F466844

General Info

Members Datasets Scaffolds Average Seq Length
589 460 1178 109

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10638707|Ga0081455_106387072
Length 131
Sequence MARHDMAMSAGRMVCRELERMTDVASVSVSDAAAKRISAILKSEPDKTALRISVEGGGCSGFSYKYDLVNAQDADDLVIEKLGAKVLIDAISLPYIGGSEIDFVDDLMGQSFQIRNPNATSSCGCGTSFAV

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
56 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
70 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
73 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
74 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
75 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
79 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
116 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
118 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
122 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
128 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
133 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
134 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
135 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
136 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
139 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
140 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
141 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
142 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
143 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
144 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
145 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
146 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
147 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
150 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
151 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
214 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
225 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
226 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
227 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
228 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
229 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
230 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
231 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
234 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
239 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
240 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
241 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
242 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
257 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
258 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
259 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
260 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
261 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
262 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
263 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
264 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
265 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
266 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
267 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
268 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
269 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
270 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
271 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
272 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
273 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
274 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
275 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
276 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
277 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
278 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
279 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
280 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
281 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
282 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
283 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
284 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
285 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
286 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
287 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
288 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
289 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
290 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
291 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
292 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
293 2643221557 Ensifer sp. Root558 Isolate Unclassified
294 2643221558 Rhizobium sp. Root149 Isolate Unclassified
295 2643221599 Rhizobium sp. Root708 Isolate Unclassified
296 2643221607 Rhizobium sp. Root73 Isolate Unclassified
297 2643221610 Ensifer sp. Root74 Isolate Unclassified
298 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
299 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
300 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
301 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
302 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
303 2643221668 Ensifer sp. Root423 Isolate Unclassified
304 2643221675 Ensifer sp. Root1298 Isolate Unclassified
305 2643221680 Ensifer sp. Root1312 Isolate Unclassified
306 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
307 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
308 2643221693 Rhizobium sp. Root491 Isolate Unclassified
309 2643221718 Rhizobium sp. Root268 Isolate Unclassified
310 2643221719 Rhizobium sp. Root274 Isolate Unclassified
311 2643221723 Ensifer sp. Root278 Isolate Unclassified
312 2643221726 Ensifer sp. Root954 Isolate Unclassified
313 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
314 2718217927 Rhizobium sp. N324 Isolate Nodule
315 2718218423 Rhizobium sp. N941 Isolate Nodule
316 2721755809 Rhizobium sp. N541 Isolate Nodule
317 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
318 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
319 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
320 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
321 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
322 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
323 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
324 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
325 2791355256 Rhizobium sp. M10 Isolate Nodule
326 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
327 2791355260 Rhizobium sp. L9 Isolate Nodule
328 2791355261 Rhizobium sp. J15 Isolate Nodule
329 2791355262 Rhizobium sp. M1 Isolate Nodule
330 2791355263 Rhizobium chutanense C5 Isolate Nodule
331 2791355265 Rhizobium sp. H4 Isolate Nodule
332 2791355266 Rhizobium sp. L43 Isolate Nodule
333 2791355267 Rhizobium sp. L18 Isolate Nodule
334 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
335 2802429633 Rhizobium anhuiense J3 Isolate Nodule
336 2802429637 Rhizobium anhuiense C15 Isolate Nodule
337 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
338 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
339 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
340 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
341 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
342 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
343 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
344 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
345 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
346 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
347 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
348 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
349 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
350 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
351 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
352 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
353 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
354 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
355 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
356 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
357 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
358 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
359 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
360 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
361 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
362 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
363 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
364 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
365 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
366 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
367 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
368 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
369 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
370 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
371 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
372 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
373 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
374 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
375 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
376 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
377 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
378 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
379 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
380 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
381 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
382 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
383 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
384 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
385 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
386 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
387 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
388 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
389 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
390 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
391 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
392 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
393 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
394 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
395 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
396 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
397 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
398 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
399 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
400 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
401 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
402 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
403 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
404 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
405 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
406 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
407 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
408 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
409 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
410 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
411 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
412 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
413 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
414 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
415 2936381700 Rhizobium chutanense C16 Isolate Unclassified
416 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
417 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
418 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
419 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
420 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
421 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
422 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
423 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
424 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
425 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
426 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
427 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
428 2996887358 Rhizobium sp. R711 Isolate Nodule
429 2996893221 Rhizobium sp. R635 Isolate Nodule
430 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
431 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
432 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
433 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
434 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
435 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
436 8005258706 Rhizobium sp. R693 Isolate Nodule
437 8005275841 Rhizobium sp. N4311 Isolate Nodule
438 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
439 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
440 8005321885 Rhizobium sp. R72 Isolate Nodule
441 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
442 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
443 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
444 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
445 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
446 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
447 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
448 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
449 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
450 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
451 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
452 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
453 8024501048 Rhizobium sp. H4 Isolate Nodule
454 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
455 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
456 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
457 8056382006 Rhizobium croatiense 13T Isolate Nodule
458 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
459 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
460 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 61.63
Metatranscriptomes 3.57
Isolates 34.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.68
Bulb 0
Endosphere 21.9
Nodule 20.2
Rhizoplane 2.72
Rhizosphere 31.58
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10638707 3300005937 Bacteria 687
2 JGI25155J39150_1000011 3300002704 Bacteria 207685
3 JGI25156J39149_1000027 3300002705 Bacteria 127396
4 JGI25162J39368_1000963 3300002737 Bacteria 18339
5 JGI25154J39366_1000181 3300002738 Bacteria 49117
6 JGI25157J39369_1000010 3300002741 Bacteria 207685
7 JGI25159J45721_1000006 3300002987 Bacteria 188201
8 JGI25159J45721_1002092 3300002987 Bacteria 7840
9 JGI25151J46595_10000326 3300003187 Bacteria 51646
10 JGI25151J46595_10002380 3300003187 Bacteria 11407
11 JGI25151J46595_10018050 3300003187 Bacteria 3042
12 JGI25151J46595_10026360 3300003187 Bacteria 2346
13 JGI25165J46597_1000900 3300003214 Bacteria 20669
14 JGI25165J46597_1000920 3300003214 Bacteria 20377
15 JGI25165J46597_1001027 3300003214 Bacteria 18335
16 JGI25153J46596_10102139 3300003215 Bacteria 673
17 rootH1_10012915 3300003316 Bacteria 6044
18 rootL2_10018543 3300003322 Bacteria 7640
19 JGI25160J50197_1000004 3300003354 Bacteria 419797
20 JGI25160J50197_1000019 3300003354 Bacteria 233980
21 JGI25161J50226_1000003 3300003374 Bacteria 413345
22 JGI25161J50226_1000467 3300003374 Bacteria 18513
23 Ga0006562J51391_1008590 3300003578 Bacteria 660
24 Ga0006562J51391_1053935 3300003578 Bacteria 527
25 Ga0055539_1004307 3300003752 Bacteria 1900
26 Ga0055526_1000462 3300003771 Bacteria 32312
27 Ga0055524_1035440 3300003775 Bacteria 1361
28 Ga0055536_1002723 3300003781 Bacteria 9796
29 Ga0055530_10011193 3300003791 Bacteria 3243
30 Ga0055540_1002665 3300003792 Bacteria 9227
31 Ga0055540_1014671 3300003792 Bacteria 2322
32 Ga0055531_10002882 3300003794 Bacteria 11201
33 Ga0055531_10003417 3300003794 Bacteria 10139
34 Ga0055531_10075107 3300003794 Bacteria 764
35 Ga0058692_1002873 3300003856 Bacteria 5604
36 Ga0058692_1039309 3300003856 Bacteria 839
37 Ga0055543_1000001 3300004625 Bacteria 419949
38 Ga0055543_1000275 3300004625 Bacteria 38327
39 Ga0065165_1000149 3300005262 Bacteria 122370
40 Ga0065165_1000272 3300005262 Bacteria 88086
41 Ga0065704_10206666 3300005289 Bacteria 1124
42 Ga0070669_100490185 3300005353 Bacteria 1018
43 Ga0070678_100546319 3300005456 Bacteria 1028
44 Ga0070707_101166976 3300005468 Bacteria 736
45 Ga0068853_101803677 3300005539 Bacteria 593
46 Ga0070672_100618594 3300005543 Bacteria 944
47 Ga0070665_100025262 3300005548 Bacteria 5986
48 Ga0070665_100040711 3300005548 Bacteria 4670
49 Ga0068856_100389696 3300005614 Bacteria 1413
50 Ga0068852_100040901 3300005616 Bacteria 3915
51 Ga0068866_11388406 3300005718 Unclassified 513
52 Ga0068861_100464409 3300005719 Bacteria 1137
53 Ga0068851_10072973 3300005834 Bacteria 1779
54 Ga0068858_101561116 3300005842 Unclassified 651
55 Ga0081455_10965889 3300005937 Bacteria 528
56 Ga0075365_10135802 3300006038 Bacteria 1704
57 Ga0075365_10432131 3300006038 Bacteria 930
58 Ga0075368_10151362 3300006042 Bacteria 969
59 Ga0075368_10542853 3300006042 Bacteria 522
60 Ga0075363_100012575 3300006048 Bacteria 4084
61 Ga0075364_10001918 3300006051 Bacteria 11579
62 Ga0075364_10402263 3300006051 Bacteria 934
63 Ga0075362_10100273 3300006177 Bacteria 1353
64 Ga0075367_10006256 3300006178 Bacteria 6000
65 Ga0075367_10345775 3300006178 Bacteria 938
66 Ga0075370_10014017 3300006353 Bacteria 4269
67 Ga0075370_10028124 3300006353 Bacteria 3124
68 Ga0075370_10436392 3300006353 Bacteria 787
69 Ga0079104_1000129 3300006946 Bacteria 108427
70 Ga0099826_10002926 3300006948 Bacteria 11342
71 Ga0099826_10023176 3300006948 Bacteria 4631
72 Ga0105240_10000005 3300009093 Bacteria 702630
73 Ga0105247_10137204 3300009101 Bacteria 1599
74 Ga0105243_10005858 3300009148 Bacteria 9526
75 Ga0105242_12822471 3300009176 Unclassified 536
76 Ga0105248_10764104 3300009177 Bacteria 1091
77 Ga0105237_10001991 3300009545 Bacteria 25984
78 Ga0105249_12185818 3300009553 Bacteria 626
79 Ga0105249_12194975 3300009553 Bacteria 625
80 Ga0123341_1000001 3300009765 Bacteria 314908
81 Ga0123342_1023582 3300009766 Bacteria 3969
82 Ga0105239_10003100 3300010375 Bacteria 20616
83 Ga0105246_10665759 3300011119 Bacteria 908
84 Ga0157319_1004456 3300012497 Bacteria 922
85 Ga0157373_10005196 3300013100 Bacteria 9780
86 Ga0157371_10000015 3300013102 Bacteria 339838
87 Ga0157370_10000309 3300013104 Bacteria 61167
88 Ga0157370_10000665 3300013104 Bacteria 42812
89 Ga0157369_10281895 3300013105 Bacteria 1730
90 Ga0157369_10398896 3300013105 Bacteria 1427
91 Ga0157369_10415738 3300013105 Bacteria 1394
92 Ga0171463_1011 3300013249 Bacteria 230603
93 Ga0163162_10848509 3300013306 Bacteria 1029
94 Ga0157372_10567411 3300013307 Bacteria 1323
95 Ga0157372_10985243 3300013307 Bacteria 977
96 Ga0182007_10000998 3300015262 Bacteria 15523
97 Ga0182005_1009577 3300015265 Bacteria 2814
98 Ga0183363_1143 3300015690 Bacteria 17948
99 Ga0206349_1725640 3300020075 Bacteria 534
100 Ga0154015_1207814 3300020610 Bacteria 535
101 Ga0228711_1000528 3300022739 Bacteria 47804
102 Ga0228710_1000006 3300022740 Bacteria 209134
103 Ga0209435_100022 3300025206 Bacteria 207766
104 Ga0209436_100390 3300025208 Bacteria 19835
105 Ga0209672_101326 3300025228 Bacteria 9432
106 Ga0209672_115196 3300025228 Bacteria 868
107 Ga0209437_100153 3300025233 Bacteria 154068
108 Ga0209437_100201 3300025233 Bacteria 119080
109 Ga0209437_108911 3300025233 Bacteria 1587
110 Ga0207425_1014295 3300025245 Bacteria 1805
111 Ga0207425_1037107 3300025245 Bacteria 942
112 Ga0207425_1074758 3300025245 Bacteria 574
113 Ga0209646_1000078 3300025246 Bacteria 207766
114 Ga0209026_1000065 3300025250 Bacteria 207766
115 Ga0209026_1054798 3300025250 Bacteria 565
116 Ga0209677_101154 3300025253 Bacteria 12276
117 Ga0209148_1015119 3300025254 Bacteria 1355
118 Ga0209759_1000055 3300025256 Bacteria 207766
119 Ga0209759_1026496 3300025256 Bacteria 1214
120 Ga0209129_1000470 3300025258 Bacteria 29594
121 Ga0209129_1013211 3300025258 Bacteria 1834
122 Ga0209129_1054669 3300025258 Bacteria 602
123 Ga0209233_1000175 3300025261 Bacteria 144221
124 Ga0209233_1000226 3300025261 Bacteria 103045
125 Ga0209233_1000248 3300025261 Bacteria 87812
126 Ga0209455_1027369 3300025272 Bacteria 1011
127 Ga0209455_1028396 3300025272 Bacteria 979
128 Ga0209673_1003247 3300025273 Bacteria 9822
129 Ga0209130_1000007 3300025284 Bacteria 591584
130 Ga0209130_1000012 3300025284 Bacteria 421329
131 Ga0209676_1002948 3300025292 Bacteria 11110
132 Ga0209025_1000033 3300025294 Bacteria 414511
133 Ga0209025_1000097 3300025294 Bacteria 236632
134 Ga0209025_1000702 3300025294 Bacteria 57061
135 Ga0209025_1011412 3300025294 Bacteria 5858
136 Ga0209025_1039084 3300025294 Bacteria 2076
137 Ga0209025_1083402 3300025294 Bacteria 1075
138 Ga0209025_1099196 3300025294 Bacteria 927
139 Ga0209564_1000740 3300025295 Bacteria 46349
140 Ga0209758_1000520 3300025297 Bacteria 61722
141 Ga0209758_1001887 3300025297 Bacteria 22869
142 Ga0209758_1019549 3300025297 Bacteria 3260
143 Ga0209050_1004383 3300025298 Bacteria 9579
144 Ga0209256_1000319 3300025299 Bacteria 82827
145 Ga0209256_1002545 3300025299 Bacteria 14596
146 Ga0207426_1000010 3300025302 Bacteria 796003
147 Ga0207426_1000111 3300025302 Bacteria 234032
148 Ga0209051_1000166 3300025303 Bacteria 120265
149 Ga0209051_1003640 3300025303 Bacteria 9983
150 Ga0209051_1107050 3300025303 Bacteria 738
151 Ga0209257_1001307 3300025304 Bacteria 30337
152 Ga0209257_1003894 3300025304 Bacteria 12172
153 Ga0209257_1005270 3300025304 Bacteria 9217
154 Ga0207656_10034847 3300025321 Bacteria 2104
155 Ga0207695_10000011 3300025913 Bacteria 910221
156 Ga0207671_10000276 3300025914 Bacteria 76490
157 Ga0207646_11254035 3300025922 Bacteria 649
158 Ga0207681_10445217 3300025923 Bacteria 1053
159 Ga0207694_10671638 3300025924 Bacteria 873
160 Ga0207700_11365004 3300025928 Bacteria 631
161 Ga0207709_11096273 3300025935 Bacteria 654
162 Ga0207691_10385241 3300025940 Bacteria 1197
163 Ga0207711_10560539 3300025941 Bacteria 1066
164 Ga0207712_11398552 3300025961 Bacteria 626
165 Ga0207668_10275568 3300025972 Bacteria 1377
166 Ga0207640_10060572 3300025981 Bacteria 2503
167 Ga0207703_11360423 3300026035 Bacteria 683
168 Ga0207639_11603234 3300026041 Bacteria 610
169 Ga0207702_10100675 3300026078 Bacteria 2550
170 Ga0207698_10095170 3300026142 Bacteria 2451
171 Ga0209281_1000036 3300027111 Bacteria 369415
172 Ga0209281_1000047 3300027111 Bacteria 326514
173 Ga0209281_1000268 3300027111 Bacteria 100508
174 Ga0209371_1000178 3300027312 Bacteria 93894
175 Ga0209371_1000382 3300027312 Bacteria 47344
176 Ga0209371_1001444 3300027312 Bacteria 16135
177 Ga0209371_1002027 3300027312 Bacteria 12116
178 Ga0209282_1000026 3300027666 Bacteria 166272
179 Ga0209282_1000095 3300027666 Bacteria 60099
180 Ga0209282_1079392 3300027666 Bacteria 1757
181 Ga0209813_10005272 3300027866 Bacteria 3129
182 Ga0268266_10025145 3300028379 Bacteria 5068
183 Ga0268266_10030382 3300028379 Bacteria 4590
184 Ga0268266_10598234 3300028379 Bacteria 1059
185 Ga0307515_10000656 3300028794 Bacteria 79816
186 Ga0268256_1000837 3300030500 Bacteria 21879
187 Ga0268256_1002533 3300030500 Bacteria 9201
188 Ga0268256_1014606 3300030500 Bacteria 2321
189 Ga0316182_1300461 3300030745 Bacteria 964
190 Ga0307408_101033425 3300031548 Bacteria 759
191 Ga0307407_10662959 3300031903 Bacteria 783
192 Ga0315914_1000008 3300031967 Bacteria 209133
193 Ga0307409_100896747 3300031995 Bacteria 900
194 Ga0315913_1000137 3300033430 Bacteria 47802
195 Ga0315915_1000014 3300033464 Bacteria 171068
196 Ga0373927_0002192 3300035695 Bacteria 14352
197 Ga0373925_0016473 3300037068 Bacteria 5355
198 Ga0436360_0816593 3300039438 Bacteria 1456
199 Ga0439438_068707 3300041405 Bacteria 879
200 Ga0439466_0062925 3300041411 Bacteria 1192
201 Ga0439465_0380175 3300041413 Bacteria 536
202 Ga0451795_0672550 3300041456 Bacteria 805
203 Ga0451798_0357052 3300041458 Bacteria 529
204 Ga0451807_0617558 3300041486 Bacteria 846
205 Ga0451833_0164686 3300041491 Bacteria 1235
206 Ga0451835_0501641 3300041492 Bacteria 1407
207 Ga0451837_0609112 3300041494 Bacteria 588
208 Ga0451841_1387287 3300041498 Bacteria 2352
209 Ga0451845_0265737 3300041501 Bacteria 919
210 Ga0451846_44962 3300041502 Bacteria 1013
211 Ga0451850_24435 3300041506 Bacteria 1617
212 Ga0451851_0456096 3300041507 Bacteria 785
213 Ga0451843_0429565 3300041509 Bacteria 3247
214 Ga0451855_0262920 3300041511 Bacteria 1387
215 Ga0451853_0932150 3300041512 Bacteria 2858
216 Ga0452271_23420 3300041916 Bacteria 1167
217 Ga0439433_0039980 3300041999 Bacteria 1090
218 Ga0439449_0152855 3300042007 Bacteria 861
219 Ga0466966_0512868 3300044684 Bacteria 721
220 Ga0466963_0271616 3300044694 Bacteria 1191
221 Ga0466968_0067578 3300044735 Bacteria 1550
222 Ga0466970_0004213 3300044765 Bacteria 7078
223 Ga0466970_0096626 3300044765 Bacteria 1607
224 Ga0466960_0069638 3300044901 Bacteria 1748
225 Ga0466958_0622491 3300045836 Bacteria 702
226 Ga0466967_0976422 3300045976 Bacteria 843
227 Ga0495629_0039145 3300046459 Bacteria 3337
228 Ga0495638_0082374 3300046460 Bacteria 1951
229 Ga0495651_0043436 3300046462 Bacteria 3488
230 Ga0495653_0368417 3300046463 Bacteria 920
231 Ga0495639_0088449 3300046475 Bacteria 1451
232 Ga0495662_0032625 3300046476 Bacteria 2516
233 Ga0495585_0056387 3300046492 Bacteria 2170
234 Ga0495585_0162551 3300046492 Bacteria 1158
235 Ga0495606_0144680 3300046507 Bacteria 1401
236 Ga0495618_0186173 3300046514 Bacteria 1318
237 Ga0495628_0045009 3300046516 Bacteria 3510
238 Ga0495666_0092263 3300046526 Bacteria 1429
239 Ga0495640_0092724 3300046533 Bacteria 1992
240 Ga0495622_0012582 3300046557 Bacteria 3921
241 Ga0495633_0021766 3300046558 Bacteria 3202
242 Ga0495633_0183359 3300046558 Bacteria 963
243 Ga0495656_0643419 3300046615 Bacteria 569
244 Ga0495634_0575656 3300046642 Bacteria 655
245 Ga0495625_0243184 3300046660 Bacteria 1171
246 Ga0495635_0090827 3300046663 Bacteria 2089
247 Ga0495661_0422501 3300046665 Bacteria 645
248 Ga0495588_0001225 3300046674 Bacteria 11061
249 Ga0495657_0041037 3300046675 Bacteria 3170
250 Ga0495658_0029296 3300046683 Bacteria 2979
251 Ga0495613_0756144 3300046689 Bacteria 637
252 Ga0495600_0131859 3300046809 Bacteria 1624
253 Ga0495604_0058840 3300047317 Bacteria 2949
254 Ga0495676_0382676 3300047321 Bacteria 936
255 Ga0495683_0284816 3300047323 Bacteria 714
256 Ga0495681_0042887 3300047470 Bacteria 2186
257 Ga0495686_0070708 3300047472 Bacteria 2150
258 Ga0495686_0151862 3300047472 Bacteria 1359
259 Ga0495602_0816187 3300048088 Bacteria 625
260 Ga0496103_0005774 3300048906 Bacteria 7388
261 Ga0496104_0827853 3300048907 Bacteria 831
262 Ga0496112_0632430 3300048915 Bacteria 1001
263 Ga0496113_0074829 3300048916 Bacteria 2583
264 Ga0496114_0445459 3300048917 Bacteria 1147
265 Ga0496116_0000061 3300048919 Bacteria 271860
266 Ga0496116_0013279 3300048919 Bacteria 6658
267 Ga0496116_0045233 3300048919 Bacteria 2982
268 Ga0496116_0282763 3300048919 Bacteria 802
269 Ga0496117_0000002 3300048920 Bacteria 2483758
270 Ga0496117_0001684 3300048920 Bacteria 30795
271 Ga0496117_0033913 3300048920 Bacteria 3854
272 Ga0496117_0251379 3300048920 Bacteria 964
273 Ga0496118_0000460 3300048921 Bacteria 67445
274 Ga0496118_0000756 3300048921 Bacteria 52299
275 Ga0496118_0044985 3300048921 Bacteria 3451
276 Ga0496118_0045994 3300048921 Bacteria 3400
277 Ga0496118_0073755 3300048921 Bacteria 2443
278 Ga0496119_0009961 3300048922 Bacteria 8058
279 Ga0496119_0021313 3300048922 Bacteria 4689
280 Ga0496120_0000078 3300048923 Bacteria 162312
281 Ga0496120_0005495 3300048923 Bacteria 10088
282 Ga0496120_0027751 3300048923 Bacteria 3477
283 Ga0496120_0436944 3300048923 Bacteria 572
284 Ga0496120_0505738 3300048923 Bacteria 518
285 Ga0496121_0000001 3300048924 Bacteria 1830318
286 Ga0496121_0001247 3300048924 Bacteria 44170
287 Ga0496121_0038531 3300048924 Bacteria 4229
288 Ga0496121_0152962 3300048924 Bacteria 1695
289 Ga0496121_0306688 3300048924 Bacteria 1075
290 Ga0496121_0491537 3300048924 Bacteria 781
291 Ga0496121_0501856 3300048924 Bacteria 770
292 Ga0496122_0000001 3300048925 Bacteria 1827766
293 Ga0496122_0012559 3300048925 Bacteria 8410
294 Ga0496122_0013836 3300048925 Bacteria 7856
295 Ga0496122_0031709 3300048925 Bacteria 4389
296 Ga0496122_0037942 3300048925 Bacteria 3868
297 Ga0496122_0088691 3300048925 Bacteria 2118
298 Ga0496122_0236302 3300048925 Bacteria 1034
299 Ga0496122_0616777 3300048925 Bacteria 504
300 Ga0496123_0000001 3300048926 Bacteria 1831497
301 Ga0496123_0012058 3300048926 Bacteria 7411
302 Ga0496123_0151979 3300048926 Bacteria 1247
303 Ga0496123_0174681 3300048926 Bacteria 1129
304 Ga0496123_0199911 3300048926 Bacteria 1025
305 Ga0496123_0376627 3300048926 Bacteria 652
306 Ga0496124_0000112 3300048927 Bacteria 166282
307 Ga0496124_0015634 3300048927 Bacteria 7264
308 Ga0496124_0029389 3300048927 Bacteria 4899
309 Ga0496124_0070150 3300048927 Bacteria 2908
310 Ga0496124_0154215 3300048927 Bacteria 1798
311 Ga0496124_0290244 3300048927 Bacteria 1187
312 Ga0496125_0000001 3300048928 Bacteria 1766138
313 Ga0496125_0028452 3300048928 Bacteria 5048
314 Ga0496125_0203684 3300048928 Bacteria 1292
315 Ga0496126_0000397 3300048929 Bacteria 89305
316 Ga0496126_0052378 3300048929 Bacteria 3710
317 Ga0496126_0099260 3300048929 Bacteria 2550
318 Ga0501034_0027452 3300049571 Bacteria 5791
319 Ga0501034_0248837 3300049571 Bacteria 1722
320 Ga0501038_0852827 3300049574 Bacteria 674
321 Ga0501041_0282908 3300049577 Bacteria 1044
322 Ga0501075_0540134 3300049591 Bacteria 890
323 Ga0501076_0374757 3300049592 Bacteria 1170
324 Ga0501077_0820847 3300049593 Bacteria 598
325 Ga0501238_076260 3300049671 Bacteria 525
326 Ga0501081_0125733 3300049743 Bacteria 1829
327 Ga0501280_005471 3300049776 Bacteria 1815
328 nmdc:mga03683_10679_c1 3300050489 Bacteria 3299
329 nmdc:mga03n38_73294_c1 3300050490 Bacteria 1590
330 nmdc:mga00v17_153564_c1 3300050491 Bacteria 1480
331 nmdc:mga00v17_444949_c1 3300050491 Bacteria 841
332 nmdc:mga00v17_80_c1 3300050491 Bacteria 58183
333 nmdc:mga0yw44_323535_c1 3300050492 Bacteria 1036
334 nmdc:mga0yw44_391458_c1 3300050492 Bacteria 939
335 nmdc:mga0yw44_45095_c1 3300050492 Bacteria 2641
336 nmdc:mga0k408_114871_c1 3300050493 Bacteria 1224
337 nmdc:mga0k408_555272_c1 3300050493 Bacteria 679
338 nmdc:mga0k408_643689_c1 3300050493 Bacteria 624
339 nmdc:mga06z11_248270_c1 3300050494 Bacteria 1047
340 nmdc:mga06z11_411576_c1 3300050494 Bacteria 815
341 nmdc:mga04h51_105456_c1 3300050495 Bacteria 1033
342 nmdc:mga07m45_187475_c1 3300050496 Bacteria 1203
343 nmdc:mga07m45_297585_c1 3300050496 Bacteria 939
344 nmdc:mga0sz30_198681_c1 3300050516 Bacteria 890
345 nmdc:mga0sz30_8434_c1 3300050516 Bacteria 3893
346 Ga0495619_0179729 3300053085 Bacteria 1464
347 Ga0500644_0052166 3300053088 Bacteria 1407
348 Ga0500646_0332894 3300053090 Bacteria 550
349 Ga0500560_067141 3300053107 Bacteria 1177
350 Ga0500607_189560 3300053121 Bacteria 900
351 Ga0500608_021456 3300053122 Bacteria 2985
352 Ga0500614_174722 3300053123 Bacteria 655
353 Ga0500618_000510 3300053125 Bacteria 24654
354 Ga0500561_0000062 3300053137 Bacteria 21493
355 Ga0500568_0041443 3300053139 Bacteria 1850
356 Ga0500573_0003702 3300053140 Bacteria 7954
357 Ga0500590_014477 3300053148 Bacteria 4066
358 Ga0500616_0000647 3300053153 Bacteria 41713
359 Ga0500616_0073580 3300053153 Bacteria 1734
360 Ga0500619_215789 3300053154 Bacteria 640
361 Ga0500622_0000158 3300053156 Bacteria 71215
362 Ga0500624_000357 3300053157 Bacteria 14815
363 Ga0500627_0004905 3300053158 Bacteria 4371
364 Ga0500627_0092249 3300053158 Bacteria 1356
365 Ga0500627_0112499 3300053158 Bacteria 1226
366 Ga0500634_0054472 3300053161 Bacteria 2143
367 Ga0500636_0000019 3300053177 Bacteria 105042
368 Ga0500636_0001577 3300053177 Bacteria 12406
369 Ga0500636_0349540 3300053177 Bacteria 706
370 Ga0587073_0123744 3300059492 Bacteria 701
371 Ga0587073_0168309 3300059492 Bacteria 634
372 Ga0587080_021315 3300059503 Bacteria 1065
373 Ga0587082_095103 3300059504 Bacteria 641
374 Ga0587086_097385 3300059507 Bacteria 538
375 Ga0587088_010730 3300059508 Bacteria 1349
376 Ga0587089_101380 3300059509 Bacteria 523
377 Ga0587099_002533 3300059622 Bacteria 1448
378 Ga0587068_150723 3300059641 Bacteria 526
379 Ga0587069_028962 3300059642 Bacteria 883
380 Ga0587075_125420 3300059644 Bacteria 535
381 Ga0587076_081239 3300059645 Bacteria 692
382 Ga0587071_151812 3300060344 Bacteria 576
383 Ga0587111_0207985 3300060346 Bacteria 558
384 Ga0501082_0469705 3300060353 Bacteria 1099
385 2509442688 2509276033 Bacteria 7180565
386 2510132767 2510065019 Bacteria 6903379
387 2511132482 2510917022 Bacteria 6504556
388 2511391417 2511231027 Bacteria 5013807
389 2513632908 2513237093 Bacteria 7545552
390 2513710360 2513237103 Bacteria 7647401
391 2515111712 2515075009 Bacteria 7288508
392 2515634798 2515154113 Bacteria 7807172
393 2517040404 2516653077 Bacteria 7555578
394 2517094475 2517093000 Bacteria 7412387
395 2524461303 2524023209 Bacteria 6679728
396 2530645005 2529292951 Bacteria 6916614
397 2537875957 2537561587 Bacteria 5425293
398 2554247787 2554235003 Bacteria 5877155
399 2559294920 2558860242 Bacteria 5568029
400 2561468944 2558860983 Bacteria 4133860
401 2585168363 2582581283 Bacteria 6030556
402 2585232503 2582581299 Bacteria 6518058
403 2585272907 2582581307 Bacteria 6597605
404 2585276841 2582581308 Bacteria 7413247
405 2585324160 2582581315 Bacteria 7318924
406 2585333447 2582581316 Bacteria 7774528
407 2585534856 2585427527 Bacteria 7273426
408 2585540250 2585427528 Bacteria 6842387
409 2585551699 2585427530 Bacteria 7383882
410 2585558185 2585427531 Bacteria 6992870
411 2585838448 2585427593 Bacteria 7141551
412 2585897579 2585427608 Bacteria 6544331
413 2585904827 2585427609 Bacteria 6667127
414 2587980057 2585428125 Bacteria 6662905
415 2599604181 2599185210 Bacteria 5624189
416 2600192390 2599185352 Bacteria 7228948
417 2601608026 2600255279 Bacteria 5605316
418 2601744801 2600255308 Bacteria 5611129
419 2616308214 2615840626 Bacteria 7921970
420 2616556764 2615840698 Bacteria 7319877
421 2617381569 2617270742 Bacteria 6808054
422 2643808471 2643221557 Bacteria 7184309
423 2643812134 2643221558 Bacteria 5460675
424 2644005979 2643221599 Bacteria 6292121
425 2644049499 2643221607 Bacteria 6314006
426 2644066436 2643221610 Bacteria 7480339
427 2644193196 2643221634 Bacteria 6705461
428 2644204093 2643221636 Bacteria 6583769
429 2644210998 2643221637 Bacteria 5345260
430 2644238198 2643221643 Bacteria 5749658
431 2644300216 2643221653 Bacteria 4569637
432 2644378024 2643221668 Bacteria 7306521
433 2644415351 2643221675 Bacteria 7473456
434 2644450248 2643221680 Bacteria 7473610
435 2644482533 2643221686 Bacteria 6310811
436 2644499036 2643221689 Bacteria 6042950
437 2644522313 2643221693 Bacteria 5513853
438 2644654653 2643221718 Bacteria 5345506
439 2644658442 2643221719 Bacteria 4568197
440 2644677965 2643221723 Bacteria 7095460
441 2644687800 2643221726 Bacteria 7455827
442 2671115611 2667528174 Bacteria 6435400
443 2719385259 2718217927 Bacteria 6972593
444 2721398980 2718218423 Bacteria 6438183
445 2724037793 2721755809 Bacteria 6438790
446 2725951731 2724679232 Bacteria 7646494
447 2757569988 2757320392 Bacteria 3737298
448 2765465060 2765235802 Bacteria 5618596
449 2766068046 2765235942 Bacteria 7445910
450 2770198227 2767802442 Bacteria 5747986
451 2776271165 2775506902 Bacteria 6208009
452 2776280838 2775506904 Bacteria 5954060
453 2778176356 2775507266 Bacteria 7392367
454 2793297033 2791355256 Bacteria 6798008
455 2793315605 2791355259 Bacteria 7254731
456 2793321359 2791355260 Bacteria 6598818
457 2793330008 2791355261 Bacteria 6661293
458 2793335227 2791355262 Bacteria 6774204
459 2793342699 2791355263 Bacteria 6872478
460 2793352138 2791355265 Bacteria 6539969
461 2793360500 2791355266 Bacteria 7116587
462 2793366287 2791355267 Bacteria 7222458
463 2805930056 2802429605 Bacteria 6875453
464 2806045652 2802429633 Bacteria 7341974
465 2806072879 2802429637 Bacteria 7067217
466 2808985310 2808606387 Bacteria 5697198
467 2819242167 2818991272 Bacteria 4622173
468 2819559743 2818991439 Bacteria 6907412
469 2819610526 2818991448 Bacteria 6772224
470 2819638273 2818991453 Bacteria 7181617
471 2837683120 2837678835 Bacteria 5252418
472 2838022694 2838022645 Bacteria 6494267
473 2838032299 2838029111 Bacteria 6603031
474 2838047687 2838042994 Bacteria 6046894
475 2838676154 2838675328 Bacteria 4909118
476 2838682761 2838680041 Bacteria 6545511
477 2838697395 2838694306 Bacteria 6853137
478 2838709427 2838707686 Bacteria 6619912
479 2838715036 2838714209 Bacteria 5525906
480 2838721164 2838719591 Bacteria 5523910
481 2838725795 2838724970 Bacteria 4908691
482 2839994998 2839993093 Bacteria 5512535
483 2840767887 2840764183 Bacteria 6358399
484 2841848121 2841846520 Bacteria 5345850
485 2841859328 2841859092 Bacteria 5436171
486 2841865067 2841864319 Bacteria 6742987
487 2842077538 2842077413 Bacteria 6508645
488 2842111058 2842110456 Bacteria 7656360
489 2842119953 2842118031 Bacteria 7033875
490 2842125849 2842124991 Bacteria 5346824
491 2842131048 2842130223 Bacteria 4909145
492 2842153782 2842152218 Bacteria 4908957
493 2842171279 2842170452 Bacteria 5525737
494 2842177402 2842175837 Bacteria 4908771
495 2842188144 2842187318 Bacteria 5524014
496 2842201479 2842198810 Bacteria 6608673
497 2842206575 2842205361 Bacteria 6340321
498 2842212455 2842211629 Bacteria 5523832
499 2842220470 2842217011 Bacteria 7497767
500 2842225926 2842224351 Bacteria 5524473
501 2842238840 2842237096 Bacteria 6620661
502 2842280032 2842278818 Bacteria 6340002
503 2842287661 2842285085 Bacteria 6011953
504 2842291200 2842291075 Bacteria 7076806
505 2842302893 2842298080 Bacteria 6123127
506 2842318419 2842317721 Bacteria 6793725
507 2842347060 2842341865 Bacteria 7003929
508 2842362569 2842357229 Bacteria 6485165
509 2842366892 2842363717 Bacteria 6844742
510 2842373391 2842370503 Bacteria 7038661
511 2842377596 2842377471 Bacteria 7140707
512 2842386463 2842384541 Bacteria 7057858
513 2842399652 2842395702 Bacteria 6780583
514 2842404810 2842402390 Bacteria 6681310
515 2842411393 2842409023 Bacteria 6687331
516 2842418156 2842415677 Bacteria 6596907
517 2842479072 2842475841 Bacteria 6603183
518 2842500606 2842495871 Bacteria 6820686
519 2842506208 2842502639 Bacteria 6604161
520 2842510085 2842509118 Bacteria 6850950
521 2842516112 2842515876 Bacteria 5436280
522 2852389475 2852387548 Bacteria 8025568
523 2857523038 2857516855 Bacteria 7787325
524 2894656441 2894652903 Bacteria 4587256
525 2896387049 2896384573 Bacteria 7700774
526 2899794198 2899792073 Bacteria 4926588
527 2899807416 2899803654 Bacteria 5577784
528 2899846503 2899845264 Bacteria 5672268
529 2904581044 2904578770 Bacteria 5302906
530 2917556863 2917554339 Bacteria 4987857
531 2919115127 2919114240 Bacteria 5700270
532 2919121163 2919119836 Bacteria 5208557
533 2919409659 2919408235 Bacteria 6149349
534 2920824280 2920822456 Bacteria 6897201
535 2926756172 2926754445 Bacteria 5964435
536 2926760404 2926760298 Bacteria 5505990
537 2928523505 2928521798 Bacteria 4960112
538 2929139803 2929138655 Bacteria 5810547
539 2933008428 2933006813 Bacteria 4912075
540 2933013244 2933011516 Bacteria 5439334
541 2933587083 2933586486 Bacteria 7667493
542 2933597933 2933594066 Bacteria 5594265
543 2935900471 2935894831 Bacteria 6620579
544 2936384697 2936381700 Bacteria 7006523
545 2937846093 2937843397 Bacteria 5256375
546 2941499765 2941499720 Bacteria 7599444
547 2954015786 2954011201 Bacteria 4762601
548 2979094321 2979089926 Bacteria 5670289
549 2979098298 2979095461 Bacteria 5669583
550 2979103554 2979100975 Bacteria 5423623
551 2984511878 2984509177 Bacteria 5274802
552 2984521762 2984518228 Bacteria 5277463
553 2984541059 2984537506 Bacteria 5277481
554 2984603340 2984601300 Bacteria 5455244
555 2989776084 2989771324 Bacteria 5605128
556 2989778556 2989776772 Bacteria 4843317
557 2996892325 2996887358 Bacteria 5795980
558 2996893909 2996893221 Bacteria 5823108
559 3002144158 3002141150 Bacteria 5254435
560 3003933284 3003930520 Bacteria 5667563
561 3005453826 3005452660 Bacteria 5889319
562 639647921 639633055 Bacteria 7751309
563 650740176 650716007 Bacteria 5573770
564 8002285586 8002285264 Bacteria 6717907
565 8005259607 8005258706 Bacteria 6184835
566 8005280065 8005275841 Bacteria 6929066
567 8005294643 8005289223 Bacteria 6634003
568 8005307183 8005301065 Bacteria 6614431
569 8005326852 8005321885 Bacteria 5795980
570 8005462368 8005460587 Bacteria 7157962
571 8005486504 8005484373 Bacteria 6297373
572 8005544746 8005542996 Bacteria 7077758
573 8005558266 8005556819 Bacteria 6908598
574 8005569447 8005563573 Bacteria 7153261
575 8005646417 8005645114 Bacteria 6950293
576 8005686480 8005682033 Bacteria 6726518
577 8005695093 8005688590 Bacteria 6610080
578 8005696322 8005695170 Bacteria 6912330
579 8018152619 8018150411 Bacteria 5549903
580 8018167943 8018163183 Bacteria 7277977
581 8024485594 8024479707 Bacteria 6954785
582 8024505064 8024501048 Bacteria 6427847
583 8045865152 8045864390 Bacteria 5043873
584 8046768593 8046767195 Bacteria 7547379
585 8056379997 8056375014 Bacteria 7006639
586 8056387707 8056382006 Bacteria 6408074
587 8056876699 8056875544 Bacteria 4355797
588 8057578127 8057575449 Bacteria 7367519
589 8057875646 8057874678 Bacteria 7494653
590 Ga0081455_10638707
591 JGI25155J39150_1000011
592 JGI25156J39149_1000027
593 JGI25162J39368_1000963
594 JGI25154J39366_1000181
595 JGI25157J39369_1000010
596 JGI25159J45721_1000006
597 JGI25159J45721_1002092
598 JGI25151J46595_10000326
599 JGI25151J46595_10002380
600 JGI25151J46595_10018050
601 JGI25151J46595_10026360
602 JGI25165J46597_1000900
603 JGI25165J46597_1000920
604 JGI25165J46597_1001027
605 JGI25153J46596_10102139
606 rootH1_10012915
607 rootL2_10018543
608 JGI25160J50197_1000004
609 JGI25160J50197_1000019
610 JGI25161J50226_1000003
611 JGI25161J50226_1000467
612 Ga0006562J51391_1008590
613 Ga0006562J51391_1053935
614 Ga0055539_1004307
615 Ga0055526_1000462
616 Ga0055524_1035440
617 Ga0055536_1002723
618 Ga0055530_10011193
619 Ga0055540_1002665
620 Ga0055540_1014671
621 Ga0055531_10002882
622 Ga0055531_10003417
623 Ga0055531_10075107
624 Ga0058692_1002873
625 Ga0058692_1039309
626 Ga0055543_1000001
627 Ga0055543_1000275
628 Ga0065165_1000149
629 Ga0065165_1000272
630 Ga0065704_10206666
631 Ga0070669_100490185
632 Ga0070678_100546319
633 Ga0070707_101166976
634 Ga0068853_101803677
635 Ga0070672_100618594
636 Ga0070665_100025262
637 Ga0070665_100040711
638 Ga0068856_100389696
639 Ga0068852_100040901
640 Ga0068866_11388406
641 Ga0068861_100464409
642 Ga0068851_10072973
643 Ga0068858_101561116
644 Ga0081455_10965889
645 Ga0075365_10135802
646 Ga0075365_10432131
647 Ga0075368_10151362
648 Ga0075368_10542853
649 Ga0075363_100012575
650 Ga0075364_10001918
651 Ga0075364_10402263
652 Ga0075362_10100273
653 Ga0075367_10006256
654 Ga0075367_10345775
655 Ga0075370_10014017
656 Ga0075370_10028124
657 Ga0075370_10436392
658 Ga0079104_1000129
659 Ga0099826_10002926
660 Ga0099826_10023176
661 Ga0105240_10000005
662 Ga0105247_10137204
663 Ga0105243_10005858
664 Ga0105242_12822471
665 Ga0105248_10764104
666 Ga0105237_10001991
667 Ga0105249_12185818
668 Ga0105249_12194975
669 Ga0123341_1000001
670 Ga0123342_1023582
671 Ga0105239_10003100
672 Ga0105246_10665759
673 Ga0157319_1004456
674 Ga0157373_10005196
675 Ga0157371_10000015
676 Ga0157370_10000309
677 Ga0157370_10000665
678 Ga0157369_10281895
679 Ga0157369_10398896
680 Ga0157369_10415738
681 Ga0171463_1011
682 Ga0163162_10848509
683 Ga0157372_10567411
684 Ga0157372_10985243
685 Ga0182007_10000998
686 Ga0182005_1009577
687 Ga0183363_1143
688 Ga0206349_1725640
689 Ga0154015_1207814
690 Ga0228711_1000528
691 Ga0228710_1000006
692 Ga0209435_100022
693 Ga0209436_100390
694 Ga0209672_101326
695 Ga0209672_115196
696 Ga0209437_100153
697 Ga0209437_100201
698 Ga0209437_108911
699 Ga0207425_1014295
700 Ga0207425_1037107
701 Ga0207425_1074758
702 Ga0209646_1000078
703 Ga0209026_1000065
704 Ga0209026_1054798
705 Ga0209677_101154
706 Ga0209148_1015119
707 Ga0209759_1000055
708 Ga0209759_1026496
709 Ga0209129_1000470
710 Ga0209129_1013211
711 Ga0209129_1054669
712 Ga0209233_1000175
713 Ga0209233_1000226
714 Ga0209233_1000248
715 Ga0209455_1027369
716 Ga0209455_1028396
717 Ga0209673_1003247
718 Ga0209130_1000007
719 Ga0209130_1000012
720 Ga0209676_1002948
721 Ga0209025_1000033
722 Ga0209025_1000097
723 Ga0209025_1000702
724 Ga0209025_1011412
725 Ga0209025_1039084
726 Ga0209025_1083402
727 Ga0209025_1099196
728 Ga0209564_1000740
729 Ga0209758_1000520
730 Ga0209758_1001887
731 Ga0209758_1019549
732 Ga0209050_1004383
733 Ga0209256_1000319
734 Ga0209256_1002545
735 Ga0207426_1000010
736 Ga0207426_1000111
737 Ga0209051_1000166
738 Ga0209051_1003640
739 Ga0209051_1107050
740 Ga0209257_1001307
741 Ga0209257_1003894
742 Ga0209257_1005270
743 Ga0207656_10034847
744 Ga0207695_10000011
745 Ga0207671_10000276
746 Ga0207646_11254035
747 Ga0207681_10445217
748 Ga0207694_10671638
749 Ga0207700_11365004
750 Ga0207709_11096273
751 Ga0207691_10385241
752 Ga0207711_10560539
753 Ga0207712_11398552
754 Ga0207668_10275568
755 Ga0207640_10060572
756 Ga0207703_11360423
757 Ga0207639_11603234
758 Ga0207702_10100675
759 Ga0207698_10095170
760 Ga0209281_1000036
761 Ga0209281_1000047
762 Ga0209281_1000268
763 Ga0209371_1000178
764 Ga0209371_1000382
765 Ga0209371_1001444
766 Ga0209371_1002027
767 Ga0209282_1000026
768 Ga0209282_1000095
769 Ga0209282_1079392
770 Ga0209813_10005272
771 Ga0268266_10025145
772 Ga0268266_10030382
773 Ga0268266_10598234
774 Ga0307515_10000656
775 Ga0268256_1000837
776 Ga0268256_1002533
777 Ga0268256_1014606
778 Ga0316182_1300461
779 Ga0307408_101033425
780 Ga0307407_10662959
781 Ga0315914_1000008
782 Ga0307409_100896747
783 Ga0315913_1000137
784 Ga0315915_1000014
785 Ga0373927_0002192
786 Ga0373925_0016473
787 Ga0436360_0816593
788 Ga0439438_068707
789 Ga0439466_0062925
790 Ga0439465_0380175
791 Ga0451795_0672550
792 Ga0451798_0357052
793 Ga0451807_0617558
794 Ga0451833_0164686
795 Ga0451835_0501641
796 Ga0451837_0609112
797 Ga0451841_1387287
798 Ga0451845_0265737
799 Ga0451846_44962
800 Ga0451850_24435
801 Ga0451851_0456096
802 Ga0451843_0429565
803 Ga0451855_0262920
804 Ga0451853_0932150
805 Ga0452271_23420
806 Ga0439433_0039980
807 Ga0439449_0152855
808 Ga0466966_0512868
809 Ga0466963_0271616
810 Ga0466968_0067578
811 Ga0466970_0004213
812 Ga0466970_0096626
813 Ga0466960_0069638
814 Ga0466958_0622491
815 Ga0466967_0976422
816 Ga0495629_0039145
817 Ga0495638_0082374
818 Ga0495651_0043436
819 Ga0495653_0368417
820 Ga0495639_0088449
821 Ga0495662_0032625
822 Ga0495585_0056387
823 Ga0495585_0162551
824 Ga0495606_0144680
825 Ga0495618_0186173
826 Ga0495628_0045009
827 Ga0495666_0092263
828 Ga0495640_0092724
829 Ga0495622_0012582
830 Ga0495633_0021766
831 Ga0495633_0183359
832 Ga0495656_0643419
833 Ga0495634_0575656
834 Ga0495625_0243184
835 Ga0495635_0090827
836 Ga0495661_0422501
837 Ga0495588_0001225
838 Ga0495657_0041037
839 Ga0495658_0029296
840 Ga0495613_0756144
841 Ga0495600_0131859
842 Ga0495604_0058840
843 Ga0495676_0382676
844 Ga0495683_0284816
845 Ga0495681_0042887
846 Ga0495686_0070708
847 Ga0495686_0151862
848 Ga0495602_0816187
849 Ga0496103_0005774
850 Ga0496104_0827853
851 Ga0496112_0632430
852 Ga0496113_0074829
853 Ga0496114_0445459
854 Ga0496116_0000061
855 Ga0496116_0013279
856 Ga0496116_0045233
857 Ga0496116_0282763
858 Ga0496117_0000002
859 Ga0496117_0001684
860 Ga0496117_0033913
861 Ga0496117_0251379
862 Ga0496118_0000460
863 Ga0496118_0000756
864 Ga0496118_0044985
865 Ga0496118_0045994
866 Ga0496118_0073755
867 Ga0496119_0009961
868 Ga0496119_0021313
869 Ga0496120_0000078
870 Ga0496120_0005495
871 Ga0496120_0027751
872 Ga0496120_0436944
873 Ga0496120_0505738
874 Ga0496121_0000001
875 Ga0496121_0001247
876 Ga0496121_0038531
877 Ga0496121_0152962
878 Ga0496121_0306688
879 Ga0496121_0491537
880 Ga0496121_0501856
881 Ga0496122_0000001
882 Ga0496122_0012559
883 Ga0496122_0013836
884 Ga0496122_0031709
885 Ga0496122_0037942
886 Ga0496122_0088691
887 Ga0496122_0236302
888 Ga0496122_0616777
889 Ga0496123_0000001
890 Ga0496123_0012058
891 Ga0496123_0151979
892 Ga0496123_0174681
893 Ga0496123_0199911
894 Ga0496123_0376627
895 Ga0496124_0000112
896 Ga0496124_0015634
897 Ga0496124_0029389
898 Ga0496124_0070150
899 Ga0496124_0154215
900 Ga0496124_0290244
901 Ga0496125_0000001
902 Ga0496125_0028452
903 Ga0496125_0203684
904 Ga0496126_0000397
905 Ga0496126_0052378
906 Ga0496126_0099260
907 Ga0501034_0027452
908 Ga0501034_0248837
909 Ga0501038_0852827
910 Ga0501041_0282908
911 Ga0501075_0540134
912 Ga0501076_0374757
913 Ga0501077_0820847
914 Ga0501238_076260
915 Ga0501081_0125733
916 Ga0501280_005471
917 nmdc:mga03683_10679_c1
918 nmdc:mga03n38_73294_c1
919 nmdc:mga00v17_153564_c1
920 nmdc:mga00v17_444949_c1
921 nmdc:mga00v17_80_c1
922 nmdc:mga0yw44_323535_c1
923 nmdc:mga0yw44_391458_c1
924 nmdc:mga0yw44_45095_c1
925 nmdc:mga0k408_114871_c1
926 nmdc:mga0k408_555272_c1
927 nmdc:mga0k408_643689_c1
928 nmdc:mga06z11_248270_c1
929 nmdc:mga06z11_411576_c1
930 nmdc:mga04h51_105456_c1
931 nmdc:mga07m45_187475_c1
932 nmdc:mga07m45_297585_c1
933 nmdc:mga0sz30_198681_c1
934 nmdc:mga0sz30_8434_c1
935 Ga0495619_0179729
936 Ga0500644_0052166
937 Ga0500646_0332894
938 Ga0500560_067141
939 Ga0500607_189560
940 Ga0500608_021456
941 Ga0500614_174722
942 Ga0500618_000510
943 Ga0500561_0000062
944 Ga0500568_0041443
945 Ga0500573_0003702
946 Ga0500590_014477
947 Ga0500616_0000647
948 Ga0500616_0073580
949 Ga0500619_215789
950 Ga0500622_0000158
951 Ga0500624_000357
952 Ga0500627_0004905
953 Ga0500627_0092249
954 Ga0500627_0112499
955 Ga0500634_0054472
956 Ga0500636_0000019
957 Ga0500636_0001577
958 Ga0500636_0349540
959 Ga0587073_0123744
960 Ga0587073_0168309
961 Ga0587080_021315
962 Ga0587082_095103
963 Ga0587086_097385
964 Ga0587088_010730
965 Ga0587089_101380
966 Ga0587099_002533
967 Ga0587068_150723
968 Ga0587069_028962
969 Ga0587075_125420
970 Ga0587076_081239
971 Ga0587071_151812
972 Ga0587111_0207985
973 Ga0501082_0469705
974 2509442688
975 2510132767
976 2511132482
977 2511391417
978 2513632908
979 2513710360
980 2515111712
981 2515634798
982 2517040404
983 2517094475
984 2524461303
985 2530645005
986 2537875957
987 2554247787
988 2559294920
989 2561468944
990 2585168363
991 2585232503
992 2585272907
993 2585276841
994 2585324160
995 2585333447
996 2585534856
997 2585540250
998 2585551699
999 2585558185
1000 2585838448
1001 2585897579
1002 2585904827
1003 2587980057
1004 2599604181
1005 2600192390
1006 2601608026
1007 2601744801
1008 2616308214
1009 2616556764
1010 2617381569
1011 2643808471
1012 2643812134
1013 2644005979
1014 2644049499
1015 2644066436
1016 2644193196
1017 2644204093
1018 2644210998
1019 2644238198
1020 2644300216
1021 2644378024
1022 2644415351
1023 2644450248
1024 2644482533
1025 2644499036
1026 2644522313
1027 2644654653
1028 2644658442
1029 2644677965
1030 2644687800
1031 2671115611
1032 2719385259
1033 2721398980
1034 2724037793
1035 2725951731
1036 2757569988
1037 2765465060
1038 2766068046
1039 2770198227
1040 2776271165
1041 2776280838
1042 2778176356
1043 2793297033
1044 2793315605
1045 2793321359
1046 2793330008
1047 2793335227
1048 2793342699
1049 2793352138
1050 2793360500
1051 2793366287
1052 2805930056
1053 2806045652
1054 2806072879
1055 2808985310
1056 2819242167
1057 2819559743
1058 2819610526
1059 2819638273
1060 2837683120
1061 2838022694
1062 2838032299
1063 2838047687
1064 2838676154
1065 2838682761
1066 2838697395
1067 2838709427
1068 2838715036
1069 2838721164
1070 2838725795
1071 2839994998
1072 2840767887
1073 2841848121
1074 2841859328
1075 2841865067
1076 2842077538
1077 2842111058
1078 2842119953
1079 2842125849
1080 2842131048
1081 2842153782
1082 2842171279
1083 2842177402
1084 2842188144
1085 2842201479
1086 2842206575
1087 2842212455
1088 2842220470
1089 2842225926
1090 2842238840
1091 2842280032
1092 2842287661
1093 2842291200
1094 2842302893
1095 2842318419
1096 2842347060
1097 2842362569
1098 2842366892
1099 2842373391
1100 2842377596
1101 2842386463
1102 2842399652
1103 2842404810
1104 2842411393
1105 2842418156
1106 2842479072
1107 2842500606
1108 2842506208
1109 2842510085
1110 2842516112
1111 2852389475
1112 2857523038
1113 2894656441
1114 2896387049
1115 2899794198
1116 2899807416
1117 2899846503
1118 2904581044
1119 2917556863
1120 2919115127
1121 2919121163
1122 2919409659
1123 2920824280
1124 2926756172
1125 2926760404
1126 2928523505
1127 2929139803
1128 2933008428
1129 2933013244
1130 2933587083
1131 2933597933
1132 2935900471
1133 2936384697
1134 2937846093
1135 2941499765
1136 2954015786
1137 2979094321
1138 2979098298
1139 2979103554
1140 2984511878
1141 2984521762
1142 2984541059
1143 2984603340
1144 2989776084
1145 2989778556
1146 2996892325
1147 2996893909
1148 3002144158
1149 3003933284
1150 3005453826
1151 639647921
1152 650740176
1153 8002285586
1154 8005259607
1155 8005280065
1156 8005294643
1157 8005307183
1158 8005326852
1159 8005462368
1160 8005486504
1161 8005544746
1162 8005558266
1163 8005569447
1164 8005646417
1165 8005686480
1166 8005695093
1167 8005696322
1168 8018152619
1169 8018167943
1170 8024485594
1171 8024505064
1172 8045865152
1173 8046768593
1174 8056379997
1175 8056387707
1176 8056876699
1177 8057578127
1178 8057875646

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

25

127

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.9134 1 98
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.8378 1 98
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8346 1 98
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8276 5 98
2k4z-assembly1.cif.gz_A solution nmr structure of allochromatium vinosum dsrr: northeast structural genomics consortium target op5 0.8248 6 96
ID Description Score Start End Superfamily
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9342 5 98 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9245 5 98 2.60.300.12
af_A0A0R0F1L8_21_105_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.863 5 87 2.60.300.12
af_I3ITR1_24_129_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8589 5 110 2.60.300.12
af_P77667_17_122_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8554 5 110 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A5R2N9K1-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9362 2 98 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A1G1M7N8-F1-model_v4 FeS cluster biogenesis domain-containing protein 0.9317 5 98 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A7W1ANF1-F1-model_v4 Iron-sulfur cluster insertion protein ErpA 0.9196 6 103 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A2X1KGP0-F1-model_v4 Fe-S cluster assembly protein 0.9169 5 98 GO:0005829
GO:0016226
GO:0046872
GO:0051537
GO:0097428
AF-A0A0B1SWC3-F1-model_v4 Iron-sulfur cluster assembly 1 homolog, mitochondrial 0.9149 6 98 GO:0005739
GO:0016226
GO:0051537
GO:0097428

Map