 3300005338 Bacteria 31007
38 Ga0068868_100001171 3300005338 Bacteria 17966
39 Ga0068868_100010802 3300005338 Bacteria 6623
40 Ga0068868_100058476 3300005338 Bacteria 3047
41 Ga0068868_100073595 3300005338 Bacteria 2728
42 Ga0070660_100001572 3300005339 Bacteria 15695
43 Ga0070660_100020834 3300005339 Bacteria 4826
44 Ga0070660_100027728 3300005339 Bacteria 4230
45 Ga0070660_100031682 3300005339 Bacteria 3973
46 Ga0070660_100053207 3300005339 Bacteria 3122
47 Ga0070660_100097355 3300005339 Bacteria 2327
48 Ga0070689_100444441 3300005340 Unclassified 1102
49 Ga0070687_100029399 3300005343 Bacteria 2676
50 Ga0070661_100009242 3300005344 Bacteria 6814
51 Ga0070661_100078786 3300005344 Bacteria 2431
52 Ga0070661_100108525 3300005344 Bacteria 2071
53 Ga0070661_100153316 3300005344 Bacteria 1742
54 Ga0070692_10013468 3300005345 Bacteria 3813
55 Ga0070692_10043414 3300005345 Bacteria 2311
56 Ga0070668_100188767 3300005347 Bacteria 1687
57 Ga0070668_100703929 3300005347 Bacteria 891
58 Ga0070669_100000665 3300005353 Bacteria 25327
59 Ga0070669_100104526 3300005353 Bacteria 2141
60 Ga0070671_100000212 3300005355 Bacteria 38767
61 Ga0070671_100001537 3300005355 Bacteria 17332
62 Ga0070671_100017864 3300005355 Bacteria 5750
63 Ga0070671_100020524 3300005355 Bacteria 5389
64 Ga0070671_100033451 3300005355 Bacteria 4252
65 Ga0070671_100049688 3300005355 Bacteria 3489
66 Ga0070671_100072839 3300005355 Bacteria 2869
67 Ga0070674_100021398 3300005356 Bacteria 4151
68 Ga0070674_100071510 3300005356 Bacteria 2454
69 Ga0070674_100104375 3300005356 Bacteria 2071
70 Ga0070673_100001506 3300005364 Bacteria 13683
71 Ga0070673_100103882 3300005364 Bacteria 2345
72 Ga0070673_100126762 3300005364 Bacteria 2137
73 Ga0070673_100163550 3300005364 Bacteria 1894
74 Ga0070659_100001452 3300005366 Bacteria 17075
75 Ga0070659_100008972 3300005366 Bacteria 7331
76 Ga0070659_100015877 3300005366 Bacteria 5647
77 Ga0070659_100056896 3300005366 Bacteria 3083
78 Ga0070659_100067445 3300005366 Bacteria 2838
79 Ga0070659_100082527 3300005366 Bacteria 2568
80 Ga0070659_100263439 3300005366 Bacteria 1430
81 Ga0070659_100567516 3300005366 Unclassified 973
82 Ga0070667_100001664 3300005367 Bacteria 19850
83 Ga0070667_100004890 3300005367 Bacteria 11219
84 Ga0070667_100017502 3300005367 Bacteria 5940
85 Ga0070667_100034479 3300005367 Bacteria 4234
86 Ga0070667_100043599 3300005367 Bacteria 3765
87 Ga0070667_100150230 3300005367 Bacteria 2046
88 Ga0070667_100242253 3300005367 Bacteria 1610
89 Ga0070714_100015473 3300005435 Bacteria 6138
90 Ga0070714_100019783 3300005435 Bacteria 5491
91 Ga0070713_100035736 3300005436 Bacteria 4003
92 Ga0070713_100065720 3300005436 Bacteria 3048
93 Ga0070694_100005801 3300005444 Bacteria 7491
94 Ga0070663_100014704 3300005455 Bacteria 5029
95 Ga0070663_100024350 3300005455 Bacteria 4073
96 Ga0070663_100074796 3300005455 Bacteria 2474
97 Ga0070663_100258104 3300005455 Bacteria 1382
98 Ga0070662_100000799 3300005457 Bacteria 19352
99 Ga0070662_100001429 3300005457 Bacteria 14745
100 Ga0070662_100005565 3300005457 Bacteria 8051
101 Ga0070662_100028212 3300005457 Bacteria 3904
102 Ga0070662_100032776 3300005457 Bacteria 3653
103 Ga0070662_100072438 3300005457 Bacteria 2544
104 Ga0070662_100075071 3300005457 Bacteria 2503
105 Ga0068867_100000728 3300005459 Bacteria 22034
106 Ga0068867_100008740 3300005459 Bacteria 7150
107 Ga0070685_10201810 3300005466 Bacteria 1293
108 Ga0070679_100186510 3300005530 Bacteria 2045
109 Ga0068853_100001135 3300005539 Bacteria 18856
110 Ga0068853_100117122 3300005539 Unclassified 2373
111 Ga0068853_100498276 3300005539 Bacteria 1150
112 Ga0070672_100000252 3300005543 Bacteria 30208
113 Ga0070672_100086371 3300005543 Bacteria 2523
114 Ga0070672_100301986 3300005543 Bacteria 1357
115 Ga0070696_100108966 3300005546 Bacteria 1993
116 Ga0070693_100021123 3300005547 Plasmid 3445
117 Ga0070693_100069574 3300005547 Bacteria 2069
118 Ga0070693_100101843 3300005547 Bacteria 1751
119 Ga0070693_100153318 3300005547 Unclassified 1461
120 Ga0070665_100002211 3300005548 Bacteria 21716
121 Ga0070665_100004862 3300005548 Bacteria 13962
122 Ga0070665_100004918 3300005548 Bacteria 13862
123 Ga0070665_100010166 3300005548 Bacteria 9515
124 Ga0070665_100013436 3300005548 Bacteria 8238
125 Ga0070665_100033101 3300005548 Bacteria 5201
126 Ga0070704_100242718 3300005549 Bacteria 1475
127 Ga0068855_100119267 3300005563 Bacteria 3021
128 Ga0068855_100148685 3300005563 Bacteria 2664
129 Ga0068855_100210389 3300005563 Bacteria 2186
130 Ga0070664_100002458 3300005564 Bacteria 14922
131 Ga0070664_100005426 3300005564 Bacteria 10233
132 Ga0070664_100041951 3300005564 Bacteria 3863
133 Ga0070664_100090241 3300005564 Bacteria 2652
134 Ga0070664_100119669 3300005564 Bacteria 2304
135 Ga0070664_100492248 3300005564 Bacteria 1129
136 Ga0070664_100531942 3300005564 Bacteria 1086
137 Ga0068857_100000311 3300005577 Bacteria 33662
138 Ga0068857_100008184 3300005577 Bacteria 9033
139 Ga0068857_100019023 3300005577 Bacteria 6026
140 Ga0068854_100000744 3300005578 Bacteria 19264
141 Ga0068854_100001807 3300005578 Bacteria 13011
142 Ga0068854_100117701 3300005578 Bacteria 2012
143 Ga0068854_100118648 3300005578 Bacteria 2005
144 Ga0068854_100166437 3300005578 Bacteria 1712
145 Ga0068854_100192964 3300005578 Bacteria 1597
146 Ga0068854_100198269 3300005578 Bacteria 1576
147 Ga0068856_100064475 3300005614 Bacteria 3620
148 Ga0068856_100079750 3300005614 Bacteria 3246
149 Ga0068852_100000917 3300005616 Bacteria 19516
150 Ga0068852_100037196 3300005616 Bacteria 4079
151 Ga0068852_100058743 3300005616 Bacteria 3333
152 Ga0068852_100208505 3300005616 Unclassified 1853
153 Ga0068852_100220528 3300005616 Bacteria 1803
154 Ga0068859_100002640 3300005617 Bacteria 18240
155 Ga0068859_100015919 3300005617 Bacteria 7558
156 Ga0068864_100000539 3300005618 Bacteria 32424
157 Ga0068864_100086558 3300005618 Bacteria 2757
158 Ga0068864_100088204 3300005618 Bacteria 2732
159 Ga0068864_100121793 3300005618 Bacteria 2333
160 Ga0068864_100153118 3300005618 Bacteria 2090
161 Ga0068864_100467308 3300005618 Bacteria 1209
162 Ga0068866_10006380 3300005718 Bacteria 4911
163 Ga0068851_10009070 3300005834 Bacteria 4616
164 Ga0068851_10026757 3300005834 Bacteria 2837
165 Ga0068851_10035637 3300005834 Bacteria 2488
166 Ga0068851_10087769 3300005834 Bacteria 1634
167 Ga0068851_10108445 3300005834 Bacteria 1480
168 Ga0068863_100007928 3300005841 Bacteria 10381
169 Ga0068863_100009535 3300005841 Bacteria 9465
170 Ga0068863_100019832 3300005841 Bacteria 6431
171 Ga0068863_100024847 3300005841 Bacteria 5714
172 Ga0068858_100000698 3300005842 Bacteria 35076
173 Ga0068858_100001273 3300005842 Bacteria 26088
174 Ga0068858_100002196 3300005842 Bacteria 19760
175 Ga0068858_100059517 3300005842 Bacteria 3530
176 Ga0068858_100069650 3300005842 Bacteria 3261
177 Ga0068858_100213544 3300005842 Unclassified 1826
178 Ga0068860_100030209 3300005843 Bacteria 5211
179 Ga0068860_100032848 3300005843 Bacteria 4985
180 Ga0068860_100048108 3300005843 Bacteria 4065
181 Ga0068860_100313682 3300005843 Bacteria 1538
182 Ga0068860_100322167 3300005843 Unclassified 1517
183 Ga0068862_100004596 3300005844 Bacteria 11630
184 Ga0070717_10243545 3300006028 Bacteria 1586
185 Ga0070715_10100727 3300006163 Bacteria 1347
186 Ga0070716_100006823 3300006173 Bacteria 5597
187 Ga0070712_100164654 3300006175 Bacteria 1715
188 Ga0097621_100036321 3300006237 Bacteria 3942
189 Ga0097621_100128674 3300006237 Bacteria 2153
190 Ga0068871_100024070 3300006358 Bacteria 4718
191 Ga0068871_100435361 3300006358 Unclassified 1173
192 Ga0068865_100003600 3300006881 Bacteria 9312
193 Ga0068865_100009553 3300006881 Bacteria 6021
194 Ga0068865_100042510 3300006881 Bacteria 3099
195 Ga0097620_100002640 3300006931 Bacteria 18240
196 Ga0097620_100015919 3300006931 Bacteria 7558
197 Ga0105245_10000345 3300009098 Bacteria 43597
198 Ga0105245_10023574 3300009098 Bacteria 5402
199 Ga0105245_10027511 3300009098 Bacteria 5011
200 Ga0105243_10062763 3300009148 Bacteria 2975
201 Ga0105241_10287198 3300009174 Unclassified 1407
202 Ga0105242_10109459 3300009176 Bacteria 2352
203 Ga0105248_10001053 3300009177 Bacteria 30546
204 Ga0105248_10003112 3300009177 Bacteria 18370
205 Ga0105248_10007395 3300009177 Bacteria 12055
206 Ga0105248_10009395 3300009177 Bacteria 10767
207 Ga0105248_10010225 3300009177 Bacteria 10331
208 Ga0105248_10011440 3300009177 Bacteria 9780
209 Ga0105248_10054636 3300009177 Bacteria 4479
210 Ga0105248_10118730 3300009177 Bacteria 2983
211 Ga0105248_10500350 3300009177 Bacteria 1370
212 Ga0105237_10256259 3300009545 Bacteria 1752
213 Ga0105238_10036279 3300009551 Bacteria 5010
214 Ga0105249_10008193 3300009553 Bacteria 9107
215 Ga0105249_10054905 3300009553 Bacteria 3643
216 Ga0105246_10099522 3300011119 Bacteria 2114
217 Ga0157373_10002786 3300013100 Bacteria 13221
218 Ga0157373_10011456 3300013100 Bacteria 6521
219 Ga0157373_10016875 3300013100 Bacteria 5324
220 Ga0157373_10036671 3300013100 Bacteria 3518
221 Ga0157373_10069397 3300013100 Bacteria 2492
222 Ga0157371_10005567 3300013102 Bacteria 10594
223 Ga0157371_10265504 3300013102 Bacteria 1238
224 Ga0157370_10086197 3300013104 Bacteria 2951
225 Ga0157369_10097281 3300013105 Bacteria 3140
226 Ga0157374_10055589 3300013296 Bacteria 3694
227 Ga0157374_10123137 3300013296 Bacteria 2505
228 Ga0157374_10128993 3300013296 Bacteria 2446
229 Ga0157374_10463709 3300013296 Bacteria 1269
230 Ga0157374_10652556 3300013296 Bacteria 1064
231 Ga0157378_10008802 3300013297 Bacteria 8787
232 Ga0157378_10111926 3300013297 Bacteria 2504
233 Ga0163162_10005625 3300013306 Bacteria 12112
234 Ga0163162_10040852 3300013306 Bacteria 4640
235 Ga0163162_10216253 3300013306 Unclassified 2047
236 Ga0157372_10063174 3300013307 Bacteria 4151
237 Ga0157372_10280064 3300013307 Bacteria 1939
238 Ga0157375_10008995 3300013308 Bacteria 8742
239 Ga0157375_10035646 3300013308 Bacteria 4751
240 Ga0157375_10221221 3300013308 Bacteria 2052
241 Ga0157375_10253865 3300013308 Bacteria 1919
242 Ga0157375_10281496 3300013308 Bacteria 1826
243 Ga0157375_10957718 3300013308 Bacteria 997
244 Ga0163163_10006833 3300014325 Bacteria 10011
245 Ga0182008_10324195 3300014497 Bacteria 811
246 Ga0157379_10007107 3300014968 Bacteria 9682
247 Ga0157379_10015552 3300014968 Bacteria 6679
248 Ga0157379_10616146 3300014968 Unclassified 1014
249 Ga0206353_10112932 3300020082 Bacteria 2385
250 Ga0207697_10000126 3300025315 Bacteria 36583
251 Ga0207697_10011504 3300025315 Bacteria 3741
252 Ga0207682_10006624 3300025893 Bacteria 4657
253 Ga0207642_10016085 3300025899 Bacteria 2808
254 Ga0207688_10000322 3300025901 Bacteria 22144
255 Ga0207680_10011355 3300025903 Bacteria 4500
256 Ga0207680_10021717 3300025903 Bacteria 3477
257 Ga0207680_10037682 3300025903 Bacteria 2793
258 Ga0207647_10000454 3300025904 Bacteria 33337
259 Ga0207647_10008463 3300025904 Bacteria 7375
260 Ga0207647_10116227 3300025904 Bacteria 1579
261 Ga0207645_10039934 3300025907 Bacteria 3006
262 Ga0207645_10092302 3300025907 Bacteria 1947
263 Ga0207645_10115500 3300025907 Bacteria 1740
264 Ga0207643_10049795 3300025908 Bacteria 2374
265 Ga0207705_10004511 3300025909 Bacteria 10524
266 Ga0207705_10007795 3300025909 Bacteria 7863
267 Ga0207705_10017158 3300025909 Bacteria 5186
268 Ga0207705_10026652 3300025909 Bacteria 4120
269 Ga0207705_10033299 3300025909 Bacteria 3680
270 Ga0207705_10072938 3300025909 Bacteria 2490
271 Ga0207705_10120262 3300025909 Bacteria 1948
272 Ga0207705_10160025 3300025909 Bacteria 1691
273 Ga0207705_10204153 3300025909 Bacteria 1498
274 Ga0207707_10321727 3300025912 Bacteria 1335
275 Ga0207657_10001942 3300025919 Bacteria 22329
276 Ga0207657_10006524 3300025919 Bacteria 12087
277 Ga0207657_10006637 3300025919 Bacteria 11976
278 Ga0207657_10021894 3300025919 Bacteria 6003
279 Ga0207657_10062220 3300025919 Bacteria 3197
280 Ga0207657_10066147 3300025919 Bacteria 3078
281 Ga0207657_10134115 3300025919 Bacteria 2028
282 Ga0207649_10016046 3300025920 Bacteria 4217
283 Ga0207649_10018797 3300025920 Bacteria 3939
284 Ga0207649_10020295 3300025920 Bacteria 3809
285 Ga0207649_10088205 3300025920 Bacteria 2025
286 Ga0207649_10100984 3300025920 Bacteria 1909
287 Ga0207649_10128839 3300025920 Bacteria 1716
288 Ga0207649_10173931 3300025920 Unclassified 1502
289 Ga0207649_10268181 3300025920 Bacteria 1236
290 Ga0207652_10040839 3300025921 Unclassified 3941
291 Ga0207652_10226123 3300025921 Bacteria 1686
292 Ga0207681_10002095 3300025923 Bacteria 12781
293 Ga0207650_10050578 3300025925 Bacteria 3074
294 Ga0207650_10161378 3300025925 Unclassified 1776
295 Ga0207650_10223620 3300025925 Bacteria 1516
296 Ga0207659_10128740 3300025926 Bacteria 1950
297 Ga0207687_10010640 3300025927 Bacteria 6012
298 Ga0207687_10015454 3300025927 Bacteria 5006
299 Ga0207687_10114359 3300025927 Bacteria 2008
300 Ga0207700_10099585 3300025928 Bacteria 2314
301 Ga0207664_10034652 3300025929 Bacteria 3889
302 Ga0207644_10003407 3300025931 Bacteria 10259
303 Ga0207644_10011990 3300025931 Bacteria 5748
304 Ga0207644_10015843 3300025931 Bacteria 5069
305 Ga0207644_10020625 3300025931 Bacteria 4484
306 Ga0207644_10026785 3300025931 Bacteria 3977
307 Ga0207644_10043431 3300025931 Bacteria 3189
308 Ga0207644_10061925 3300025931 Bacteria 2711
309 Ga0207644_10357286 3300025931 Bacteria 1187
310 Ga0207690_10010441 3300025932 Bacteria 5519
311 Ga0207690_10017751 3300025932 Bacteria 4352
312 Ga0207690_10019076 3300025932 Bacteria 4214
313 Ga0207690_10057370 3300025932 Bacteria 2630
314 Ga0207690_10187805 3300025932 Bacteria 1561
315 Ga0207690_10348530 3300025932 Bacteria 1170
316 Ga0207706_10000906 3300025933 Bacteria 30490
317 Ga0207706_10001111 3300025933 Bacteria 27391
318 Ga0207706_10003880 3300025933 Bacteria 14211
319 Ga0207706_10011920 3300025933 Bacteria 7915
320 Ga0207706_10098712 3300025933 Bacteria 2569
321 Ga0207706_10320018 3300025933 Viruses 1350
322 Ga0207706_10339935 3300025933 Bacteria 1306
323 Ga0207709_10083802 3300025935 Bacteria 2062
324 Ga0207709_10193994 3300025935 Bacteria 1445
325 Ga0207709_10208069 3300025935 Unclassified 1402
326 Ga0207669_10020221 3300025937 Bacteria 3485
327 Ga0207669_10046721 3300025937 Bacteria 2560
328 Ga0207704_10007140 3300025938 Bacteria 5258
329 Ga0207665_10024770 3300025939 Bacteria 3958
330 Ga0207691_10001556 3300025940 Bacteria 22756
331 Ga0207691_10024055 3300025940 Bacteria 5729
332 Ga0207691_10085225 3300025940 Bacteria 2836
333 Ga0207691_10106213 3300025940 Bacteria 2501
334 Ga0207691_10221120 3300025940 Bacteria 1642
335 Ga0207711_10000305 3300025941 Bacteria 52775
336 Ga0207711_10000896 3300025941 Bacteria 28670
337 Ga0207711_10002485 3300025941 Bacteria 16450
338 Ga0207711_10028810 3300025941 Bacteria 4677
339 Ga0207711_10218734 3300025941 Bacteria 1741
340 Ga0207689_10000486 3300025942 Bacteria 37525
341 Ga0207661_10095464 3300025944 Bacteria 2486
342 Ga0207661_10159493 3300025944 Bacteria 1956
343 Ga0207679_10005792 3300025945 Bacteria 7759
344 Ga0207679_10024362 3300025945 Bacteria 4148
345 Ga0207679_10024937 3300025945 Bacteria 4106
346 Ga0207679_10027631 3300025945 Bacteria 3926
347 Ga0207679_10123746 3300025945 Bacteria 2063
348 Ga0207679_10147100 3300025945 Bacteria 1912
349 Ga0207679_10235820 3300025945 Bacteria 1547
350 Ga0207679_10379453 3300025945 Bacteria 1239
351 Ga0207667_10007136 3300025949 Bacteria 13489
352 Ga0207667_10266913 3300025949 Bacteria 1750
353 Ga0207667_10373287 3300025949 Bacteria 1453
354 Ga0207667_10459588 3300025949 Bacteria 1293
355 Ga0207651_10001001 3300025960 Bacteria 12470
356 Ga0207651_10005072 3300025960 Bacteria 6718
357 Ga0207651_10023427 3300025960 Bacteria 3798
358 Ga0207651_10028555 3300025960 Bacteria 3521
359 Ga0207651_10111137 3300025960 Bacteria 2057
360 Ga0207651_10133516 3300025960 Bacteria 1904
361 Ga0207651_10580798 3300025960 Bacteria 978
362 Ga0207712_10011364 3300025961 Bacteria 5673
363 Ga0207668_10548650 3300025972 Bacteria 1001
364 Ga0207640_10027331 3300025981 Bacteria 3475
365 Ga0207640_10036745 3300025981 Bacteria 3077
366 Ga0207640_10060298 3300025981 Unclassified 2507
367 Ga0207640_10085284 3300025981 Bacteria 2171
368 Ga0207640_10105084 3300025981 Bacteria 1989
369 Ga0207658_10001198 3300025986 Bacteria 20677
370 Ga0207658_10004950 3300025986 Bacteria 9189
371 Ga0207658_10006011 3300025986 Bacteria 8292
372 Ga0207658_10010008 3300025986 Bacteria 6444
373 Ga0207658_10024944 3300025986 Bacteria 4184
374 Ga0207658_10037474 3300025986 Bacteria 3485
375 Ga0207677_10001583 3300026023 Bacteria 12062
376 Ga0207677_10006057 3300026023 Bacteria 6596
377 Ga0207677_10015474 3300026023 Bacteria 4490
378 Ga0207677_10044940 3300026023 Bacteria 2947
379 Ga0207677_10175520 3300026023 Bacteria 1680
380 Ga0207677_10266758 3300026023 Bacteria 1398
381 Ga0207703_10001860 3300026035 Bacteria 18758
382 Ga0207703_10002395 3300026035 Bacteria 16298
383 Ga0207703_10019192 3300026035 Bacteria 5340
384 Ga0207639_10012499 3300026041 Bacteria 5914
385 Ga0207639_10028261 3300026041 Bacteria 4093
386 Ga0207639_10054337 3300026041 Bacteria 3060
387 Ga0207678_10001918 3300026067 Bacteria 18985
388 Ga0207678_10003630 3300026067 Bacteria 13870
389 Ga0207678_10023043 3300026067 Bacteria 5449
390 Ga0207678_10028632 3300026067 Bacteria 4862
391 Ga0207678_10034928 3300026067 Bacteria 4378
392 Ga0207678_10190794 3300026067 Bacteria 1751
393 Ga0207678_10263877 3300026067 Bacteria 1476
394 Ga0207678_10267468 3300026067 Bacteria 1466
395 Ga0207678_10436791 3300026067 Bacteria 1136
396 Ga0207678_10506528 3300026067 Bacteria 1053
397 Ga0207702_10015179 3300026078 Bacteria 6385
398 Ga0207702_10070392 3300026078 Bacteria 3008
399 Ga0207702_10070974 3300026078 Bacteria 2997
400 Ga0207641_10000401 3300026088 Bacteria 50998
401 Ga0207641_10020327 3300026088 Bacteria 5453
402 Ga0207648_10003492 3300026089 Bacteria 16469
403 Ga0207648_10009797 3300026089 Bacteria 9154
404 Ga0207648_10016776 3300026089 Bacteria 6679
405 Ga0207648_10020735 3300026089 Bacteria 5917
406 Ga0207676_10003455 3300026095 Bacteria 11181
407 Ga0207676_10017923 3300026095 Bacteria 5138
408 Ga0207676_10024892 3300026095 Bacteria 4435
409 Ga0207676_10327262 3300026095 Bacteria 1409
410 Ga0207676_10487893 3300026095 Bacteria 1168
411 Ga0207674_10000151 3300026116 Bacteria 81529
412 Ga0207674_10001172 3300026116 Bacteria 34017
413 Ga0207675_100199000 3300026118 Bacteria 1924
414 Ga0207675_100634212 3300026118 Bacteria 1074
415 Ga0207683_10114587 3300026121 Bacteria 2415
416 Ga0207698_10002206 3300026142 Bacteria 11504
417 Ga0207698_10021033 3300026142 Bacteria 4505
418 Ga0207698_10072365 3300026142 Bacteria 2740
419 Ga0207698_10107411 3300026142 Bacteria 2330
420 Ga0207698_10534654 3300026142 Bacteria 1146
421 Ga0268266_10000733 3300028379 Bacteria 44017
422 Ga0268266_10004937 3300028379 Bacteria 12635
423 Ga0268266_10027041 3300028379 Bacteria 4881
424 Ga0268266_10042575 3300028379 Bacteria 3879
425 Ga0268266_10275841 3300028379 Bacteria 1562
426 Ga0268265_10002118 3300028380 Bacteria 15390
427 Ga0268264_10028070 3300028381 Bacteria 4603
428 Ga0268264_10049604 3300028381 Bacteria 3493
429 Ga0268264_10286459 3300028381 Bacteria 1545
430 Ga0268264_10297818 3300028381 Unclassified 1517
431 Ga0307408_100155922 3300031548 Bacteria 1808
432 Ga0307413_10085150 3300031824 Bacteria 2040
433 Ga0307406_10652864 3300031901 Bacteria 873
434 Ga0307407_10037676 3300031903 Bacteria 2673
435 Ga0307409_100039816 3300031995 Bacteria 3492
436 Ga0307416_100004705 3300032002 Bacteria 8269
437 Ga0307416_100425627 3300032002 Bacteria 1373
438 Ga0307414_10184220 3300032004 Bacteria 1683
439 Ga0307414_10725235 3300032004 Unclassified 902
440 Ga0307415_100014195 3300032126 Bacteria 4675
441 Ga0307415_100019926 3300032126 Bacteria 4083
442 Ga0373929_0075821 3300035085 Bacteria 812
443 Ga0373940_0161811 3300035088 Bacteria 719
444 Ga0373944_0056096 3300035089 Bacteria 1253
445 Ga0373954_0014631 3300035118 Bacteria 3499
446 Ga0373956_0046497 3300035119 Bacteria 1939
447 Ga0373955_0004166 3300035172 Bacteria 6383
448 Ga0373937_0025909 3300036401 Bacteria 5296
449 Ga0373937_0446761 3300036401 Unclassified 1228
450 Ga0373925_0412284 3300037068 Bacteria 1103
451 Ga0395899_0000618 3300037312 Bacteria 37007
452 Ga0395899_0011688 3300037312 Bacteria 6719
453 Ga0395899_0094469 3300037312 Bacteria 2164
454 Ga0395899_0105835 3300037312 Bacteria 2026
455 Ga0395899_0139255 3300037312 Unclassified 1728
456 Ga0395899_0159913 3300037312 Bacteria 1592
457 Ga0395899_0210348 3300037312 Bacteria 1352
458 Ga0395899_0251191 3300037312 Unclassified 1213
459 Ga0395899_0670930 3300037312 Bacteria 653
460 Ga0395900_0000221 3300037418 Bacteria 89883
461 Ga0395900_0003502 3300037418 Bacteria 16945
462 Ga0395900_0013288 3300037418 Bacteria 8417
463 Ga0395900_0021283 3300037418 Bacteria 6630
464 Ga0395900_0026602 3300037418 Bacteria 5923
465 Ga0395900_0037550 3300037418 Bacteria 4993
466 Ga0395900_0041795 3300037418 Bacteria 4724
467 Ga0395900_0062195 3300037418 Bacteria 3837
468 Ga0395900_0144406 3300037418 Bacteria 2434
469 Ga0395900_0163173 3300037418 Bacteria 2272
470 Ga0395900_0215884 3300037418 Bacteria 1936
471 Ga0395900_0339757 3300037418 Bacteria 1477
472 Ga0395900_0428500 3300037418 Unclassified 1282
473 Ga0395900_0787275 3300037418 Bacteria 879
474 Ga0395898_0000053 3300037466 Bacteria 279600
475 Ga0395898_0016277 3300037466 Bacteria 7610
476 Ga0395898_0051296 3300037466 Bacteria 4035
477 Ga0395898_0051451 3300037466 Bacteria 4028
478 Ga0395898_0136482 3300037466 Bacteria 2349
479 Ga0395898_0177094 3300037466 Bacteria 2038
480 Ga0395898_0207604 3300037466 Bacteria 1869
481 Ga0395898_0732266 3300037466 Unclassified 930
482 Ga0395905_0000031 3300037471 Bacteria 286757
483 Ga0395905_0000964 3300037471 Bacteria 36944
484 Ga0395905_0010414 3300037471 Bacteria 9047
485 Ga0395905_0022078 3300037471 Bacteria 6020
486 Ga0395905_0026137 3300037471 Bacteria 5506
487 Ga0395905_0045009 3300037471 Bacteria 4140
488 Ga0395905_0083383 3300037471 Bacteria 2994
489 Ga0395905_0083490 3300037471 Bacteria 2992
490 Ga0395905_0159199 3300037471 Bacteria 2122
491 Ga0395905_0163857 3300037471 Bacteria 2089
492 Ga0395905_0168237 3300037471 Bacteria 2059
493 Ga0395905_0242183 3300037471 Bacteria 1685
494 Ga0395905_0374955 3300037471 Bacteria 1316
495 Ga0395905_0459677 3300037471 Bacteria 1171
496 Ga0395905_0479218 3300037471 Bacteria 1143
497 Ga0395905_0575815 3300037471 Unclassified 1027
498 Ga0395905_1057411 3300037471 Unclassified 715
499 Ga0395901_0010370 3300038443 Bacteria 9438
500 Ga0395901_0017656 3300038443 Bacteria 7284
501 Ga0395901_0031364 3300038443 Bacteria 5481
502 Ga0395901_0033659 3300038443 Bacteria 5291
503 Ga0395901_0117227 3300038443 Bacteria 2798
504 Ga0395901_0263576 3300038443 Bacteria 1793
505 Ga0395901_0283838 3300038443 Bacteria 1719
506 Ga0395901_0357677 3300038443 Bacteria 1506
507 Ga0395901_0394936 3300038443 Bacteria 1421
508 Ga0395901_0467669 3300038443 Unclassified 1287
509 Ga0395901_0746114 3300038443 Unclassified 972
510 Ga0439445_0064471 3300042004 Bacteria 1006
511 Ga0450898_056379 3300042134 Bacteria 767
512 Ga0439434_0020199 3300042435 Bacteria 1999
513 Ga0466969_0201857 3300044656 Bacteria 907
514 Ga0466972_0033768 3300044658 Bacteria 2509
515 Ga0466966_0022224 3300044684 Bacteria 4164
516 Ga0466966_0026687 3300044684 Bacteria 3770
517 Ga0466961_0066145 3300044693 Bacteria 2296
518 Ga0466963_0032462 3300044694 Bacteria 3381
519 Ga0466963_0042297 3300044694 Bacteria 2991
520 Ga0466963_0107623 3300044694 Unclassified 1912
521 Ga0466971_0009769 3300044719 Bacteria 4188
522 Ga0466971_0228415 3300044719 Bacteria 883
523 Ga0466968_0134082 3300044735 Bacteria 1129
524 Ga0466957_0006732 3300044842 Bacteria 6495
525 Ga0466957_0214466 3300044842 Bacteria 1269
526 Ga0466960_0091606 3300044901 Unclassified 1550
527 Ga0466959_0046928 3300045049 Bacteria 3178
528 Ga0466959_0085203 3300045049 Bacteria 2274
529 Ga0466967_0021295 3300045976 Bacteria 5261
530 Ga0466967_0051286 3300045976 Bacteria 3615
531 Ga0466967_0112648 3300045976 Bacteria 2501
532 Ga0466967_0252357 3300045976 Bacteria 1685
533 Ga0466967_0385196 3300045976 Bacteria 1362
534 Ga0466967_0654398 3300045976 Bacteria 1039
535 Ga0495598_0000101 3300046537 Bacteria 13820
536 Ga0495621_0000227 3300046539 Bacteria 13168
537 Ga0495669_0000229 3300046684 Bacteria 33149
538 Ga0495669_0040775 3300046684 Bacteria 2060
539 Ga0495669_0359054 3300046684 Unclassified 704
540 Ga0495670_0019136 3300046691 Bacteria 3374
541 Ga0495677_0078127 3300047445 Bacteria 1239
542 Ga0495602_0097189 3300048088 Bacteria 2427
543 Ga0496100_0053236 3300048903 Bacteria 2635
544 Ga0496101_0173525 3300048904 Bacteria 1657
545 Ga0496101_0333822 3300048904 Bacteria 1190
546 Ga0496102_0291974 3300048905 Bacteria 1537
547 Ga0496103_0086406 3300048906 Bacteria 1977
548 Ga0496103_0295723 3300048906 Bacteria 1042
549 Ga0496105_0028188 3300048908 Bacteria 4593
550 Ga0496106_0041060 3300048909 Bacteria 3466
551 Ga0496106_0170448 3300048909 Bacteria 1725
552 Ga0496107_0001280 3300048910 Bacteria 15389
553 Ga0496107_0057822 3300048910 Bacteria 2803
554 Ga0496107_0124752 3300048910 Bacteria 1898
555 Ga0496107_0395443 3300048910 Bacteria 1028
556 Ga0496108_0002083 3300048911 Bacteria 16006
557 Ga0496108_0068229 3300048911 Bacteria 3000
558 Ga0496108_0089464 3300048911 Bacteria 2616
559 Ga0496108_0100294 3300048911 Bacteria 2469
560 Ga0496109_0002471 3300048912 Bacteria 15498
561 Ga0496109_0034117 3300048912 Bacteria 4581
562 Ga0496109_0073512 3300048912 Bacteria 3141
563 Ga0496110_0004990 3300048913 Bacteria 10365
564 Ga0496110_0013047 3300048913 Bacteria 6854
565 Ga0496110_0016308 3300048913 Bacteria 6201
566 Ga0496110_0113594 3300048913 Bacteria 2436
567 Ga0496110_0143709 3300048913 Bacteria 2157
568 Ga0496111_0008936 3300048914 Bacteria 6663
569 Ga0496111_0135437 3300048914 Bacteria 1824
570 Ga0496111_0148155 3300048914 Bacteria 1740
571 Ga0496112_0017375 3300048915 Bacteria 6758
572 Ga0496112_0018787 3300048915 Bacteria 6514
573 Ga0496112_0029702 3300048915 Bacteria 5288
574 Ga0496112_0062861 3300048915 Bacteria 3663
575 Ga0496112_0088308 3300048915 Bacteria 3068
576 Ga0496112_0104115 3300048915 Unclassified 2808
577 Ga0496112_0121730 3300048915 Bacteria 2579
578 Ga0496112_0200763 3300048915 Bacteria 1953
579 Ga0496113_0002097 3300048916 Bacteria 11487
580 Ga0496113_0061162 3300048916 Unclassified 2841
581 Ga0496113_0133903 3300048916 Bacteria 1946
582 Ga0496113_0238175 3300048916 Bacteria 1452
583 Ga0496113_0550310 3300048916 Bacteria 925
584 Ga0496115_0001698 3300048918 Bacteria 15779
585 Ga0501069_0095476 3300049585 Bacteria 1684
586 Ga0501243_028131 3300049675 Bacteria 951
587 Ga0501080_0869732 3300049742 Bacteria 787
588 Ga0501044_0347348 3300049823 Bacteria 1404
589 Ga0466962_0136395 3300061719 Bacteria 1187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10163421 rootH2_101634212 187
2 3300048915 Ga0496112_0104115 Ga0496112_0104115_622_1308 187
3 3300048916 Ga0496113_0061162 Ga0496113_0061162_46_732 187
4 3300005355 Ga0070671_100020524 Ga0070671_1000205243 192
5 3300005834 Ga0068851_10108445 Ga0068851_101084452 192
6 3300025931 Ga0207644_10026785 Ga0207644_100267852 192
7 3300037312 Ga0395899_0000618 Ga0395899_0000618_30851_31525 192
8 3300037418 Ga0395900_0000221 Ga0395900_0000221_31852_32526 192
9 3300037418 Ga0395900_0163173 Ga0395900_0163173_1569_2258 192
10 3300037466 Ga0395898_0000053 Ga0395898_0000053_247075_247749 192
11 3300037471 Ga0395905_0000031 Ga0395905_0000031_39009_39683 192
12 3300038443 Ga0395901_0357677 Ga0395901_0357677_302_991 192
13 3300048908 Ga0496105_0028188 Ga0496105_0028188_2657_3316 192
14 3300048911 Ga0496108_0100294 Ga0496108_0100294_1087_1746 192
15 3300048912 Ga0496109_0073512 Ga0496109_0073512_76_735 192
16 3300048913 Ga0496110_0143709 Ga0496110_0143709_1168_1827 192
17 3300048915 Ga0496112_0018787 Ga0496112_0018787_2108_2767 192
18 3300005327 Ga0070658_10051515 Ga0070658_100515153 193
19 3300025909 Ga0207705_10007795 Ga0207705_100077953 193
20 3300025960 Ga0207651_10023427 Ga0207651_100234272 193
21 3300048914 Ga0496111_0135437 Ga0496111_0135437_952_1611 193
22 3300048916 Ga0496113_0133903 Ga0496113_0133903_596_1255 193
23 3300037418 Ga0395900_0428500 Ga0395900_0428500_238_960 197
24 3300037466 Ga0395898_0051296 Ga0395898_0051296_1415_2137 197
25 3300037471 Ga0395905_0575815 Ga0395905_0575815_74_796 199
26 3300044694 Ga0466963_0042297 Ga0466963_0042297_436_1161 199
27 3300044719 Ga0466971_0009769 Ga0466971_0009769_336_1061 199
28 3300044842 Ga0466957_0006732 Ga0466957_0006732_2707_3432 199
29 3300045049 Ga0466959_0046928 Ga0466959_0046928_1918_2643 199
30 3300061719 Ga0466962_0136395 Ga0466962_0136395_430_1155 199
31 3300005366 Ga0070659_100263439 Ga0070659_1002634391 200
32 3300005547 Ga0070693_100021123 Ga0070693_1000211233 200
33 3300005563 Ga0068855_100210389 Ga0068855_1002103892 200
34 3300005564 Ga0070664_100531942 Ga0070664_1005319422 200
35 3300005614 Ga0068856_100079750 Ga0068856_1000797503 200
36 3300013100 Ga0157373_10036671 Ga0157373_100366713 200
37 3300013105 Ga0157369_10097281 Ga0157369_100972812 200
38 3300013307 Ga0157372_10280064 Ga0157372_102800642 200
39 3300020082 Ga0206353_10112932 Ga0206353_101129322 200
40 3300025912 Ga0207707_10321727 Ga0207707_103217272 200
41 3300025920 Ga0207649_10268181 Ga0207649_102681812 200
42 3300025932 Ga0207690_10017751 Ga0207690_100177512 200
43 3300025940 Ga0207691_10221120 Ga0207691_102211202 200
44 3300025949 Ga0207667_10459588 Ga0207667_104595882 200
45 3300026078 Ga0207702_10015179 Ga0207702_100151794 200
46 3300048905 Ga0496102_0291974 Ga0496102_0291974_571_1299 200
47 3300048915 Ga0496112_0088308 Ga0496112_0088308_1802_2530 200
48 3300005614 Ga0068856_100064475 Ga0068856_1000644752 202
49 3300026078 Ga0207702_10070974 Ga0207702_100709741 202
50 3300048906 Ga0496103_0295723 Ga0496103_0295723_17_625 202
51 3300037312 Ga0395899_0251191 Ga0395899_0251191_23_634 203
52 3300037312 Ga0395899_0670930 Ga0395899_0670930_21_632 203
53 3300031824 Ga0307413_10085150 Ga0307413_100851502 206
54 3300031903 Ga0307407_10037676 Ga0307407_100376762 206
55 3300032004 Ga0307414_10725235 Ga0307414_107252351 206
56 3300032126 Ga0307415_100019926 Ga0307415_1000199263 206
57 3300049675 Ga0501243_028131 Ga0501243_028131_17_706 206
58 3300044694 Ga0466963_0032462 Ga0466963_0032462_1275_2000 208
59 3300045976 Ga0466967_0385196 Ga0466967_0385196_310_1035 208
60 3300036401 Ga0373937_0446761 Ga0373937_0446761_501_1184 209
61 3300003320 rootH2_10189223 rootH2_101892232 210
62 3300003323 rootH1_10214375 rootH1_102143752 210
63 3300005457 Ga0070662_100001429 Ga0070662_1000014293 210
64 3300009177 Ga0105248_10003112 Ga0105248_100031128 210
65 3300009177 Ga0105248_10007395 Ga0105248_100073955 210
66 3300009177 Ga0105248_10011440 Ga0105248_100114403 210
67 3300009177 Ga0105248_10054636 Ga0105248_100546365 210
68 3300009553 Ga0105249_10054905 Ga0105249_100549055 210
69 3300013100 Ga0157373_10002786 Ga0157373_1000278611 210
70 3300013100 Ga0157373_10011456 Ga0157373_100114565 210
71 3300013306 Ga0163162_10040852 Ga0163162_100408525 210
72 3300013308 Ga0157375_10957718 Ga0157375_109577182 210
73 3300014325 Ga0163163_10006833 Ga0163163_1000683310 210
74 3300014497 Ga0182008_10324195 Ga0182008_103241952 210
75 3300014968 Ga0157379_10007107 Ga0157379_1000710710 210
76 3300035085 Ga0373929_0075821 Ga0373929_0075821_45_707 210
77 3300035088 Ga0373940_0161811 Ga0373940_0161811_45_707 210
78 3300037312 Ga0395899_0011688 Ga0395899_0011688_2270_2914 210
79 3300037312 Ga0395899_0139255 Ga0395899_0139255_886_1548 210
80 3300037418 Ga0395900_0013288 Ga0395900_0013288_860_1522 210
81 3300037418 Ga0395900_0041795 Ga0395900_0041795_2596_3240 210
82 3300037418 Ga0395900_0144406 Ga0395900_0144406_1772_2416 210
83 3300037418 Ga0395900_0215884 Ga0395900_0215884_682_1326 210
84 3300037418 Ga0395900_0787275 Ga0395900_0787275_132_776 210
85 3300037466 Ga0395898_0016277 Ga0395898_0016277_4879_5523 210
86 3300037466 Ga0395898_0136482 Ga0395898_0136482_1583_2230 210
87 3300037466 Ga0395898_0732266 Ga0395898_0732266_263_907 210
88 3300037471 Ga0395905_0083383 Ga0395905_0083383_579_1223 210
89 3300037471 Ga0395905_0083490 Ga0395905_0083490_213_857 210
90 3300037471 Ga0395905_0159199 Ga0395905_0159199_1400_2056 210
91 3300037471 Ga0395905_0163857 Ga0395905_0163857_532_1170 210
92 3300037471 Ga0395905_0168237 Ga0395905_0168237_734_1378 210
93 3300037471 Ga0395905_0242183 Ga0395905_0242183_538_1185 210
94 3300037471 Ga0395905_0374955 Ga0395905_0374955_422_1084 210
95 3300037471 Ga0395905_0459677 Ga0395905_0459677_451_1113 210
96 3300037471 Ga0395905_1057411 Ga0395905_1057411_15_677 210
97 3300038443 Ga0395901_0033659 Ga0395901_0033659_2703_3347 210
98 3300038443 Ga0395901_0283838 Ga0395901_0283838_1060_1704 210
99 3300038443 Ga0395901_0394936 Ga0395901_0394936_96_740 210
100 3300038443 Ga0395901_0467669 Ga0395901_0467669_500_1144 210
101 3300038443 Ga0395901_0746114 Ga0395901_0746114_96_740 210
102 3300042004 Ga0439445_0064471 Ga0439445_0064471_33_677 210
103 3300042134 Ga0450898_056379 Ga0450898_056379_21_683 210
104 3300044658 Ga0466972_0033768 Ga0466972_0033768_1776_2420 210
105 3300045976 Ga0466967_0252357 Ga0466967_0252357_173_826 210
106 3300045976 Ga0466967_0654398 Ga0466967_0654398_24_680 210
107 3300046684 Ga0495669_0040775 Ga0495669_0040775_233_883 210
108 3300046684 Ga0495669_0359054 Ga0495669_0359054_17_679 210
109 3300048913 Ga0496110_0113594 Ga0496110_0113594_760_1407 210
110 3300048915 Ga0496112_0029702 Ga0496112_0029702_2435_3079 210
111 3300048915 Ga0496112_0062861 Ga0496112_0062861_1390_2052 210
112 3300048916 Ga0496113_0238175 Ga0496113_0238175_541_1185 210
113 3300048918 Ga0496115_0001698 Ga0496115_0001698_5928_6590 210
114 3300005331 Ga0070670_100108266 Ga0070670_1001082663 211
115 3300005564 Ga0070664_100002458 Ga0070664_10000245814 211
116 3300025925 Ga0207650_10223620 Ga0207650_102236202 211
117 3300025945 Ga0207679_10005792 Ga0207679_100057925 211
118 3300044735 Ga0466968_0134082 Ga0466968_0134082_117_788 211
119 3300044901 Ga0466960_0091606 Ga0466960_0091606_851_1522 211
120 3300013306 Ga0163162_10005625 Ga0163162_100056258 212
121 3300013308 Ga0157375_10008995 Ga0157375_100089953 212
122 3300025920 Ga0207649_10088205 Ga0207649_100882051 213
123 3300009098 Ga0105245_10023574 Ga0105245_100235745 214
124 3300013296 Ga0157374_10128993 Ga0157374_101289932 214
125 3300026118 Ga0207675_100634212 Ga0207675_1006342122 214
126 3300035118 Ga0373954_0014631 Ga0373954_0014631_1908_2597 216
127 3300035119 Ga0373956_0046497 Ga0373956_0046497_575_1264 216
128 3300035172 Ga0373955_0004166 Ga0373955_0004166_4053_4742 216
129 3300036401 Ga0373937_0025909 Ga0373937_0025909_2935_3624 216
130 3300037418 Ga0395900_0026602 Ga0395900_0026602_3338_4024 216
131 3300037466 Ga0395898_0177094 Ga0395898_0177094_1051_1737 216
132 3300037471 Ga0395905_0000964 Ga0395905_0000964_4784_5470 216
133 3300038443 Ga0395901_0117227 Ga0395901_0117227_839_1525 216
134 3300044694 Ga0466963_0107623 Ga0466963_0107623_214_900 216
135 3300046537 Ga0495598_0000101 Ga0495598_0000101_10477_11211 216
136 3300048088 Ga0495602_0097189 Ga0495602_0097189_727_1416 216
137 3300005344 Ga0070661_100108525 Ga0070661_1001085252 217
138 3300005546 Ga0070696_100108966 Ga0070696_1001089662 217
139 3300005549 Ga0070704_100242718 Ga0070704_1002427182 217
140 3300025920 Ga0207649_10173931 Ga0207649_101739312 217
141 3300045976 Ga0466967_0051286 Ga0466967_0051286_1691_2383 217
142 3300046539 Ga0495621_0000227 Ga0495621_0000227_1768_2460 217
143 3300046691 Ga0495670_0019136 Ga0495670_0019136_208_900 217
144 3300048904 Ga0496101_0173525 Ga0496101_0173525_169_861 217
145 3300005331 Ga0070670_100087427 Ga0070670_1000874272 218
146 3300005364 Ga0070673_100126762 Ga0070673_1001267622 218
147 3300005366 Ga0070659_100082527 Ga0070659_1000825272 218
148 3300005564 Ga0070664_100041951 Ga0070664_1000419513 218
149 3300025925 Ga0207650_10161378 Ga0207650_101613781 218
150 3300025933 Ga0207706_10320018 Ga0207706_103200181 218
151 3300025945 Ga0207679_10024937 Ga0207679_100249373 218
152 3300031901 Ga0307406_10652864 Ga0307406_106528642 218
153 3300032002 Ga0307416_100004705 Ga0307416_1000047056 218
154 3300005548 Ga0070665_100002211 Ga0070665_1000022113 220
155 3300028379 Ga0268266_10000733 Ga0268266_100007334 220
156 3300032002 Ga0307416_100425627 Ga0307416_1004256272 220
157 3300031548 Ga0307408_100155922 Ga0307408_1001559221 221
158 3300031995 Ga0307409_100039816 Ga0307409_1000398161 221
159 3300049742 Ga0501080_0869732 Ga0501080_0869732_62_772 222
160 3300005548 Ga0070665_100033101 Ga0070665_1000331013 223
161 3300026067 Ga0207678_10190794 Ga0207678_101907943 223
162 3300026067 Ga0207678_10436791 Ga0207678_104367912 223
163 3300028379 Ga0268266_10004937 Ga0268266_100049376 223
164 3300032004 Ga0307414_10184220 Ga0307414_101842202 223
165 3300042435 Ga0439434_0020199 Ga0439434_0020199_21_734 223
166 3300005337 Ga0070682_100136797 Ga0070682_1001367972 224
167 3300005338 Ga0068868_100058476 Ga0068868_1000584763 224
168 3300005339 Ga0070660_100097355 Ga0070660_1000973552 224
169 3300005340 Ga0070689_100444441 Ga0070689_1004444412 224
170 3300005345 Ga0070692_10043414 Ga0070692_100434142 224
171 3300005353 Ga0070669_100104526 Ga0070669_1001045262 224
172 3300005355 Ga0070671_100072839 Ga0070671_1000728392 224
173 3300005367 Ga0070667_100017502 Ga0070667_1000175022 224
174 3300005367 Ga0070667_100150230 Ga0070667_1001502301 224
175 3300005530 Ga0070679_100186510 Ga0070679_1001865102 224
176 3300005578 Ga0068854_100117701 Ga0068854_1001177012 224
177 3300005578 Ga0068854_100192964 Ga0068854_1001929642 224
178 3300005616 Ga0068852_100058743 Ga0068852_1000587432 224
179 3300005617 Ga0068859_100002640 Ga0068859_1000026403 224
180 3300005618 Ga0068864_100121793 Ga0068864_1001217932 224
181 3300005834 Ga0068851_10009070 Ga0068851_100090703 224
182 3300005841 Ga0068863_100007928 Ga0068863_10000792810 224
183 3300005842 Ga0068858_100001273 Ga0068858_10000127312 224
184 3300005842 Ga0068858_100213544 Ga0068858_1002135442 224
185 3300005843 Ga0068860_100032848 Ga0068860_1000328483 224
186 3300005843 Ga0068860_100048108 Ga0068860_1000481082 224
187 3300005844 Ga0068862_100004596 Ga0068862_10000459611 224
188 3300006931 Ga0097620_100002640 Ga0097620_1000026403 224
189 3300009174 Ga0105241_10287198 Ga0105241_102871982 224
190 3300013296 Ga0157374_10123137 Ga0157374_101231372 224
191 3300025909 Ga0207705_10004511 Ga0207705_100045112 224
192 3300025919 Ga0207657_10134115 Ga0207657_101341152 224
193 3300025920 Ga0207649_10016046 Ga0207649_100160464 224
194 3300025921 Ga0207652_10040839 Ga0207652_100408395 224
195 3300025921 Ga0207652_10226123 Ga0207652_102261232 224
196 3300025931 Ga0207644_10015843 Ga0207644_100158436 224
197 3300025933 Ga0207706_10000906 Ga0207706_1000090611 224
198 3300025940 Ga0207691_10106213 Ga0207691_101062132 224
199 3300025941 Ga0207711_10000305 Ga0207711_1000030519 224
200 3300025941 Ga0207711_10028810 Ga0207711_100288102 224
201 3300025960 Ga0207651_10028555 Ga0207651_100285552 224
202 3300025961 Ga0207712_10011364 Ga0207712_100113642 224
203 3300025981 Ga0207640_10060298 Ga0207640_100602982 224
204 3300025986 Ga0207658_10001198 Ga0207658_100011984 224
205 3300026023 Ga0207677_10044940 Ga0207677_100449401 224
206 3300026035 Ga0207703_10001860 Ga0207703_1000186021 224
207 3300026067 Ga0207678_10003630 Ga0207678_100036302 224
208 3300026067 Ga0207678_10506528 Ga0207678_105065281 224
209 3300026088 Ga0207641_10000401 Ga0207641_1000040136 224
210 3300026095 Ga0207676_10024892 Ga0207676_100248922 224
211 3300028380 Ga0268265_10002118 Ga0268265_1000211811 224
212 3300028381 Ga0268264_10028070 Ga0268264_100280702 224
213 3300028381 Ga0268264_10049604 Ga0268264_100496041 224
214 3300046684 Ga0495669_0000229 Ga0495669_0000229_20053_20769 224
215 3300005347 Ga0070668_100188767 Ga0070668_1001887671 225
216 3300005355 Ga0070671_100033451 Ga0070671_1000334513 225
217 3300005366 Ga0070659_100015877 Ga0070659_1000158772 225
218 3300005367 Ga0070667_100034479 Ga0070667_1000344793 225
219 3300005547 Ga0070693_100069574 Ga0070693_1000695742 225
220 3300005563 Ga0068855_100119267 Ga0068855_1001192673 225
221 3300005564 Ga0070664_100492248 Ga0070664_1004922482 225
222 3300005577 Ga0068857_100019023 Ga0068857_1000190233 225
223 3300005618 Ga0068864_100088204 Ga0068864_1000882042 225
224 3300005834 Ga0068851_10035637 Ga0068851_100356372 225
225 3300005841 Ga0068863_100009535 Ga0068863_1000095357 225
226 3300005841 Ga0068863_100019832 Ga0068863_1000198322 225
227 3300005842 Ga0068858_100069650 Ga0068858_1000696503 225
228 3300006237 Ga0097621_100128674 Ga0097621_1001286742 225
229 3300006358 Ga0068871_100024070 Ga0068871_1000240703 225
230 3300009177 Ga0105248_10118730 Ga0105248_101187304 225
231 3300009545 Ga0105237_10256259 Ga0105237_102562591 225
232 3300011119 Ga0105246_10099522 Ga0105246_100995222 225
233 3300013100 Ga0157373_10069397 Ga0157373_100693972 225
234 3300013296 Ga0157374_10055589 Ga0157374_100555892 225
235 3300014968 Ga0157379_10015552 Ga0157379_100155523 225
236 3300025933 Ga0207706_10339935 Ga0207706_103399352 225
237 3300025945 Ga0207679_10147100 Ga0207679_101471002 225
238 3300025986 Ga0207658_10024944 Ga0207658_100249443 225
239 3300025986 Ga0207658_10037474 Ga0207658_100374742 225
240 3300026078 Ga0207702_10070392 Ga0207702_100703923 225
241 3300026088 Ga0207641_10020327 Ga0207641_100203273 225
242 3300026095 Ga0207676_10017923 Ga0207676_100179235 225
243 3300026116 Ga0207674_10000151 Ga0207674_1000015138 225
244 3300032126 Ga0307415_100014195 Ga0307415_1000141953 225
245 3300037471 Ga0395905_0045009 Ga0395905_0045009_3373_4086 225
246 3300048903 Ga0496100_0053236 Ga0496100_0053236_1346_2059 225
247 3300048904 Ga0496101_0333822 Ga0496101_0333822_334_1047 225
248 3300048910 Ga0496107_0124752 Ga0496107_0124752_433_1146 225
249 3300048911 Ga0496108_0002083 Ga0496108_0002083_13180_13893 225
250 3300048912 Ga0496109_0002471 Ga0496109_0002471_13917_14630 225
251 3300048913 Ga0496110_0013047 Ga0496110_0013047_1378_2091 225
252 3300048914 Ga0496111_0008936 Ga0496111_0008936_1777_2490 225
253 3300048915 Ga0496112_0017375 Ga0496112_0017375_3953_4666 225
254 3300048916 Ga0496113_0002097 Ga0496113_0002097_1718_2431 225
255 3300044656 Ga0466969_0201857 Ga0466969_0201857_20_736 226
256 3300044684 Ga0466966_0022224 Ga0466966_0022224_1395_2111 226
257 3300044693 Ga0466961_0066145 Ga0466961_0066145_880_1596 226
258 3300045049 Ga0466959_0085203 Ga0466959_0085203_107_823 226
259 3300005327 Ga0070658_10024696 Ga0070658_100246962 227
260 3300005339 Ga0070660_100020834 Ga0070660_1000208344 227
261 3300005339 Ga0070660_100031682 Ga0070660_1000316824 227
262 3300005344 Ga0070661_100009242 Ga0070661_1000092424 227
263 3300005366 Ga0070659_100567516 Ga0070659_1005675162 227
264 3300005455 Ga0070663_100014704 Ga0070663_1000147043 227
265 3300005455 Ga0070663_100024350 Ga0070663_1000243502 227
266 3300005457 Ga0070662_100075071 Ga0070662_1000750712 227
267 3300005578 Ga0068854_100118648 Ga0068854_1001186482 227
268 3300005616 Ga0068852_100037196 Ga0068852_1000371963 227
269 3300009551 Ga0105238_10036279 Ga0105238_100362793 227
270 3300013102 Ga0157371_10005567 Ga0157371_1000556710 227
271 3300013104 Ga0157370_10086197 Ga0157370_100861971 227
272 3300025909 Ga0207705_10017158 Ga0207705_100171587 227
273 3300025909 Ga0207705_10204153 Ga0207705_102041532 227
274 3300025919 Ga0207657_10006637 Ga0207657_100066373 227
275 3300025919 Ga0207657_10021894 Ga0207657_100218943 227
276 3300025920 Ga0207649_10018797 Ga0207649_100187972 227
277 3300025932 Ga0207690_10010441 Ga0207690_100104415 227
278 3300025932 Ga0207690_10019076 Ga0207690_100190762 227
279 3300025932 Ga0207690_10187805 Ga0207690_101878052 227
280 3300025933 Ga0207706_10098712 Ga0207706_100987122 227
281 3300025935 Ga0207709_10083802 Ga0207709_100838022 227
282 3300025944 Ga0207661_10159493 Ga0207661_101594932 227
283 3300025945 Ga0207679_10027631 Ga0207679_100276312 227
284 3300025981 Ga0207640_10085284 Ga0207640_100852842 227
285 3300026067 Ga0207678_10023043 Ga0207678_100230435 227
286 3300026067 Ga0207678_10028632 Ga0207678_100286323 227
287 3300026142 Ga0207698_10021033 Ga0207698_100210334 227
288 3300026142 Ga0207698_10072365 Ga0207698_100723652 227
289 3300037312 Ga0395899_0094469 Ga0395899_0094469_1009_1734 227
290 3300037418 Ga0395900_0037550 Ga0395900_0037550_2896_3621 227
291 3300037466 Ga0395898_0207604 Ga0395898_0207604_674_1399 227
292 3300037471 Ga0395905_0026137 Ga0395905_0026137_998_1723 227
293 3300038443 Ga0395901_0263576 Ga0395901_0263576_509_1234 227
294 3300044684 Ga0466966_0026687 Ga0466966_0026687_493_1215 227
295 3300045976 Ga0466967_0021295 Ga0466967_0021295_1864_2592 227
296 3300045976 Ga0466967_0112648 Ga0466967_0112648_1002_1730 227
297 3300005327 Ga0070658_10006416 Ga0070658_1000641610 228
298 3300005327 Ga0070658_10630332 Ga0070658_106303321 228
299 3300005355 Ga0070671_100000212 Ga0070671_10000021220 228
300 3300005355 Ga0070671_100001537 Ga0070671_10000153712 228
301 3300005366 Ga0070659_100067445 Ga0070659_1000674452 228
302 3300005435 Ga0070714_100019783 Ga0070714_1000197832 228
303 3300005436 Ga0070713_100065720 Ga0070713_1000657202 228
304 3300005547 Ga0070693_100153318 Ga0070693_1001533182 228
305 3300009177 Ga0105248_10001053 Ga0105248_1000105314 228
306 3300025909 Ga0207705_10026652 Ga0207705_100266523 228
307 3300025909 Ga0207705_10033299 Ga0207705_100332995 228
308 3300025928 Ga0207700_10099585 Ga0207700_100995852 228
309 3300025929 Ga0207664_10034652 Ga0207664_100346522 228
310 3300025931 Ga0207644_10003407 Ga0207644_100034072 228
311 3300025931 Ga0207644_10020625 Ga0207644_100206253 228
312 3300025931 Ga0207644_10061925 Ga0207644_100619252 228
313 3300025932 Ga0207690_10348530 Ga0207690_103485302 228
314 3300025941 Ga0207711_10000896 Ga0207711_100008964 228
315 3300025945 Ga0207679_10379453 Ga0207679_103794532 228
316 3300037312 Ga0395899_0105835 Ga0395899_0105835_248_976 228
317 3300037312 Ga0395899_0159913 Ga0395899_0159913_339_1064 228
318 3300037312 Ga0395899_0210348 Ga0395899_0210348_118_843 228
319 3300037418 Ga0395900_0003502 Ga0395900_0003502_12829_13554 228
320 3300037418 Ga0395900_0021283 Ga0395900_0021283_3556_4284 228
321 3300037418 Ga0395900_0062195 Ga0395900_0062195_821_1546 228
322 3300037466 Ga0395898_0051451 Ga0395898_0051451_579_1304 228
323 3300037471 Ga0395905_0010414 Ga0395905_0010414_1333_2058 228
324 3300037471 Ga0395905_0022078 Ga0395905_0022078_4649_5374 228
325 3300038443 Ga0395901_0010370 Ga0395901_0010370_3829_4554 228
326 3300038443 Ga0395901_0017656 Ga0395901_0017656_3524_4252 228
327 3300038443 Ga0395901_0031364 Ga0395901_0031364_2057_2782 228
328 3300044719 Ga0466971_0228415 Ga0466971_0228415_83_817 228
329 3300044842 Ga0466957_0214466 Ga0466957_0214466_444_1178 228
330 3300047445 Ga0495677_0078127 Ga0495677_0078127_152_883 228
331 3300048909 Ga0496106_0041060 Ga0496106_0041060_515_1246 228
332 3300048910 Ga0496107_0001280 Ga0496107_0001280_10960_11691 228
333 3300048911 Ga0496108_0068229 Ga0496108_0068229_467_1198 228
334 3300048912 Ga0496109_0034117 Ga0496109_0034117_408_1139 228
335 3300048913 Ga0496110_0016308 Ga0496110_0016308_32_763 228
336 3300048914 Ga0496111_0148155 Ga0496111_0148155_884_1615 228
337 3300048915 Ga0496112_0200763 Ga0496112_0200763_408_1139 228
338 3300048916 Ga0496113_0550310 Ga0496113_0550310_27_758 228
339 3300049823 Ga0501044_0347348 Ga0501044_0347348_230_958 228
340 3300001915 JGI24741J21665_1019284 JGI24741J21665_10192842 229
341 3300001979 JGI24740J21852_10003330 JGI24740J21852_100033309 229
342 3300001989 JGI24739J22299_10004158 JGI24739J22299_100041583 229
343 3300001989 JGI24739J22299_10029885 JGI24739J22299_100298852 229
344 3300001990 JGI24737J22298_10000217 JGI24737J22298_1000021712 229
345 3300001990 JGI24737J22298_10003877 JGI24737J22298_100038773 229
346 3300001990 JGI24737J22298_10007003 JGI24737J22298_100070032 229
347 3300001991 JGI24743J22301_10000819 JGI24743J22301_100008193 229
348 3300002075 JGI24738J21930_10000735 JGI24738J21930_100007353 229
349 3300002077 JGI24744J21845_10004598 JGI24744J21845_100045982 229
350 3300005293 Ga0065715_10045623 Ga0065715_100456232 229
351 3300005327 Ga0070658_10011760 Ga0070658_100117604 229
352 3300005327 Ga0070658_10102018 Ga0070658_101020181 229
353 3300005328 Ga0070676_10011606 Ga0070676_100116065 229
354 3300005328 Ga0070676_10029067 Ga0070676_100290673 229
355 3300005330 Ga0070690_100018793 Ga0070690_1000187935 229
356 3300005330 Ga0070690_100036611 Ga0070690_1000366113 229
357 3300005330 Ga0070690_100231715 Ga0070690_1002317151 229
358 3300005331 Ga0070670_100022879 Ga0070670_1000228792 229
359 3300005331 Ga0070670_100095695 Ga0070670_1000956952 229
360 3300005333 Ga0070677_10005849 Ga0070677_100058492 229
361 3300005334 Ga0068869_100000206 Ga0068869_10000020619 229
362 3300005335 Ga0070666_10010222 Ga0070666_100102224 229
363 3300005335 Ga0070666_10013410 Ga0070666_100134103 229
364 3300005335 Ga0070666_10024519 Ga0070666_100245193 229
365 3300005335 Ga0070666_10031387 Ga0070666_100313872 229
366 3300005338 Ga0068868_100000357 Ga0068868_10000035713 229
367 3300005338 Ga0068868_100001171 Ga0068868_10000117117 229
368 3300005338 Ga0068868_100010802 Ga0068868_1000108025 229
369 3300005338 Ga0068868_100073595 Ga0068868_1000735952 229
370 3300005339 Ga0070660_100001572 Ga0070660_1000015729 229
371 3300005339 Ga0070660_100027728 Ga0070660_1000277283 229
372 3300005339 Ga0070660_100053207 Ga0070660_1000532072 229
373 3300005343 Ga0070687_100029399 Ga0070687_1000293992 229
374 3300005344 Ga0070661_100078786 Ga0070661_1000787862 229
375 3300005344 Ga0070661_100153316 Ga0070661_1001533162 229
376 3300005345 Ga0070692_10013468 Ga0070692_100134683 229
377 3300005347 Ga0070668_100703929 Ga0070668_1007039292 229
378 3300005353 Ga0070669_100000665 Ga0070669_10000066522 229
379 3300005355 Ga0070671_100017864 Ga0070671_1000178642 229
380 3300005355 Ga0070671_100049688 Ga0070671_1000496882 229
381 3300005356 Ga0070674_100021398 Ga0070674_1000213982 229
382 3300005356 Ga0070674_100071510 Ga0070674_1000715102 229
383 3300005356 Ga0070674_100104375 Ga0070674_1001043752 229
384 3300005364 Ga0070673_100001506 Ga0070673_1000015063 229
385 3300005364 Ga0070673_100103882 Ga0070673_1001038822 229
386 3300005364 Ga0070673_100163550 Ga0070673_1001635502 229
387 3300005366 Ga0070659_100001452 Ga0070659_1000014529 229
388 3300005366 Ga0070659_100008972 Ga0070659_1000089725 229
389 3300005366 Ga0070659_100056896 Ga0070659_1000568962 229
390 3300005367 Ga0070667_100001664 Ga0070667_10000166418 229
391 3300005367 Ga0070667_100004890 Ga0070667_10000489013 229
392 3300005367 Ga0070667_100043599 Ga0070667_1000435992 229
393 3300005367 Ga0070667_100242253 Ga0070667_1002422532 229
394 3300005435 Ga0070714_100015473 Ga0070714_1000154736 229
395 3300005436 Ga0070713_100035736 Ga0070713_1000357365 229
396 3300005444 Ga0070694_100005801 Ga0070694_1000058013 229
397 3300005455 Ga0070663_100074796 Ga0070663_1000747962 229
398 3300005455 Ga0070663_100258104 Ga0070663_1002581042 229
399 3300005457 Ga0070662_100000799 Ga0070662_1000007993 229
400 3300005457 Ga0070662_100005565 Ga0070662_1000055653 229
401 3300005457 Ga0070662_100028212 Ga0070662_1000282122 229
402 3300005457 Ga0070662_100032776 Ga0070662_1000327762 229
403 3300005457 Ga0070662_100072438 Ga0070662_1000724382 229
404 3300005459 Ga0068867_100000728 Ga0068867_10000072813 229
405 3300005459 Ga0068867_100008740 Ga0068867_1000087406 229
406 3300005466 Ga0070685_10201810 Ga0070685_102018102 229
407 3300005539 Ga0068853_100001135 Ga0068853_1000011355 229
408 3300005539 Ga0068853_100117122 Ga0068853_1001171222 229
409 3300005539 Ga0068853_100498276 Ga0068853_1004982761 229
410 3300005543 Ga0070672_100000252 Ga0070672_10000025220 229
411 3300005543 Ga0070672_100086371 Ga0070672_1000863712 229
412 3300005543 Ga0070672_100301986 Ga0070672_1003019862 229
413 3300005547 Ga0070693_100101843 Ga0070693_1001018432 229
414 3300005548 Ga0070665_100004862 Ga0070665_1000048628 229
415 3300005548 Ga0070665_100004918 Ga0070665_1000049184 229
416 3300005548 Ga0070665_100010166 Ga0070665_1000101668 229
417 3300005548 Ga0070665_100013436 Ga0070665_1000134363 229
418 3300005563 Ga0068855_100148685 Ga0068855_1001486852 229
419 3300005564 Ga0070664_100005426 Ga0070664_10000542610 229
420 3300005564 Ga0070664_100090241 Ga0070664_1000902411 229
421 3300005564 Ga0070664_100119669 Ga0070664_1001196692 229
422 3300005577 Ga0068857_100000311 Ga0068857_10000031122 229
423 3300005577 Ga0068857_100008184 Ga0068857_1000081848 229
424 3300005578 Ga0068854_100000744 Ga0068854_10000074410 229
425 3300005578 Ga0068854_100001807 Ga0068854_1000018074 229
426 3300005578 Ga0068854_100166437 Ga0068854_1001664372 229
427 3300005578 Ga0068854_100198269 Ga0068854_1001982692 229
428 3300005616 Ga0068852_100000917 Ga0068852_1000009179 229
429 3300005616 Ga0068852_100208505 Ga0068852_1002085052 229
430 3300005616 Ga0068852_100220528 Ga0068852_1002205282 229
431 3300005617 Ga0068859_100015919 Ga0068859_1000159193 229
432 3300005618 Ga0068864_100000539 Ga0068864_10000053924 229
433 3300005618 Ga0068864_100086558 Ga0068864_1000865583 229
434 3300005618 Ga0068864_100153118 Ga0068864_1001531182 229
435 3300005618 Ga0068864_100467308 Ga0068864_1004673082 229
436 3300005718 Ga0068866_10006380 Ga0068866_100063804 229
437 3300005834 Ga0068851_10026757 Ga0068851_100267573 229
438 3300005834 Ga0068851_10087769 Ga0068851_100877692 229
439 3300005841 Ga0068863_100024847 Ga0068863_1000248474 229
440 3300005842 Ga0068858_100000698 Ga0068858_10000069814 229
441 3300005842 Ga0068858_100002196 Ga0068858_1000021965 229
442 3300005842 Ga0068858_100059517 Ga0068858_1000595173 229
443 3300005843 Ga0068860_100030209 Ga0068860_1000302093 229
444 3300005843 Ga0068860_100313682 Ga0068860_1003136822 229
445 3300005843 Ga0068860_100322167 Ga0068860_1003221672 229
446 3300006028 Ga0070717_10243545 Ga0070717_102435452 229
447 3300006163 Ga0070715_10100727 Ga0070715_101007272 229
448 3300006173 Ga0070716_100006823 Ga0070716_1000068233 229
449 3300006175 Ga0070712_100164654 Ga0070712_1001646542 229
450 3300006237 Ga0097621_100036321 Ga0097621_1000363211 229
451 3300006358 Ga0068871_100435361 Ga0068871_1004353612 229
452 3300006881 Ga0068865_100003600 Ga0068865_1000036005 229
453 3300006881 Ga0068865_100009553 Ga0068865_1000095533 229
454 3300006881 Ga0068865_100042510 Ga0068865_1000425102 229
455 3300006931 Ga0097620_100015919 Ga0097620_1000159193 229
456 3300009098 Ga0105245_10000345 Ga0105245_1000034535 229
457 3300009098 Ga0105245_10027511 Ga0105245_100275114 229
458 3300009148 Ga0105243_10062763 Ga0105243_100627633 229
459 3300009176 Ga0105242_10109459 Ga0105242_101094592 229
460 3300009177 Ga0105248_10009395 Ga0105248_100093958 229
461 3300009177 Ga0105248_10010225 Ga0105248_100102259 229
462 3300009177 Ga0105248_10500350 Ga0105248_105003502 229
463 3300009553 Ga0105249_10008193 Ga0105249_100081937 229
464 3300013100 Ga0157373_10016875 Ga0157373_100168754 229
465 3300013102 Ga0157371_10265504 Ga0157371_102655042 229
466 3300013296 Ga0157374_10463709 Ga0157374_104637092 229
467 3300013296 Ga0157374_10652556 Ga0157374_106525562 229
468 3300013297 Ga0157378_10008802 Ga0157378_100088025 229
469 3300013297 Ga0157378_10111926 Ga0157378_101119261 229
470 3300013306 Ga0163162_10216253 Ga0163162_102162532 229
471 3300013307 Ga0157372_10063174 Ga0157372_100631744 229
472 3300013308 Ga0157375_10035646 Ga0157375_100356463 229
473 3300013308 Ga0157375_10221221 Ga0157375_102212212 229
474 3300013308 Ga0157375_10253865 Ga0157375_102538652 229
475 3300013308 Ga0157375_10281496 Ga0157375_102814962 229
476 3300014968 Ga0157379_10616146 Ga0157379_106161462 229
477 3300025315 Ga0207697_10000126 Ga0207697_1000012625 229
478 3300025315 Ga0207697_10011504 Ga0207697_100115043 229
479 3300025893 Ga0207682_10006624 Ga0207682_100066243 229
480 3300025899 Ga0207642_10016085 Ga0207642_100160852 229
481 3300025901 Ga0207688_10000322 Ga0207688_100003224 229
482 3300025903 Ga0207680_10011355 Ga0207680_100113552 229
483 3300025903 Ga0207680_10021717 Ga0207680_100217174 229
484 3300025903 Ga0207680_10037682 Ga0207680_100376822 229
485 3300025904 Ga0207647_10000454 Ga0207647_1000045413 229
486 3300025904 Ga0207647_10008463 Ga0207647_100084633 229
487 3300025904 Ga0207647_10116227 Ga0207647_101162272 229
488 3300025907 Ga0207645_10039934 Ga0207645_100399343 229
489 3300025907 Ga0207645_10092302 Ga0207645_100923022 229
490 3300025907 Ga0207645_10115500 Ga0207645_101155002 229
491 3300025908 Ga0207643_10049795 Ga0207643_100497952 229
492 3300025909 Ga0207705_10072938 Ga0207705_100729382 229
493 3300025909 Ga0207705_10120262 Ga0207705_101202622 229
494 3300025909 Ga0207705_10160025 Ga0207705_101600252 229
495 3300025919 Ga0207657_10001942 Ga0207657_100019426 229
496 3300025919 Ga0207657_10006524 Ga0207657_1000652412 229
497 3300025919 Ga0207657_10062220 Ga0207657_100622202 229
498 3300025919 Ga0207657_10066147 Ga0207657_100661472 229
499 3300025920 Ga0207649_10020295 Ga0207649_100202952 229
500 3300025920 Ga0207649_10100984 Ga0207649_101009842 229
501 3300025920 Ga0207649_10128839 Ga0207649_101288392 229
502 3300025923 Ga0207681_10002095 Ga0207681_100020952 229
503 3300025925 Ga0207650_10050578 Ga0207650_100505782 229
504 3300025926 Ga0207659_10128740 Ga0207659_101287402 229
505 3300025927 Ga0207687_10010640 Ga0207687_100106404 229
506 3300025927 Ga0207687_10015454 Ga0207687_100154542 229
507 3300025927 Ga0207687_10114359 Ga0207687_101143592 229
508 3300025931 Ga0207644_10011990 Ga0207644_100119902 229
509 3300025931 Ga0207644_10043431 Ga0207644_100434312 229
510 3300025931 Ga0207644_10357286 Ga0207644_103572862 229
511 3300025932 Ga0207690_10057370 Ga0207690_100573702 229
512 3300025933 Ga0207706_10001111 Ga0207706_1000111126 229
513 3300025933 Ga0207706_10003880 Ga0207706_100038805 229
514 3300025933 Ga0207706_10011920 Ga0207706_100119203 229
515 3300025935 Ga0207709_10193994 Ga0207709_101939942 229
516 3300025935 Ga0207709_10208069 Ga0207709_102080693 229
517 3300025937 Ga0207669_10020221 Ga0207669_100202213 229
518 3300025937 Ga0207669_10046721 Ga0207669_100467212 229
519 3300025938 Ga0207704_10007140 Ga0207704_100071403 229
520 3300025939 Ga0207665_10024770 Ga0207665_100247702 229
521 3300025940 Ga0207691_10001556 Ga0207691_1000155613 229
522 3300025940 Ga0207691_10024055 Ga0207691_100240553 229
523 3300025940 Ga0207691_10085225 Ga0207691_100852252 229
524 3300025941 Ga0207711_10002485 Ga0207711_1000248517 229
525 3300025941 Ga0207711_10218734 Ga0207711_102187342 229
526 3300025942 Ga0207689_10000486 Ga0207689_1000048613 229
527 3300025944 Ga0207661_10095464 Ga0207661_100954642 229
528 3300025945 Ga0207679_10024362 Ga0207679_100243624 229
529 3300025945 Ga0207679_10123746 Ga0207679_101237462 229
530 3300025945 Ga0207679_10235820 Ga0207679_102358202 229
531 3300025949 Ga0207667_10007136 Ga0207667_1000713611 229
532 3300025949 Ga0207667_10266913 Ga0207667_102669132 229
533 3300025949 Ga0207667_10373287 Ga0207667_103732872 229
534 3300025960 Ga0207651_10001001 Ga0207651_100010014 229
535 3300025960 Ga0207651_10005072 Ga0207651_100050723 229
536 3300025960 Ga0207651_10111137 Ga0207651_101111372 229
537 3300025960 Ga0207651_10133516 Ga0207651_101335162 229
538 3300025960 Ga0207651_10580798 Ga0207651_105807982 229
539 3300025972 Ga0207668_10548650 Ga0207668_105486502 229
540 3300025981 Ga0207640_10027331 Ga0207640_100273312 229
541 3300025981 Ga0207640_10036745 Ga0207640_100367452 229
542 3300025981 Ga0207640_10105084 Ga0207640_101050842 229
543 3300025986 Ga0207658_10004950 Ga0207658_100049504 229
544 3300025986 Ga0207658_10006011 Ga0207658_100060112 229
545 3300025986 Ga0207658_10010008 Ga0207658_100100086 229
546 3300026023 Ga0207677_10001583 Ga0207677_100015832 229
547 3300026023 Ga0207677_10006057 Ga0207677_100060573 229
548 3300026023 Ga0207677_10015474 Ga0207677_100154742 229
549 3300026023 Ga0207677_10175520 Ga0207677_101755202 229
550 3300026023 Ga0207677_10266758 Ga0207677_102667581 229
551 3300026035 Ga0207703_10002395 Ga0207703_100023959 229
552 3300026035 Ga0207703_10019192 Ga0207703_100191923 229
553 3300026041 Ga0207639_10012499 Ga0207639_100124999 229
554 3300026041 Ga0207639_10028261 Ga0207639_100282613 229
555 3300026041 Ga0207639_10054337 Ga0207639_100543372 229
556 3300026067 Ga0207678_10001918 Ga0207678_100019182 229
557 3300026067 Ga0207678_10034928 Ga0207678_100349282 229
558 3300026067 Ga0207678_10263877 Ga0207678_102638772 229
559 3300026067 Ga0207678_10267468 Ga0207678_102674683 229
560 3300026089 Ga0207648_10003492 Ga0207648_1000349213 229
561 3300026089 Ga0207648_10009797 Ga0207648_100097978 229
562 3300026089 Ga0207648_10016776 Ga0207648_100167763 229
563 3300026089 Ga0207648_10020735 Ga0207648_100207353 229
564 3300026095 Ga0207676_10003455 Ga0207676_1000345510 229
565 3300026095 Ga0207676_10327262 Ga0207676_103272622 229
566 3300026095 Ga0207676_10487893 Ga0207676_104878932 229
567 3300026116 Ga0207674_10001172 Ga0207674_1000117219 229
568 3300026118 Ga0207675_100199000 Ga0207675_1001990001 229
569 3300026121 Ga0207683_10114587 Ga0207683_101145872 229
570 3300026142 Ga0207698_10002206 Ga0207698_100022068 229
571 3300026142 Ga0207698_10107411 Ga0207698_101074113 229
572 3300026142 Ga0207698_10534654 Ga0207698_105346542 229
573 3300028379 Ga0268266_10027041 Ga0268266_100270413 229
574 3300028379 Ga0268266_10042575 Ga0268266_100425753 229
575 3300028379 Ga0268266_10275841 Ga0268266_102758412 229
576 3300028381 Ga0268264_10286459 Ga0268264_102864592 229
577 3300028381 Ga0268264_10297818 Ga0268264_102978182 229
578 3300035089 Ga0373944_0056096 Ga0373944_0056096_298_1029 229
579 3300037068 Ga0373925_0412284 Ga0373925_0412284_79_810 229
580 3300037418 Ga0395900_0339757 Ga0395900_0339757_493_1218 229
581 3300037471 Ga0395905_0479218 Ga0395905_0479218_309_1034 229
582 3300048906 Ga0496103_0086406 Ga0496103_0086406_126_857 229
583 3300048909 Ga0496106_0170448 Ga0496106_0170448_172_903 229
584 3300048910 Ga0496107_0057822 Ga0496107_0057822_905_1636 229
585 3300048910 Ga0496107_0395443 Ga0496107_0395443_143_877 229
586 3300048911 Ga0496108_0089464 Ga0496108_0089464_1755_2486 229
587 3300048913 Ga0496110_0004990 Ga0496110_0004990_5019_5750 229
588 3300048915 Ga0496112_0121730 Ga0496112_0121730_241_972 229
589 3300049585 Ga0501069_0095476 Ga0501069_0095476_84_815 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

71

114

0.94

PF01323

DSBA

DSBA-like thioredoxin domain

110

198

0.84

PF13462

Thioredoxin_4

Thioredoxin

58

126

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d6l-assembly1.cif.gz_A crystal structure of trx2 from d. radiodurans r1 0.9141 83 117
6nen-assembly1.cif.gz_A catalytic domain of proteus mirabilis scsc 0.9008 60 227
3gyk-assembly4.cif.gz_D the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 0.8974 63 229
4gxz-assembly3.cif.gz_C crystal structure of a periplasmic thioredoxin-like protein from salmonella enterica serovar typhimurium 0.8909 61 227
1v98-assembly2.cif.gz_B-3 crystal structure analysis of thioredoxin from thermus thermophilus 0.8735 83 119
ID Description Score Start End Superfamily
3gykA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8947 62 229 3.40.30.10
3gykA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8848 62 229 3.40.30.10
4xvwC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8778 56 228 3.40.30.10
af_O76877_42_160_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.877 83 119 3.40.30.10
1v98B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8735 83 119 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2A2K558-F1-model_v4 Thioredoxin domain-containing protein 0.9678 50 228 GO:0016491
AF-A0A418Q2E3-F1-model_v4 DsbA family protein 0.9623 28 227 GO:0016491
AF-A0A2A2K558-F1-model_v4 Thioredoxin domain-containing protein 0.9522 50 228 GO:0016491
AF-A0A258X6G2-F1-model_v4 Disulfide bond formation protein DsbA 0.9384 82 227 GO:0016491
AF-A0A7W0XMI2-F1-model_v4 DsbA family protein 0.9285 76 227 GO:0016491

Feature Viewer

pLDDT pTM Quality
86.95 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map