F466841

General Info

Members Datasets Scaffolds Average Seq Length
589 324 1178 110

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_102417549|Ga0068855_1024175491
Length 130
Sequence LAFPPRSAYGPFVSRLANLTLAVILSLLCAAAPAAAVQKRAARVWHGYGFLPGYQQPPNNALPPFKQKAAMRHSPRDRRPWYIDPTPQYYGYDGDWHYFGRPGFYRGHYNGGSFGPCWTRTPIGPVWNCG

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
175 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
176 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
177 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
178 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
179 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
180 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
181 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
206 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
268 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
269 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
270 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
271 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
272 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
273 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
274 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
275 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
276 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
277 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
278 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
279 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
280 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
281 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
282 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
283 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
284 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
285 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
286 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
287 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
288 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
289 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
290 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
291 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
292 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
293 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
294 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
295 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
296 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
297 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
298 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
299 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
300 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
301 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
302 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
303 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
304 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
305 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
306 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
307 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
308 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
309 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
310 2791355199
311 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
312 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
313 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
314 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
315 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
316 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
317 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
318 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
319 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
320 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
321 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
322 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
323 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
324 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.94
Metatranscriptomes 0.17
Isolates 2.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.47
Nodule 0.85
Rhizoplane 4.41
Rhizosphere 68.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_102417549 3300005563 Bacteria 524
2 CNAas_1013747 3300000532 Bacteria 562
3 JGI25153J46596_10005433 3300003215 Bacteria 6690
4 Ga0070676_11282344 3300005328 Bacteria 559
5 Ga0070670_100148903 3300005331 Bacteria 2025
6 Ga0070670_101117993 3300005331 Bacteria 719
7 Ga0068869_100055338 3300005334 Bacteria 2891
8 Ga0068869_100130186 3300005334 Bacteria 1933
9 Ga0070666_10904138 3300005335 Bacteria 653
10 Ga0070682_100452578 3300005337 Bacteria 983
11 Ga0068868_100024320 3300005338 Bacteria 4595
12 Ga0068868_100653397 3300005338 Bacteria 937
13 Ga0068868_100868899 3300005338 Bacteria 818
14 Ga0068868_101936782 3300005338 Bacteria 559
15 Ga0070689_100236075 3300005340 Bacteria 1505
16 Ga0070689_100266556 3300005340 Bacteria 1417
17 Ga0070689_100683909 3300005340 Bacteria 895
18 Ga0070687_100033028 3300005343 Bacteria 2551
19 Ga0070661_100544974 3300005344 Bacteria 933
20 Ga0070692_10870087 3300005345 Bacteria 621
21 Ga0070668_100006633 3300005347 Bacteria 8579
22 Ga0070668_100066033 3300005347 Bacteria 2806
23 Ga0070668_100103879 3300005347 Bacteria 2254
24 Ga0070668_100384106 3300005347 Bacteria 1196
25 Ga0070668_101055895 3300005347 Bacteria 732
26 Ga0070669_100048506 3300005353 Bacteria 3099
27 Ga0070669_100979695 3300005353 Bacteria 725
28 Ga0070675_101725967 3300005354 Bacteria 578
29 Ga0070671_100298954 3300005355 Bacteria 1370
30 Ga0070674_100096291 3300005356 Bacteria 2147
31 Ga0070674_100261088 3300005356 Bacteria 1365
32 Ga0070674_100356545 3300005356 Bacteria 1183
33 Ga0070673_100974461 3300005364 Bacteria 789
34 Ga0070673_101335917 3300005364 Bacteria 674
35 Ga0070659_100210698 3300005366 Bacteria 1601
36 Ga0070667_100634838 3300005367 Bacteria 985
37 Ga0070667_100745608 3300005367 Bacteria 907
38 Ga0070714_100858360 3300005435 Bacteria 880
39 Ga0070701_10627746 3300005438 Bacteria 715
40 Ga0070705_100245062 3300005440 Bacteria 1255
41 Ga0070700_101127008 3300005441 Bacteria 652
42 Ga0070694_100766549 3300005444 Bacteria 789
43 Ga0070663_100045207 3300005455 Bacteria 3109
44 Ga0070663_100093985 3300005455 Bacteria 2226
45 Ga0070663_100562372 3300005455 Bacteria 955
46 Ga0070678_100170428 3300005456 Bacteria 1772
47 Ga0070678_100188206 3300005456 Bacteria 1695
48 Ga0070678_100316856 3300005456 Bacteria 1331
49 Ga0070678_100433662 3300005456 Bacteria 1148
50 Ga0070678_100533531 3300005456 Bacteria 1040
51 Ga0070662_100092853 3300005457 Bacteria 2269
52 Ga0070662_100144688 3300005457 Bacteria 1846
53 Ga0070662_100289860 3300005457 Bacteria 1327
54 Ga0068867_100353715 3300005459 Bacteria 1226
55 Ga0068867_101181971 3300005459 Bacteria 702
56 Ga0070685_10182969 3300005466 Bacteria 1351
57 Ga0070698_100205328 3300005471 Bacteria 1905
58 Ga0070699_100286743 3300005518 Bacteria 1475
59 Ga0070684_100815668 3300005535 Bacteria 872
60 Ga0070684_101643644 3300005535 Bacteria 606
61 Ga0068853_100082639 3300005539 Bacteria 2813
62 Ga0068853_100253222 3300005539 Bacteria 1616
63 Ga0068853_100814131 3300005539 Bacteria 895
64 Ga0068853_101724731 3300005539 Bacteria 607
65 Ga0070695_100390416 3300005545 Bacteria 1052
66 Ga0070693_100225791 3300005547 Bacteria 1229
67 Ga0070665_100023329 3300005548 Bacteria 6228
68 Ga0070665_100123653 3300005548 Bacteria 2589
69 Ga0070665_100414435 3300005548 Bacteria 1356
70 Ga0070665_100449820 3300005548 Bacteria 1298
71 Ga0070665_100601624 3300005548 Bacteria 1112
72 Ga0070665_100810131 3300005548 Bacteria 949
73 Ga0070665_101157730 3300005548 Bacteria 784
74 Ga0068855_102028197 3300005563 Bacteria 581
75 Ga0070664_101183991 3300005564 Bacteria 721
76 Ga0068857_100458179 3300005577 Bacteria 1193
77 Ga0068854_100236774 3300005578 Bacteria 1452
78 Ga0068854_101329034 3300005578 Bacteria 648
79 Ga0068854_101746342 3300005578 Bacteria 570
80 Ga0070702_100072301 3300005615 Bacteria 2040
81 Ga0070702_100089788 3300005615 Bacteria 1861
82 Ga0068852_100984508 3300005616 Bacteria 862
83 Ga0068852_101818451 3300005616 Bacteria 631
84 Ga0068859_100143379 3300005617 Bacteria 2462
85 Ga0068859_100437814 3300005617 Bacteria 1403
86 Ga0068864_100041502 3300005618 Bacteria 3935
87 Ga0068864_102154243 3300005618 Bacteria 564
88 Ga0068866_10557969 3300005718 Bacteria 767
89 Ga0068861_100059652 3300005719 Bacteria 2922
90 Ga0068861_100155352 3300005719 Bacteria 1881
91 Ga0068861_100980313 3300005719 Bacteria 805
92 Ga0068851_10701824 3300005834 Bacteria 623
93 Ga0068870_10085984 3300005840 Bacteria 1749
94 Ga0068863_100652677 3300005841 Bacteria 1043
95 Ga0068863_101069663 3300005841 Bacteria 811
96 Ga0068863_101425702 3300005841 Bacteria 700
97 Ga0068863_101820855 3300005841 Bacteria 619
98 Ga0068858_100079194 3300005842 Bacteria 3053
99 Ga0068858_100350952 3300005842 Bacteria 1413
100 Ga0068860_100212986 3300005843 Bacteria 1874
101 Ga0068860_100431365 3300005843 Bacteria 1308
102 Ga0068860_100618624 3300005843 Bacteria 1089
103 Ga0068860_101142944 3300005843 Bacteria 798
104 Ga0068860_101311976 3300005843 Bacteria 744
105 Ga0068862_100060130 3300005844 Bacteria 3263
106 Ga0068862_100085852 3300005844 Bacteria 2735
107 Ga0068862_100407277 3300005844 Bacteria 1273
108 Ga0068862_100425814 3300005844 Bacteria 1246
109 Ga0068862_102074111 3300005844 Bacteria 580
110 Ga0081455_10013510 3300005937 Bacteria 8055
111 Ga0081455_10142699 3300005937 Bacteria 1858
112 Ga0081455_10166290 3300005937 Bacteria 1685
113 Ga0081540_1002045 3300005983 Bacteria 16821
114 Ga0081540_1007384 3300005983 Bacteria 7840
115 Ga0081540_1008388 3300005983 Bacteria 7222
116 Ga0081539_10116473 3300005985 Bacteria 1334
117 Ga0075365_10007354 3300006038 Bacteria 6160
118 Ga0075365_10278471 3300006038 Bacteria 1177
119 Ga0075365_10874164 3300006038 Bacteria 634
120 Ga0075368_10038412 3300006042 Bacteria 1874
121 Ga0075368_10079539 3300006042 Bacteria 1333
122 Ga0075368_10137917 3300006042 Bacteria 1016
123 Ga0075363_100041738 3300006048 Bacteria 2420
124 Ga0075363_100076365 3300006048 Bacteria 1826
125 Ga0075363_100366832 3300006048 Bacteria 843
126 Ga0075363_100586444 3300006048 Bacteria 667
127 Ga0075364_10065494 3300006051 Bacteria 2385
128 Ga0075364_10150100 3300006051 Bacteria 1570
129 Ga0075364_10592466 3300006051 Bacteria 757
130 Ga0075362_10273279 3300006177 Bacteria 835
131 Ga0075367_10035459 3300006178 Bacteria 2888
132 Ga0075367_10065534 3300006178 Bacteria 2175
133 Ga0075367_10178366 3300006178 Bacteria 1324
134 Ga0075369_10050342 3300006186 Bacteria 1801
135 Ga0075366_10050305 3300006195 Bacteria 2474
136 Ga0075366_10480349 3300006195 Bacteria 768
137 Ga0097621_100251871 3300006237 Bacteria 1546
138 Ga0097621_100444078 3300006237 Bacteria 1168
139 Ga0075370_10098966 3300006353 Bacteria 1687
140 Ga0075370_10239878 3300006353 Bacteria 1073
141 Ga0075370_10334946 3300006353 Bacteria 903
142 Ga0075370_10620308 3300006353 Bacteria 656
143 Ga0068871_100208500 3300006358 Bacteria 1690
144 Ga0068871_100378223 3300006358 Bacteria 1257
145 Ga0075428_101291606 3300006844 Bacteria 768
146 Ga0075434_100458667 3300006871 Bacteria 1296
147 Ga0068865_101818053 3300006881 Bacteria 551
148 Ga0097620_100143388 3300006931 Bacteria 2462
149 Ga0097620_100437797 3300006931 Bacteria 1403
150 Ga0075435_100687915 3300007076 Bacteria 889
151 Ga0099795_10039078 3300007788 Bacteria 1678
152 Ga0105250_10154915 3300009092 Bacteria 955
153 Ga0105240_11260547 3300009093 Bacteria 781
154 Ga0111539_10645858 3300009094 Bacteria 1232
155 Ga0111539_12278360 3300009094 Bacteria 628
156 Ga0105245_10421603 3300009098 Bacteria 1338
157 Ga0105245_10463278 3300009098 Bacteria 1278
158 Ga0114129_10100622 3300009147 Bacteria 4000
159 Ga0105243_10009554 3300009148 Bacteria 7383
160 Ga0105243_10254663 3300009148 Bacteria 1569
161 Ga0105243_10731646 3300009148 Bacteria 968
162 Ga0105243_11021651 3300009148 Bacteria 831
163 Ga0105243_11341464 3300009148 Bacteria 734
164 Ga0105243_12110827 3300009148 Bacteria 599
165 Ga0105241_10618529 3300009174 Bacteria 980
166 Ga0105241_12232835 3300009174 Bacteria 543
167 Ga0105242_10048353 3300009176 Bacteria 3457
168 Ga0105242_10656637 3300009176 Bacteria 1021
169 Ga0105242_12112235 3300009176 Bacteria 607
170 Ga0105248_10091047 3300009177 Bacteria 3435
171 Ga0105248_10568172 3300009177 Bacteria 1279
172 Ga0105248_11793730 3300009177 Bacteria 696
173 Ga0105237_10379300 3300009545 Bacteria 1418
174 Ga0105237_10804705 3300009545 Bacteria 947
175 Ga0105238_10271887 3300009551 Bacteria 1675
176 Ga0105238_10543432 3300009551 Bacteria 1166
177 Ga0105249_10066330 3300009553 Bacteria 3323
178 Ga0105249_10205914 3300009553 Bacteria 1928
179 Ga0105249_10353943 3300009553 Bacteria 1488
180 Ga0105249_10392609 3300009553 Bacteria 1416
181 Ga0105239_10162266 3300010375 Bacteria 2498
182 Ga0105239_10565964 3300010375 Bacteria 1295
183 Ga0105239_10852406 3300010375 Bacteria 1045
184 Ga0105246_10732227 3300011119 Bacteria 870
185 Ga0157374_10473137 3300013296 Bacteria 1256
186 Ga0157374_11379530 3300013296 Bacteria 727
187 Ga0157378_10385858 3300013297 Bacteria 1377
188 Ga0157378_11374974 3300013297 Bacteria 748
189 Ga0163162_10147389 3300013306 Bacteria 2470
190 Ga0163162_10449040 3300013306 Bacteria 1421
191 Ga0163162_10827570 3300013306 Bacteria 1042
192 Ga0163162_12153927 3300013306 Bacteria 640
193 Ga0163162_12347490 3300013306 Bacteria 613
194 Ga0157372_10857259 3300013307 Bacteria 1054
195 Ga0157375_10061281 3300013308 Bacteria 3735
196 Ga0157375_10618427 3300013308 Bacteria 1241
197 Ga0163163_10344422 3300014325 Bacteria 1546
198 Ga0157380_10846155 3300014326 Bacteria 936
199 Ga0157380_10902481 3300014326 Bacteria 910
200 Ga0157380_11163306 3300014326 Bacteria 813
201 Ga0157377_10223908 3300014745 Bacteria 1206
202 Ga0157379_10493302 3300014968 Bacteria 1134
203 Ga0157379_11047646 3300014968 Bacteria 779
204 Ga0157379_11545605 3300014968 Bacteria 647
205 Ga0157376_10083763 3300014969 Bacteria 2744
206 Ga0163161_10038442 3300017792 Bacteria 3433
207 Ga0163161_10422920 3300017792 Bacteria 1072
208 Ga0163161_11783901 3300017792 Bacteria 547
209 Ga0209758_1029821 3300025297 Bacteria 2271
210 Ga0207697_10224752 3300025315 Bacteria 828
211 Ga0207653_10450480 3300025885 Bacteria 505
212 Ga0207642_10413721 3300025899 Bacteria 809
213 Ga0207710_10138158 3300025900 Bacteria 1175
214 Ga0207710_10428143 3300025900 Bacteria 681
215 Ga0207688_10155694 3300025901 Bacteria 1352
216 Ga0207688_10187782 3300025901 Bacteria 1235
217 Ga0207680_10138449 3300025903 Bacteria 1611
218 Ga0207680_10911206 3300025903 Bacteria 630
219 Ga0207680_10933143 3300025903 Bacteria 622
220 Ga0207643_10035204 3300025908 Bacteria 2806
221 Ga0207643_10306614 3300025908 Bacteria 989
222 Ga0207671_10032207 3300025914 Bacteria 3903
223 Ga0207671_10754041 3300025914 Bacteria 773
224 Ga0207662_10126207 3300025918 Bacteria 1609
225 Ga0207681_10040025 3300025923 Bacteria 3116
226 Ga0207681_11125225 3300025923 Bacteria 659
227 Ga0207694_10598743 3300025924 Bacteria 927
228 Ga0207650_10247261 3300025925 Bacteria 1443
229 Ga0207650_10382698 3300025925 Bacteria 1162
230 Ga0207659_10346960 3300025926 Bacteria 1231
231 Ga0207659_11314745 3300025926 Bacteria 621
232 Ga0207687_10024608 3300025927 Bacteria 4024
233 Ga0207644_10483547 3300025931 Bacteria 1020
234 Ga0207706_10046302 3300025933 Bacteria 3851
235 Ga0207706_10082368 3300025933 Bacteria 2828
236 Ga0207706_10333396 3300025933 Bacteria 1320
237 Ga0207706_10349543 3300025933 Bacteria 1286
238 Ga0207686_10462106 3300025934 Bacteria 978
239 Ga0207686_10905574 3300025934 Bacteria 712
240 Ga0207709_10006210 3300025935 Bacteria 6722
241 Ga0207709_10491642 3300025935 Bacteria 956
242 Ga0207709_10556095 3300025935 Bacteria 903
243 Ga0207709_11375628 3300025935 Bacteria 584
244 Ga0207670_10291902 3300025936 Bacteria 1274
245 Ga0207669_10105109 3300025937 Bacteria 1877
246 Ga0207669_10213573 3300025937 Bacteria 1410
247 Ga0207704_11388063 3300025938 Bacteria 602
248 Ga0207691_10103097 3300025940 Bacteria 2544
249 Ga0207691_10332016 3300025940 Bacteria 1303
250 Ga0207711_10051031 3300025941 Bacteria 3542
251 Ga0207711_10904643 3300025941 Bacteria 820
252 Ga0207711_11546022 3300025941 Bacteria 607
253 Ga0207689_10110956 3300025942 Bacteria 2254
254 Ga0207689_10173805 3300025942 Bacteria 1776
255 Ga0207679_10262846 3300025945 Bacteria 1473
256 Ga0207651_10681648 3300025960 Bacteria 904
257 Ga0207651_11564156 3300025960 Bacteria 594
258 Ga0207712_10294090 3300025961 Bacteria 1330
259 Ga0207712_10758330 3300025961 Bacteria 851
260 Ga0207668_10031568 3300025972 Bacteria 3490
261 Ga0207668_10598118 3300025972 Bacteria 960
262 Ga0207668_10970582 3300025972 Bacteria 758
263 Ga0207640_10869639 3300025981 Bacteria 785
264 Ga0207658_10118116 3300025986 Bacteria 2109
265 Ga0207677_11357975 3300026023 Bacteria 654
266 Ga0207703_10110047 3300026035 Bacteria 2349
267 Ga0207703_10733301 3300026035 Bacteria 941
268 Ga0207639_10169569 3300026041 Bacteria 1847
269 Ga0207639_10252620 3300026041 Bacteria 1538
270 Ga0207639_10522084 3300026041 Bacteria 1087
271 Ga0207639_10713887 3300026041 Bacteria 931
272 Ga0207678_10050170 3300026067 Bacteria 3606
273 Ga0207678_10226208 3300026067 Bacteria 1602
274 Ga0207678_10246003 3300026067 Bacteria 1532
275 Ga0207678_10441008 3300026067 Bacteria 1131
276 Ga0207678_10561262 3300026067 Bacteria 999
277 Ga0207708_10071693 3300026075 Bacteria 2654
278 Ga0207708_10105788 3300026075 Bacteria 2181
279 Ga0207708_10120091 3300026075 Bacteria 2047
280 Ga0207708_10863787 3300026075 Bacteria 782
281 Ga0207641_11443843 3300026088 Bacteria 689
282 Ga0207648_10173323 3300026089 Bacteria 1907
283 Ga0207648_11180811 3300026089 Bacteria 719
284 Ga0207676_10175875 3300026095 Bacteria 1869
285 Ga0207676_10623507 3300026095 Bacteria 1038
286 Ga0207674_10460609 3300026116 Bacteria 1229
287 Ga0207675_100081041 3300026118 Bacteria 3043
288 Ga0207675_100087811 3300026118 Bacteria 2921
289 Ga0207675_100391646 3300026118 Bacteria 1368
290 Ga0207683_10056160 3300026121 Bacteria 3453
291 Ga0207683_10469140 3300026121 Bacteria 1161
292 Ga0207698_10246337 3300026142 Bacteria 1632
293 Ga0209813_10146168 3300027866 Bacteria 843
294 Ga0268266_10002199 3300028379 Bacteria 21331
295 Ga0268266_10099211 3300028379 Bacteria 2563
296 Ga0268266_10109899 3300028379 Bacteria 2441
297 Ga0268266_10945948 3300028379 Bacteria 833
298 Ga0268266_10981973 3300028379 Bacteria 817
299 Ga0268265_10107844 3300028380 Bacteria 2266
300 Ga0268265_10265796 3300028380 Bacteria 1527
301 Ga0268265_11756762 3300028380 Bacteria 626
302 Ga0268264_10236243 3300028381 Bacteria 1691
303 Ga0268264_10297996 3300028381 Bacteria 1517
304 Ga0268264_10641345 3300028381 Bacteria 1050
305 Ga0268264_11585827 3300028381 Bacteria 665
306 Ga0307517_10000436 3300028786 Bacteria 71537
307 Ga0307517_10278822 3300028786 Bacteria 955
308 Ga0307517_10341114 3300028786 Bacteria 818
309 Ga0307517_10666770 3300028786 Bacteria 504
310 Ga0307515_10015628 3300028794 Bacteria 13968
311 Ga0307515_10235612 3300028794 Bacteria 1612
312 Ga0307515_10261754 3300028794 Bacteria 1465
313 Ga0265763_1048612 3300030763 Bacteria 529
314 Ga0265331_10251723 3300031250 Bacteria 792
315 Ga0307513_10183297 3300031456 Bacteria 1954
316 Ga0307513_10312785 3300031456 Bacteria 1332
317 Ga0307513_10503841 3300031456 Bacteria 928
318 Ga0307509_10142946 3300031507 Bacteria 2324
319 Ga0307509_10533721 3300031507 Bacteria 853
320 Ga0307408_100469580 3300031548 Bacteria 1095
321 Ga0307508_10156717 3300031616 Bacteria 1881
322 Ga0307516_10557254 3300031730 Bacteria 800
323 Ga0307516_10667755 3300031730 Bacteria 695
324 Ga0307405_10555219 3300031731 Bacteria 930
325 Ga0307413_10331057 3300031824 Bacteria 1167
326 Ga0307412_10970290 3300031911 Bacteria 749
327 Ga0307416_100126764 3300032002 Bacteria 2288
328 Ga0307416_102219618 3300032002 Bacteria 650
329 Ga0307411_10184067 3300032005 Bacteria 1588
330 Ga0307411_10264705 3300032005 Bacteria 1360
331 Ga0307415_100059631 3300032126 Bacteria 2633
332 Ga0307415_100128905 3300032126 Bacteria 1911
333 Ga0307507_10190631 3300033179 Bacteria 1442
334 Ga0307510_10015811 3300033180 Bacteria 8919
335 Ga0373959_0161420 3300034820 Bacteria 573
336 Ga0373944_0228084 3300035089 Bacteria 682
337 Ga0373939_0221401 3300035114 Bacteria 725
338 Ga0373943_0117087 3300035170 Bacteria 1412
339 Ga0373942_0194794 3300035207 Bacteria 670
340 Ga0373931_1026585 3300035691 Bacteria 559
341 Ga0373935_0652896 3300035692 Bacteria 772
342 Ga0373927_0361147 3300035695 Bacteria 957
343 Ga0373947_0154780 3300035725 Bacteria 1479
344 Ga0373947_0491687 3300035725 Bacteria 833
345 Ga0373925_0011573 3300037068 Bacteria 6382
346 Ga0373925_0705183 3300037068 Bacteria 832
347 Ga0395905_0207139 3300037471 Bacteria 1838
348 Ga0395905_0474405 3300037471 Bacteria 1150
349 Ga0451791_1289547 3300041451 Bacteria 1084
350 Ga0451795_0475458 3300041456 Bacteria 1187
351 Ga0451800_0210512 3300041459 Bacteria 603
352 Ga0451849_1450693 3300041505 Bacteria 518
353 Ga0439458_0123311 3300042157 Bacteria 683
354 Ga0439459_0044165 3300042438 Bacteria 957
355 Ga0495617_136265 3300046452 Bacteria 785
356 Ga0495627_171588 3300046453 Bacteria 602
357 Ga0495603_0050280 3300046455 Bacteria 2479
358 Ga0495603_0090017 3300046455 Bacteria 1795
359 Ga0495603_0352298 3300046455 Bacteria 844
360 Ga0495638_0005551 3300046460 Bacteria 9340
361 Ga0495638_0132595 3300046460 Bacteria 1462
362 Ga0495638_0173532 3300046460 Bacteria 1235
363 Ga0495638_0239000 3300046460 Bacteria 1007
364 Ga0495638_0243683 3300046460 Bacteria 994
365 Ga0495638_0286718 3300046460 Bacteria 892
366 Ga0495638_0395366 3300046460 Bacteria 718
367 Ga0495650_0192322 3300046471 Bacteria 712
368 Ga0495582_0563571 3300046473 Bacteria 659
369 Ga0495605_0137460 3300046474 Bacteria 1098
370 Ga0495605_0467130 3300046474 Bacteria 518
371 Ga0495639_0276847 3300046475 Bacteria 833
372 Ga0495664_0048540 3300046477 Bacteria 2520
373 Ga0495584_0097091 3300046491 Bacteria 1488
374 Ga0495584_0321710 3300046491 Bacteria 785
375 Ga0495585_0134043 3300046492 Bacteria 1301
376 Ga0495585_0144832 3300046492 Bacteria 1242
377 Ga0495585_0226455 3300046492 Bacteria 941
378 Ga0495594_0233909 3300046499 Bacteria 1047
379 Ga0495596_0177719 3300046500 Bacteria 827
380 Ga0495607_0323288 3300046501 Bacteria 719
381 Ga0495583_0431643 3300046506 Bacteria 516
382 Ga0495606_0086378 3300046507 Bacteria 1939
383 Ga0495610_0013025 3300046512 Bacteria 4966
384 Ga0495616_0451763 3300046513 Bacteria 520
385 Ga0495620_0027777 3300046515 Bacteria 2643
386 Ga0495620_0265067 3300046515 Bacteria 654
387 Ga0495628_0406340 3300046516 Bacteria 994
388 Ga0495630_0199239 3300046517 Bacteria 1528
389 Ga0495630_0224216 3300046517 Bacteria 1435
390 Ga0495631_0063305 3300046518 Bacteria 1602
391 Ga0495631_0532814 3300046518 Bacteria 500
392 Ga0495632_0048364 3300046519 Bacteria 2106
393 Ga0495632_0081393 3300046519 Bacteria 1544
394 Ga0495632_0098496 3300046519 Bacteria 1379
395 Ga0495644_0017737 3300046523 Bacteria 2720
396 Ga0495644_0103841 3300046523 Bacteria 1076
397 Ga0495644_0179673 3300046523 Bacteria 813
398 Ga0495648_0208640 3300046524 Bacteria 972
399 Ga0495663_0051083 3300046525 Bacteria 1280
400 Ga0495663_0055996 3300046525 Bacteria 1231
401 Ga0495598_0031195 3300046537 Bacteria 1498
402 Ga0495598_0306483 3300046537 Bacteria 602
403 Ga0495609_0068531 3300046538 Bacteria 1561
404 Ga0495621_0133458 3300046539 Bacteria 967
405 Ga0495645_0449380 3300046543 Bacteria 813
406 Ga0495622_0242127 3300046557 Bacteria 795
407 Ga0495656_0008247 3300046615 Bacteria 3715
408 Ga0495656_0148102 3300046615 Bacteria 1131
409 Ga0495656_0525108 3300046615 Bacteria 629
410 Ga0495668_0017565 3300046616 Bacteria 4146
411 Ga0495668_0122036 3300046616 Bacteria 1425
412 Ga0495668_0302963 3300046616 Bacteria 876
413 Ga0495611_0106641 3300046648 Bacteria 1303
414 Ga0495611_0455187 3300046648 Bacteria 583
415 Ga0495625_0071756 3300046660 Bacteria 2429
416 Ga0495635_0547363 3300046663 Bacteria 759
417 Ga0495588_0080545 3300046674 Bacteria 1699
418 Ga0495669_0006054 3300046684 Bacteria 5048
419 Ga0495669_0073816 3300046684 Bacteria 1558
420 Ga0495669_0212148 3300046684 Bacteria 927
421 Ga0495670_0097717 3300046691 Bacteria 1509
422 Ga0495589_0089162 3300046794 Bacteria 1498
423 Ga0495589_0146428 3300046794 Bacteria 1129
424 Ga0495581_0463860 3300047315 Bacteria 737
425 Ga0495674_0560327 3300047319 Bacteria 909
426 Ga0495672_0012352 3300047320 Bacteria 5964
427 Ga0495672_0039865 3300047320 Bacteria 2853
428 Ga0495672_0046432 3300047320 Bacteria 2590
429 Ga0495676_0059587 3300047321 Bacteria 2997
430 Ga0495683_0129686 3300047323 Bacteria 1190
431 Ga0495683_0254626 3300047323 Bacteria 769
432 Ga0495683_0352251 3300047323 Bacteria 621
433 Ga0495673_0107617 3300047469 Bacteria 1119
434 Ga0495681_0112430 3300047470 Bacteria 1178
435 Ga0495681_0334547 3300047470 Bacteria 579
436 Ga0495686_0068809 3300047472 Bacteria 2184
437 Ga0495686_0193793 3300047472 Bacteria 1170
438 Ga0495615_0048519 3300048090 Bacteria 1086
439 Ga0495615_0090644 3300048090 Bacteria 851
440 Ga0496100_1229867 3300048903 Bacteria 591
441 Ga0496101_0046877 3300048904 Bacteria 3101
442 Ga0496102_0699694 3300048905 Bacteria 936
443 Ga0496102_0709024 3300048905 Bacteria 929
444 Ga0496102_0752342 3300048905 Bacteria 897
445 Ga0496102_0879214 3300048905 Bacteria 818
446 Ga0496103_0299812 3300048906 Bacteria 1034
447 Ga0496103_0315474 3300048906 Bacteria 1006
448 Ga0496103_1056226 3300048906 Bacteria 504
449 Ga0496107_0471145 3300048910 Bacteria 932
450 Ga0496107_1107495 3300048910 Bacteria 572
451 Ga0496108_0439691 3300048911 Bacteria 1139
452 Ga0496108_0521527 3300048911 Bacteria 1037
453 Ga0496108_0952146 3300048911 Bacteria 735
454 Ga0496109_0582545 3300048912 Bacteria 1054
455 Ga0496109_1084249 3300048912 Bacteria 738
456 Ga0496110_0103637 3300048913 Bacteria 2552
457 Ga0496110_0195411 3300048913 Bacteria 1837
458 Ga0496111_0423183 3300048914 Bacteria 984
459 Ga0496112_0316185 3300048915 Bacteria 1506
460 Ga0496113_0188070 3300048916 Bacteria 1639
461 Ga0496115_0073493 3300048918 Bacteria 2775
462 Ga0496115_0895957 3300048918 Bacteria 684
463 Ga0496117_0574901 3300048920 Bacteria 532
464 Ga0496118_0196553 3300048921 Bacteria 1200
465 Ga0496119_0166486 3300048922 Bacteria 1167
466 Ga0496119_0185773 3300048922 Bacteria 1087
467 Ga0496119_0307922 3300048922 Bacteria 779
468 Ga0496121_0000571 3300048924 Bacteria 69504
469 Ga0496121_0002649 3300048924 Bacteria 26855
470 Ga0496121_0007595 3300048924 Bacteria 13052
471 Ga0496121_0041980 3300048924 Bacteria 3987
472 Ga0496121_0084695 3300048924 Bacteria 2498
473 Ga0496121_0106662 3300048924 Bacteria 2147
474 Ga0496121_0119637 3300048924 Bacteria 1991
475 Ga0496121_0119655 3300048924 Bacteria 1991
476 Ga0496121_0162547 3300048924 Bacteria 1631
477 Ga0496121_0312316 3300048924 Bacteria 1062
478 Ga0496124_0308054 3300048927 Bacteria 1140
479 Ga0496124_0728378 3300048927 Bacteria 625
480 Ga0496125_0067360 3300048928 Bacteria 2822
481 Ga0496125_0319365 3300048928 Bacteria 942
482 Ga0496126_0001525 3300048929 Bacteria 35645
483 Ga0496126_0019825 3300048929 Bacteria 6613
484 Ga0496126_0044158 3300048929 Bacteria 4106
485 Ga0496126_0057137 3300048929 Bacteria 3525
486 Ga0496126_0109337 3300048929 Bacteria 2409
487 Ga0496126_0654503 3300048929 Bacteria 821
488 Ga0495682_0097071 3300049460 Bacteria 1058
489 Ga0495682_0165098 3300049460 Bacteria 788
490 Ga0501040_1191949 3300049576 Bacteria 553
491 Ga0501067_0014579 3300049583 Bacteria 4351
492 Ga0501067_0249526 3300049583 Bacteria 988
493 Ga0501069_0116823 3300049585 Bacteria 1522
494 Ga0501079_1270762 3300049741 Bacteria 580
495 Ga0501080_1762050 3300049742 Bacteria 521
496 nmdc:mga03683_64375_c1 3300050489 Bacteria 1556
497 nmdc:mga03n38_505603_c1 3300050490 Bacteria 679
498 nmdc:mga00v17_64075_c1 3300050491 Bacteria 2265
499 nmdc:mga0yw44_166191_c1 3300050492 Bacteria 1447
500 nmdc:mga0yw44_294743_c1 3300050492 Bacteria 1086
501 nmdc:mga0yw44_457432_c1 3300050492 Bacteria 865
502 nmdc:mga0yw44_677010_c1 3300050492 Bacteria 701
503 nmdc:mga0k408_37605_c1 3300050493 Bacteria 2779
504 nmdc:mga0k408_430748_c1 3300050493 Bacteria 784
505 nmdc:mga0k408_749295_c1 3300050493 Bacteria 571
506 nmdc:mga06z11_140496_c1 3300050494 Bacteria 1365
507 nmdc:mga04h51_170367_c1 3300050495 Bacteria 842
508 nmdc:mga07m45_251493_c1 3300050496 Bacteria 1028
509 nmdc:mga07m45_280330_c1 3300050496 Bacteria 969
510 nmdc:mga07m45_299473_c1 3300050496 Bacteria 935
511 nmdc:mga07m45_6729_c1 3300050496 Bacteria 5831
512 nmdc:mga07m45_865691_c1 3300050496 Bacteria 517
513 nmdc:mga05p37_53130_c1 3300050507 Bacteria 4983
514 nmdc:mga09592_277875_c1 3300050508 Bacteria 1452
515 nmdc:mga08y16_270243_c1 3300050511 Bacteria 1755
516 nmdc:mga0n895_197987_c1 3300050512 Bacteria 2040
517 nmdc:mga0rr50_733573_c1 3300050513 Bacteria 843
518 nmdc:mga0sz30_318075_c1 3300050516 Bacteria 695
519 nmdc:mga0sz30_338751_c1 3300050516 Bacteria 672
520 nmdc:mga0sz30_90094_c2 3300050516 Bacteria 892
521 Ga0500610_0250801 3300053079 Bacteria 816
522 Ga0495655_0037670 3300053083 Bacteria 1216
523 Ga0500643_024864 3300053087 Bacteria 1895
524 Ga0500646_0392075 3300053090 Bacteria 512
525 Ga0500583_0066008 3300053092 Bacteria 1720
526 Ga0500566_0000008 3300053094 Bacteria 143641
527 Ga0500566_0364396 3300053094 Bacteria 658
528 Ga0500640_005656 3300053095 Bacteria 4691
529 Ga0500641_0046900 3300053096 Bacteria 1765
530 Ga0500650_0292730 3300053098 Bacteria 722
531 Ga0500650_0327376 3300053098 Bacteria 674
532 Ga0500557_242275 3300053105 Bacteria 567
533 Ga0500569_319503 3300053109 Bacteria 520
534 Ga0500572_000983 3300053111 Bacteria 8644
535 Ga0500580_248451 3300053113 Bacteria 531
536 Ga0500582_046819 3300053114 Bacteria 1406
537 Ga0500594_0020861 3300053118 Bacteria 1639
538 Ga0500594_0030273 3300053118 Bacteria 1420
539 Ga0500595_000446 3300053119 Bacteria 25816
540 Ga0500595_005336 3300053119 Bacteria 5625
541 Ga0500595_076220 3300053119 Bacteria 988
542 Ga0500608_005464 3300053122 Bacteria 5054
543 Ga0500614_000233 3300053123 Bacteria 14528
544 Ga0500655_041250 3300053133 Bacteria 905
545 Ga0500559_0003471 3300053136 Bacteria 7737
546 Ga0500568_0010096 3300053139 Bacteria 4444
547 Ga0500568_0106225 3300053139 Bacteria 1052
548 Ga0500577_0189719 3300053142 Bacteria 884
549 Ga0500577_0234079 3300053142 Bacteria 796
550 Ga0500589_063808 3300053147 Bacteria 1682
551 Ga0500589_184918 3300053147 Bacteria 815
552 Ga0500589_288744 3300053147 Bacteria 585
553 Ga0500590_016483 3300053148 Bacteria 3821
554 Ga0500603_000033 3300053150 Bacteria 33766
555 Ga0500606_080490 3300053152 Bacteria 1103
556 Ga0500620_281899 3300053155 Bacteria 544
557 Ga0500622_0119082 3300053156 Bacteria 1282
558 Ga0500622_0394894 3300053156 Bacteria 563
559 Ga0500622_0448263 3300053156 Bacteria 514
560 Ga0500627_0253280 3300053158 Bacteria 779
561 Ga0500630_000238 3300053159 Bacteria 21843
562 Ga0500633_0205642 3300053160 Bacteria 736
563 Ga0500634_0019244 3300053161 Bacteria 3676
564 Ga0500638_011850 3300053162 Bacteria 3887
565 Ga0500638_137342 3300053162 Bacteria 1102
566 Ga0500639_000010 3300053163 Bacteria 136747
567 Ga0500576_184008 3300053725 Bacteria 733
568 Ga0500611_029668 3300053727 Bacteria 1121
569 Ga0500609_018783 3300053731 Bacteria 942
570 Ga0500596_011712 3300053735 Bacteria 1338
571 Ga0500601_001017 3300053737 Bacteria 3227
572 2513679168 2513237098 Bacteria 9902361
573 2513692678 2513237101 Bacteria 7952346
574 2524464134 2524023210 Bacteria 9029266
575 2793076604
576 2824618292 2824617872 Bacteria 8814715
577 2824627000 2824626560 Bacteria 8813858
578 2824635331 2824635225 Bacteria 8785348
579 2824644169 2824644064 Bacteria 8743947
580 2824714841 2824714736 Bacteria 8717648
581 2824724095 2824723954 Bacteria 8758240
582 2824754775 2824753945 Bacteria 9787441
583 2824764526 2824763712 Bacteria 9792355
584 2885387842 2885383462 Bacteria 9473874
585 2903771018 2903768456 Bacteria 9749579
586 2904713980 2904711408 Bacteria 9771557
587 8006984812 8006984368 Bacteria 9651211
588 8006995888 8006994254 Bacteria 8309700
589 8056685034 8056681323 Bacteria 8472857
590 Ga0068855_102417549
591 CNAas_1013747
592 JGI25153J46596_10005433
593 Ga0070676_11282344
594 Ga0070670_100148903
595 Ga0070670_101117993
596 Ga0068869_100055338
597 Ga0068869_100130186
598 Ga0070666_10904138
599 Ga0070682_100452578
600 Ga0068868_100024320
601 Ga0068868_100653397
602 Ga0068868_100868899
603 Ga0068868_101936782
604 Ga0070689_100236075
605 Ga0070689_100266556
606 Ga0070689_100683909
607 Ga0070687_100033028
608 Ga0070661_100544974
609 Ga0070692_10870087
610 Ga0070668_100006633
611 Ga0070668_100066033
612 Ga0070668_100103879
613 Ga0070668_100384106
614 Ga0070668_101055895
615 Ga0070669_100048506
616 Ga0070669_100979695
617 Ga0070675_101725967
618 Ga0070671_100298954
619 Ga0070674_100096291
620 Ga0070674_100261088
621 Ga0070674_100356545
622 Ga0070673_100974461
623 Ga0070673_101335917
624 Ga0070659_100210698
625 Ga0070667_100634838
626 Ga0070667_100745608
627 Ga0070714_100858360
628 Ga0070701_10627746
629 Ga0070705_100245062
630 Ga0070700_101127008
631 Ga0070694_100766549
632 Ga0070663_100045207
633 Ga0070663_100093985
634 Ga0070663_100562372
635 Ga0070678_100170428
636 Ga0070678_100188206
637 Ga0070678_100316856
638 Ga0070678_100433662
639 Ga0070678_100533531
640 Ga0070662_100092853
641 Ga0070662_100144688
642 Ga0070662_100289860
643 Ga0068867_100353715
644 Ga0068867_101181971
645 Ga0070685_10182969
646 Ga0070698_100205328
647 Ga0070699_100286743
648 Ga0070684_100815668
649 Ga0070684_101643644
650 Ga0068853_100082639
651 Ga0068853_100253222
652 Ga0068853_100814131
653 Ga0068853_101724731
654 Ga0070695_100390416
655 Ga0070693_100225791
656 Ga0070665_100023329
657 Ga0070665_100123653
658 Ga0070665_100414435
659 Ga0070665_100449820
660 Ga0070665_100601624
661 Ga0070665_100810131
662 Ga0070665_101157730
663 Ga0068855_102028197
664 Ga0070664_101183991
665 Ga0068857_100458179
666 Ga0068854_100236774
667 Ga0068854_101329034
668 Ga0068854_101746342
669 Ga0070702_100072301
670 Ga0070702_100089788
671 Ga0068852_100984508
672 Ga0068852_101818451
673 Ga0068859_100143379
674 Ga0068859_100437814
675 Ga0068864_100041502
676 Ga0068864_102154243
677 Ga0068866_10557969
678 Ga0068861_100059652
679 Ga0068861_100155352
680 Ga0068861_100980313
681 Ga0068851_10701824
682 Ga0068870_10085984
683 Ga0068863_100652677
684 Ga0068863_101069663
685 Ga0068863_101425702
686 Ga0068863_101820855
687 Ga0068858_100079194
688 Ga0068858_100350952
689 Ga0068860_100212986
690 Ga0068860_100431365
691 Ga0068860_100618624
692 Ga0068860_101142944
693 Ga0068860_101311976
694 Ga0068862_100060130
695 Ga0068862_100085852
696 Ga0068862_100407277
697 Ga0068862_100425814
698 Ga0068862_102074111
699 Ga0081455_10013510
700 Ga0081455_10142699
701 Ga0081455_10166290
702 Ga0081540_1002045
703 Ga0081540_1007384
704 Ga0081540_1008388
705 Ga0081539_10116473
706 Ga0075365_10007354
707 Ga0075365_10278471
708 Ga0075365_10874164
709 Ga0075368_10038412
710 Ga0075368_10079539
711 Ga0075368_10137917
712 Ga0075363_100041738
713 Ga0075363_100076365
714 Ga0075363_100366832
715 Ga0075363_100586444
716 Ga0075364_10065494
717 Ga0075364_10150100
718 Ga0075364_10592466
719 Ga0075362_10273279
720 Ga0075367_10035459
721 Ga0075367_10065534
722 Ga0075367_10178366
723 Ga0075369_10050342
724 Ga0075366_10050305
725 Ga0075366_10480349
726 Ga0097621_100251871
727 Ga0097621_100444078
728 Ga0075370_10098966
729 Ga0075370_10239878
730 Ga0075370_10334946
731 Ga0075370_10620308
732 Ga0068871_100208500
733 Ga0068871_100378223
734 Ga0075428_101291606
735 Ga0075434_100458667
736 Ga0068865_101818053
737 Ga0097620_100143388
738 Ga0097620_100437797
739 Ga0075435_100687915
740 Ga0099795_10039078
741 Ga0105250_10154915
742 Ga0105240_11260547
743 Ga0111539_10645858
744 Ga0111539_12278360
745 Ga0105245_10421603
746 Ga0105245_10463278
747 Ga0114129_10100622
748 Ga0105243_10009554
749 Ga0105243_10254663
750 Ga0105243_10731646
751 Ga0105243_11021651
752 Ga0105243_11341464
753 Ga0105243_12110827
754 Ga0105241_10618529
755 Ga0105241_12232835
756 Ga0105242_10048353
757 Ga0105242_10656637
758 Ga0105242_12112235
759 Ga0105248_10091047
760 Ga0105248_10568172
761 Ga0105248_11793730
762 Ga0105237_10379300
763 Ga0105237_10804705
764 Ga0105238_10271887
765 Ga0105238_10543432
766 Ga0105249_10066330
767 Ga0105249_10205914
768 Ga0105249_10353943
769 Ga0105249_10392609
770 Ga0105239_10162266
771 Ga0105239_10565964
772 Ga0105239_10852406
773 Ga0105246_10732227
774 Ga0157374_10473137
775 Ga0157374_11379530
776 Ga0157378_10385858
777 Ga0157378_11374974
778 Ga0163162_10147389
779 Ga0163162_10449040
780 Ga0163162_10827570
781 Ga0163162_12153927
782 Ga0163162_12347490
783 Ga0157372_10857259
784 Ga0157375_10061281
785 Ga0157375_10618427
786 Ga0163163_10344422
787 Ga0157380_10846155
788 Ga0157380_10902481
789 Ga0157380_11163306
790 Ga0157377_10223908
791 Ga0157379_10493302
792 Ga0157379_11047646
793 Ga0157379_11545605
794 Ga0157376_10083763
795 Ga0163161_10038442
796 Ga0163161_10422920
797 Ga0163161_11783901
798 Ga0209758_1029821
799 Ga0207697_10224752
800 Ga0207653_10450480
801 Ga0207642_10413721
802 Ga0207710_10138158
803 Ga0207710_10428143
804 Ga0207688_10155694
805 Ga0207688_10187782
806 Ga0207680_10138449
807 Ga0207680_10911206
808 Ga0207680_10933143
809 Ga0207643_10035204
810 Ga0207643_10306614
811 Ga0207671_10032207
812 Ga0207671_10754041
813 Ga0207662_10126207
814 Ga0207681_10040025
815 Ga0207681_11125225
816 Ga0207694_10598743
817 Ga0207650_10247261
818 Ga0207650_10382698
819 Ga0207659_10346960
820 Ga0207659_11314745
821 Ga0207687_10024608
822 Ga0207644_10483547
823 Ga0207706_10046302
824 Ga0207706_10082368
825 Ga0207706_10333396
826 Ga0207706_10349543
827 Ga0207686_10462106
828 Ga0207686_10905574
829 Ga0207709_10006210
830 Ga0207709_10491642
831 Ga0207709_10556095
832 Ga0207709_11375628
833 Ga0207670_10291902
834 Ga0207669_10105109
835 Ga0207669_10213573
836 Ga0207704_11388063
837 Ga0207691_10103097
838 Ga0207691_10332016
839 Ga0207711_10051031
840 Ga0207711_10904643
841 Ga0207711_11546022
842 Ga0207689_10110956
843 Ga0207689_10173805
844 Ga0207679_10262846
845 Ga0207651_10681648
846 Ga0207651_11564156
847 Ga0207712_10294090
848 Ga0207712_10758330
849 Ga0207668_10031568
850 Ga0207668_10598118
851 Ga0207668_10970582
852 Ga0207640_10869639
853 Ga0207658_10118116
854 Ga0207677_11357975
855 Ga0207703_10110047
856 Ga0207703_10733301
857 Ga0207639_10169569
858 Ga0207639_10252620
859 Ga0207639_10522084
860 Ga0207639_10713887
861 Ga0207678_10050170
862 Ga0207678_10226208
863 Ga0207678_10246003
864 Ga0207678_10441008
865 Ga0207678_10561262
866 Ga0207708_10071693
867 Ga0207708_10105788
868 Ga0207708_10120091
869 Ga0207708_10863787
870 Ga0207641_11443843
871 Ga0207648_10173323
872 Ga0207648_11180811
873 Ga0207676_10175875
874 Ga0207676_10623507
875 Ga0207674_10460609
876 Ga0207675_100081041
877 Ga0207675_100087811
878 Ga0207675_100391646
879 Ga0207683_10056160
880 Ga0207683_10469140
881 Ga0207698_10246337
882 Ga0209813_10146168
883 Ga0268266_10002199
884 Ga0268266_10099211
885 Ga0268266_10109899
886 Ga0268266_10945948
887 Ga0268266_10981973
888 Ga0268265_10107844
889 Ga0268265_10265796
890 Ga0268265_11756762
891 Ga0268264_10236243
892 Ga0268264_10297996
893 Ga0268264_10641345
894 Ga0268264_11585827
895 Ga0307517_10000436
896 Ga0307517_10278822
897 Ga0307517_10341114
898 Ga0307517_10666770
899 Ga0307515_10015628
900 Ga0307515_10235612
901 Ga0307515_10261754
902 Ga0265763_1048612
903 Ga0265331_10251723
904 Ga0307513_10183297
905 Ga0307513_10312785
906 Ga0307513_10503841
907 Ga0307509_10142946
908 Ga0307509_10533721
909 Ga0307408_100469580
910 Ga0307508_10156717
911 Ga0307516_10557254
912 Ga0307516_10667755
913 Ga0307405_10555219
914 Ga0307413_10331057
915 Ga0307412_10970290
916 Ga0307416_100126764
917 Ga0307416_102219618
918 Ga0307411_10184067
919 Ga0307411_10264705
920 Ga0307415_100059631
921 Ga0307415_100128905
922 Ga0307507_10190631
923 Ga0307510_10015811
924 Ga0373959_0161420
925 Ga0373944_0228084
926 Ga0373939_0221401
927 Ga0373943_0117087
928 Ga0373942_0194794
929 Ga0373931_1026585
930 Ga0373935_0652896
931 Ga0373927_0361147
932 Ga0373947_0154780
933 Ga0373947_0491687
934 Ga0373925_0011573
935 Ga0373925_0705183
936 Ga0395905_0207139
937 Ga0395905_0474405
938 Ga0451791_1289547
939 Ga0451795_0475458
940 Ga0451800_0210512
941 Ga0451849_1450693
942 Ga0439458_0123311
943 Ga0439459_0044165
944 Ga0495617_136265
945 Ga0495627_171588
946 Ga0495603_0050280
947 Ga0495603_0090017
948 Ga0495603_0352298
949 Ga0495638_0005551
950 Ga0495638_0132595
951 Ga0495638_0173532
952 Ga0495638_0239000
953 Ga0495638_0243683
954 Ga0495638_0286718
955 Ga0495638_0395366
956 Ga0495650_0192322
957 Ga0495582_0563571
958 Ga0495605_0137460
959 Ga0495605_0467130
960 Ga0495639_0276847
961 Ga0495664_0048540
962 Ga0495584_0097091
963 Ga0495584_0321710
964 Ga0495585_0134043
965 Ga0495585_0144832
966 Ga0495585_0226455
967 Ga0495594_0233909
968 Ga0495596_0177719
969 Ga0495607_0323288
970 Ga0495583_0431643
971 Ga0495606_0086378
972 Ga0495610_0013025
973 Ga0495616_0451763
974 Ga0495620_0027777
975 Ga0495620_0265067
976 Ga0495628_0406340
977 Ga0495630_0199239
978 Ga0495630_0224216
979 Ga0495631_0063305
980 Ga0495631_0532814
981 Ga0495632_0048364
982 Ga0495632_0081393
983 Ga0495632_0098496
984 Ga0495644_0017737
985 Ga0495644_0103841
986 Ga0495644_0179673
987 Ga0495648_0208640
988 Ga0495663_0051083
989 Ga0495663_0055996
990 Ga0495598_0031195
991 Ga0495598_0306483
992 Ga0495609_0068531
993 Ga0495621_0133458
994 Ga0495645_0449380
995 Ga0495622_0242127
996 Ga0495656_0008247
997 Ga0495656_0148102
998 Ga0495656_0525108
999 Ga0495668_0017565
1000 Ga0495668_0122036
1001 Ga0495668_0302963
1002 Ga0495611_0106641
1003 Ga0495611_0455187
1004 Ga0495625_0071756
1005 Ga0495635_0547363
1006 Ga0495588_0080545
1007 Ga0495669_0006054
1008 Ga0495669_0073816
1009 Ga0495669_0212148
1010 Ga0495670_0097717
1011 Ga0495589_0089162
1012 Ga0495589_0146428
1013 Ga0495581_0463860
1014 Ga0495674_0560327
1015 Ga0495672_0012352
1016 Ga0495672_0039865
1017 Ga0495672_0046432
1018 Ga0495676_0059587
1019 Ga0495683_0129686
1020 Ga0495683_0254626
1021 Ga0495683_0352251
1022 Ga0495673_0107617
1023 Ga0495681_0112430
1024 Ga0495681_0334547
1025 Ga0495686_0068809
1026 Ga0495686_0193793
1027 Ga0495615_0048519
1028 Ga0495615_0090644
1029 Ga0496100_1229867
1030 Ga0496101_0046877
1031 Ga0496102_0699694
1032 Ga0496102_0709024
1033 Ga0496102_0752342
1034 Ga0496102_0879214
1035 Ga0496103_0299812
1036 Ga0496103_0315474
1037 Ga0496103_1056226
1038 Ga0496107_0471145
1039 Ga0496107_1107495
1040 Ga0496108_0439691
1041 Ga0496108_0521527
1042 Ga0496108_0952146
1043 Ga0496109_0582545
1044 Ga0496109_1084249
1045 Ga0496110_0103637
1046 Ga0496110_0195411
1047 Ga0496111_0423183
1048 Ga0496112_0316185
1049 Ga0496113_0188070
1050 Ga0496115_0073493
1051 Ga0496115_0895957
1052 Ga0496117_0574901
1053 Ga0496118_0196553
1054 Ga0496119_0166486
1055 Ga0496119_0185773
1056 Ga0496119_0307922
1057 Ga0496121_0000571
1058 Ga0496121_0002649
1059 Ga0496121_0007595
1060 Ga0496121_0041980
1061 Ga0496121_0084695
1062 Ga0496121_0106662
1063 Ga0496121_0119637
1064 Ga0496121_0119655
1065 Ga0496121_0162547
1066 Ga0496121_0312316
1067 Ga0496124_0308054
1068 Ga0496124_0728378
1069 Ga0496125_0067360
1070 Ga0496125_0319365
1071 Ga0496126_0001525
1072 Ga0496126_0019825
1073 Ga0496126_0044158
1074 Ga0496126_0057137
1075 Ga0496126_0109337
1076 Ga0496126_0654503
1077 Ga0495682_0097071
1078 Ga0495682_0165098
1079 Ga0501040_1191949
1080 Ga0501067_0014579
1081 Ga0501067_0249526
1082 Ga0501069_0116823
1083 Ga0501079_1270762
1084 Ga0501080_1762050
1085 nmdc:mga03683_64375_c1
1086 nmdc:mga03n38_505603_c1
1087 nmdc:mga00v17_64075_c1
1088 nmdc:mga0yw44_166191_c1
1089 nmdc:mga0yw44_294743_c1
1090 nmdc:mga0yw44_457432_c1
1091 nmdc:mga0yw44_677010_c1
1092 nmdc:mga0k408_37605_c1
1093 nmdc:mga0k408_430748_c1
1094 nmdc:mga0k408_749295_c1
1095 nmdc:mga06z11_140496_c1
1096 nmdc:mga04h51_170367_c1
1097 nmdc:mga07m45_251493_c1
1098 nmdc:mga07m45_280330_c1
1099 nmdc:mga07m45_299473_c1
1100 nmdc:mga07m45_6729_c1
1101 nmdc:mga07m45_865691_c1
1102 nmdc:mga05p37_53130_c1
1103 nmdc:mga09592_277875_c1
1104 nmdc:mga08y16_270243_c1
1105 nmdc:mga0n895_197987_c1
1106 nmdc:mga0rr50_733573_c1
1107 nmdc:mga0sz30_318075_c1
1108 nmdc:mga0sz30_338751_c1
1109 nmdc:mga0sz30_90094_c2
1110 Ga0500610_0250801
1111 Ga0495655_0037670
1112 Ga0500643_024864
1113 Ga0500646_0392075
1114 Ga0500583_0066008
1115 Ga0500566_0000008
1116 Ga0500566_0364396
1117 Ga0500640_005656
1118 Ga0500641_0046900
1119 Ga0500650_0292730
1120 Ga0500650_0327376
1121 Ga0500557_242275
1122 Ga0500569_319503
1123 Ga0500572_000983
1124 Ga0500580_248451
1125 Ga0500582_046819
1126 Ga0500594_0020861
1127 Ga0500594_0030273
1128 Ga0500595_000446
1129 Ga0500595_005336
1130 Ga0500595_076220
1131 Ga0500608_005464
1132 Ga0500614_000233
1133 Ga0500655_041250
1134 Ga0500559_0003471
1135 Ga0500568_0010096
1136 Ga0500568_0106225
1137 Ga0500577_0189719
1138 Ga0500577_0234079
1139 Ga0500589_063808
1140 Ga0500589_184918
1141 Ga0500589_288744
1142 Ga0500590_016483
1143 Ga0500603_000033
1144 Ga0500606_080490
1145 Ga0500620_281899
1146 Ga0500622_0119082
1147 Ga0500622_0394894
1148 Ga0500622_0448263
1149 Ga0500627_0253280
1150 Ga0500630_000238
1151 Ga0500633_0205642
1152 Ga0500634_0019244
1153 Ga0500638_011850
1154 Ga0500638_137342
1155 Ga0500639_000010
1156 Ga0500576_184008
1157 Ga0500611_029668
1158 Ga0500609_018783
1159 Ga0500596_011712
1160 Ga0500601_001017
1161 2513679168
1162 2513692678
1163 2524464134
1164 2793076604
1165 2824618292
1166 2824627000
1167 2824635331
1168 2824644169
1169 2824714841
1170 2824724095
1171 2824754775
1172 2824764526
1173 2885387842
1174 2903771018
1175 2904713980
1176 8006984812
1177 8006995888
1178 8056685034

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map