F466844
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 589 | 460 | 1178 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10638707|Ga0081455_106387072 |
| Length | 131 |
| Sequence | MARHDMAMSAGRMVCRELERMTDVASVSVSDAAAKRISAILKSEPDKTALRISVEGGGCSGFSYKYDLVNAQDADDLVIEKLGAKVLIDAISLPYIGGSEIDFVDDLMGQSFQIRNPNATSSCGCGTSFAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 40 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 41 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 44 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 47 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 56 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 70 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 72 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 73 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 74 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 75 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 80 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 116 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 118 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 121 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 122 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 123 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 124 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 125 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 128 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 129 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 130 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 132 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 133 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 134 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 135 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 136 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 137 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 138 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 139 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 140 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 141 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 142 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 143 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 144 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 145 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 146 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 147 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 148 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 149 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 150 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 151 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 152 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 153 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 154 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 155 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 156 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 157 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 158 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 159 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 190 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 191 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 192 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 193 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 194 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 195 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 196 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 197 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 198 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 199 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 200 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 201 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 202 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 203 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 204 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 205 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 212 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 214 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 215 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 216 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 217 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 218 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 219 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 220 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 221 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 222 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 223 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 225 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 226 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 227 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 228 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 229 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 230 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 231 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 232 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 233 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 234 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 235 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 236 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 237 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 238 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 239 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 240 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 241 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 242 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 257 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 258 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 259 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 260 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 261 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 262 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 263 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 264 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 265 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 266 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 267 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 268 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 269 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 270 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 271 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 272 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 273 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 274 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 275 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 276 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 277 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 278 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 279 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 280 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 281 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 282 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 283 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 284 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 285 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 286 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 287 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 288 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 289 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 290 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 291 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 292 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 293 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 294 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 295 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 296 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 297 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 298 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 299 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 300 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 301 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 302 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 303 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 304 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 305 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 306 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 307 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 308 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 309 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 310 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 311 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 312 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 313 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 314 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 315 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 316 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 317 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 318 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 319 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 320 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 321 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 322 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 323 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 324 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 325 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 326 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 327 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 328 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 329 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 330 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 331 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 332 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 333 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 334 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 335 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 336 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 337 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 338 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 339 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 340 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 341 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 342 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 343 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 344 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 345 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 346 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 347 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 348 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 349 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 350 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 351 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 352 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 353 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 354 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 355 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 356 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 357 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 358 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 359 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 360 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 361 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 362 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 363 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 364 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 365 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 366 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 367 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 368 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 369 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 370 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 371 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 372 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 373 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 374 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 375 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 376 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 377 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 378 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 379 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 380 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 381 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 382 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 383 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 384 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 385 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 386 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 387 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 388 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 389 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 390 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 391 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 392 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 393 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 394 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 395 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 396 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 397 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 398 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 399 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 400 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 401 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 402 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 403 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 404 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 405 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 406 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 407 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 408 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 409 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 410 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 411 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 412 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 413 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 414 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 415 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 416 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 417 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 418 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 419 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 420 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 421 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 422 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 423 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 424 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 425 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 426 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 427 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 428 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 429 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 430 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 431 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 432 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 433 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 434 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 435 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 436 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 437 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 438 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 439 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 440 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 441 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 442 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 443 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 444 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 445 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 446 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 447 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 448 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 449 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 450 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 451 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 452 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 453 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 454 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 455 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 456 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 457 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 458 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 459 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 460 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 61.63 |
| Metatranscriptomes | 3.57 |
| Isolates | 34.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.68 |
| Bulb | 0 |
| Endosphere | 21.9 |
| Nodule | 20.2 |
| Rhizoplane | 2.72 |
| Rhizosphere | 31.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081455_10638707 | 3300005937 | Bacteria | 687 |
| 2 | JGI25155J39150_1000011 | 3300002704 | Bacteria | 207685 |
| 3 | JGI25156J39149_1000027 | 3300002705 | Bacteria | 127396 |
| 4 | JGI25162J39368_1000963 | 3300002737 | Bacteria | 18339 |
| 5 | JGI25154J39366_1000181 | 3300002738 | Bacteria | 49117 |
| 6 | JGI25157J39369_1000010 | 3300002741 | Bacteria | 207685 |
| 7 | JGI25159J45721_1000006 | 3300002987 | Bacteria | 188201 |
| 8 | JGI25159J45721_1002092 | 3300002987 | Bacteria | 7840 |
| 9 | JGI25151J46595_10000326 | 3300003187 | Bacteria | 51646 |
| 10 | JGI25151J46595_10002380 | 3300003187 | Bacteria | 11407 |
| 11 | JGI25151J46595_10018050 | 3300003187 | Bacteria | 3042 |
| 12 | JGI25151J46595_10026360 | 3300003187 | Bacteria | 2346 |
| 13 | JGI25165J46597_1000900 | 3300003214 | Bacteria | 20669 |
| 14 | JGI25165J46597_1000920 | 3300003214 | Bacteria | 20377 |
| 15 | JGI25165J46597_1001027 | 3300003214 | Bacteria | 18335 |
| 16 | JGI25153J46596_10102139 | 3300003215 | Bacteria | 673 |
| 17 | rootH1_10012915 | 3300003316 | Bacteria | 6044 |
| 18 | rootL2_10018543 | 3300003322 | Bacteria | 7640 |
| 19 | JGI25160J50197_1000004 | 3300003354 | Bacteria | 419797 |
| 20 | JGI25160J50197_1000019 | 3300003354 | Bacteria | 233980 |
| 21 | JGI25161J50226_1000003 | 3300003374 | Bacteria | 413345 |
| 22 | JGI25161J50226_1000467 | 3300003374 | Bacteria | 18513 |
| 23 | Ga0006562J51391_1008590 | 3300003578 | Bacteria | 660 |
| 24 | Ga0006562J51391_1053935 | 3300003578 | Bacteria | 527 |
| 25 | Ga0055539_1004307 | 3300003752 | Bacteria | 1900 |
| 26 | Ga0055526_1000462 | 3300003771 | Bacteria | 32312 |
| 27 | Ga0055524_1035440 | 3300003775 | Bacteria | 1361 |
| 28 | Ga0055536_1002723 | 3300003781 | Bacteria | 9796 |
| 29 | Ga0055530_10011193 | 3300003791 | Bacteria | 3243 |
| 30 | Ga0055540_1002665 | 3300003792 | Bacteria | 9227 |
| 31 | Ga0055540_1014671 | 3300003792 | Bacteria | 2322 |
| 32 | Ga0055531_10002882 | 3300003794 | Bacteria | 11201 |
| 33 | Ga0055531_10003417 | 3300003794 | Bacteria | 10139 |
| 34 | Ga0055531_10075107 | 3300003794 | Bacteria | 764 |
| 35 | Ga0058692_1002873 | 3300003856 | Bacteria | 5604 |
| 36 | Ga0058692_1039309 | 3300003856 | Bacteria | 839 |
| 37 | Ga0055543_1000001 | 3300004625 | Bacteria | 419949 |
| 38 | Ga0055543_1000275 | 3300004625 | Bacteria | 38327 |
| 39 | Ga0065165_1000149 | 3300005262 | Bacteria | 122370 |
| 40 | Ga0065165_1000272 | 3300005262 | Bacteria | 88086 |
| 41 | Ga0065704_10206666 | 3300005289 | Bacteria | 1124 |
| 42 | Ga0070669_100490185 | 3300005353 | Bacteria | 1018 |
| 43 | Ga0070678_100546319 | 3300005456 | Bacteria | 1028 |
| 44 | Ga0070707_101166976 | 3300005468 | Bacteria | 736 |
| 45 | Ga0068853_101803677 | 3300005539 | Bacteria | 593 |
| 46 | Ga0070672_100618594 | 3300005543 | Bacteria | 944 |
| 47 | Ga0070665_100025262 | 3300005548 | Bacteria | 5986 |
| 48 | Ga0070665_100040711 | 3300005548 | Bacteria | 4670 |
| 49 | Ga0068856_100389696 | 3300005614 | Bacteria | 1413 |
| 50 | Ga0068852_100040901 | 3300005616 | Bacteria | 3915 |
| 51 | Ga0068866_11388406 | 3300005718 | Unclassified | 513 |
| 52 | Ga0068861_100464409 | 3300005719 | Bacteria | 1137 |
| 53 | Ga0068851_10072973 | 3300005834 | Bacteria | 1779 |
| 54 | Ga0068858_101561116 | 3300005842 | Unclassified | 651 |
| 55 | Ga0081455_10965889 | 3300005937 | Bacteria | 528 |
| 56 | Ga0075365_10135802 | 3300006038 | Bacteria | 1704 |
| 57 | Ga0075365_10432131 | 3300006038 | Bacteria | 930 |
| 58 | Ga0075368_10151362 | 3300006042 | Bacteria | 969 |
| 59 | Ga0075368_10542853 | 3300006042 | Bacteria | 522 |
| 60 | Ga0075363_100012575 | 3300006048 | Bacteria | 4084 |
| 61 | Ga0075364_10001918 | 3300006051 | Bacteria | 11579 |
| 62 | Ga0075364_10402263 | 3300006051 | Bacteria | 934 |
| 63 | Ga0075362_10100273 | 3300006177 | Bacteria | 1353 |
| 64 | Ga0075367_10006256 | 3300006178 | Bacteria | 6000 |
| 65 | Ga0075367_10345775 | 3300006178 | Bacteria | 938 |
| 66 | Ga0075370_10014017 | 3300006353 | Bacteria | 4269 |
| 67 | Ga0075370_10028124 | 3300006353 | Bacteria | 3124 |
| 68 | Ga0075370_10436392 | 3300006353 | Bacteria | 787 |
| 69 | Ga0079104_1000129 | 3300006946 | Bacteria | 108427 |
| 70 | Ga0099826_10002926 | 3300006948 | Bacteria | 11342 |
| 71 | Ga0099826_10023176 | 3300006948 | Bacteria | 4631 |
| 72 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 73 | Ga0105247_10137204 | 3300009101 | Bacteria | 1599 |
| 74 | Ga0105243_10005858 | 3300009148 | Bacteria | 9526 |
| 75 | Ga0105242_12822471 | 3300009176 | Unclassified | 536 |
| 76 | Ga0105248_10764104 | 3300009177 | Bacteria | 1091 |
| 77 | Ga0105237_10001991 | 3300009545 | Bacteria | 25984 |
| 78 | Ga0105249_12185818 | 3300009553 | Bacteria | 626 |
| 79 | Ga0105249_12194975 | 3300009553 | Bacteria | 625 |
| 80 | Ga0123341_1000001 | 3300009765 | Bacteria | 314908 |
| 81 | Ga0123342_1023582 | 3300009766 | Bacteria | 3969 |
| 82 | Ga0105239_10003100 | 3300010375 | Bacteria | 20616 |
| 83 | Ga0105246_10665759 | 3300011119 | Bacteria | 908 |
| 84 | Ga0157319_1004456 | 3300012497 | Bacteria | 922 |
| 85 | Ga0157373_10005196 | 3300013100 | Bacteria | 9780 |
| 86 | Ga0157371_10000015 | 3300013102 | Bacteria | 339838 |
| 87 | Ga0157370_10000309 | 3300013104 | Bacteria | 61167 |
| 88 | Ga0157370_10000665 | 3300013104 | Bacteria | 42812 |
| 89 | Ga0157369_10281895 | 3300013105 | Bacteria | 1730 |
| 90 | Ga0157369_10398896 | 3300013105 | Bacteria | 1427 |
| 91 | Ga0157369_10415738 | 3300013105 | Bacteria | 1394 |
| 92 | Ga0171463_1011 | 3300013249 | Bacteria | 230603 |
| 93 | Ga0163162_10848509 | 3300013306 | Bacteria | 1029 |
| 94 | Ga0157372_10567411 | 3300013307 | Bacteria | 1323 |
| 95 | Ga0157372_10985243 | 3300013307 | Bacteria | 977 |
| 96 | Ga0182007_10000998 | 3300015262 | Bacteria | 15523 |
| 97 | Ga0182005_1009577 | 3300015265 | Bacteria | 2814 |
| 98 | Ga0183363_1143 | 3300015690 | Bacteria | 17948 |
| 99 | Ga0206349_1725640 | 3300020075 | Bacteria | 534 |
| 100 | Ga0154015_1207814 | 3300020610 | Bacteria | 535 |
| 101 | Ga0228711_1000528 | 3300022739 | Bacteria | 47804 |
| 102 | Ga0228710_1000006 | 3300022740 | Bacteria | 209134 |
| 103 | Ga0209435_100022 | 3300025206 | Bacteria | 207766 |
| 104 | Ga0209436_100390 | 3300025208 | Bacteria | 19835 |
| 105 | Ga0209672_101326 | 3300025228 | Bacteria | 9432 |
| 106 | Ga0209672_115196 | 3300025228 | Bacteria | 868 |
| 107 | Ga0209437_100153 | 3300025233 | Bacteria | 154068 |
| 108 | Ga0209437_100201 | 3300025233 | Bacteria | 119080 |
| 109 | Ga0209437_108911 | 3300025233 | Bacteria | 1587 |
| 110 | Ga0207425_1014295 | 3300025245 | Bacteria | 1805 |
| 111 | Ga0207425_1037107 | 3300025245 | Bacteria | 942 |
| 112 | Ga0207425_1074758 | 3300025245 | Bacteria | 574 |
| 113 | Ga0209646_1000078 | 3300025246 | Bacteria | 207766 |
| 114 | Ga0209026_1000065 | 3300025250 | Bacteria | 207766 |
| 115 | Ga0209026_1054798 | 3300025250 | Bacteria | 565 |
| 116 | Ga0209677_101154 | 3300025253 | Bacteria | 12276 |
| 117 | Ga0209148_1015119 | 3300025254 | Bacteria | 1355 |
| 118 | Ga0209759_1000055 | 3300025256 | Bacteria | 207766 |
| 119 | Ga0209759_1026496 | 3300025256 | Bacteria | 1214 |
| 120 | Ga0209129_1000470 | 3300025258 | Bacteria | 29594 |
| 121 | Ga0209129_1013211 | 3300025258 | Bacteria | 1834 |
| 122 | Ga0209129_1054669 | 3300025258 | Bacteria | 602 |
| 123 | Ga0209233_1000175 | 3300025261 | Bacteria | 144221 |
| 124 | Ga0209233_1000226 | 3300025261 | Bacteria | 103045 |
| 125 | Ga0209233_1000248 | 3300025261 | Bacteria | 87812 |
| 126 | Ga0209455_1027369 | 3300025272 | Bacteria | 1011 |
| 127 | Ga0209455_1028396 | 3300025272 | Bacteria | 979 |
| 128 | Ga0209673_1003247 | 3300025273 | Bacteria | 9822 |
| 129 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 130 | Ga0209130_1000012 | 3300025284 | Bacteria | 421329 |
| 131 | Ga0209676_1002948 | 3300025292 | Bacteria | 11110 |
| 132 | Ga0209025_1000033 | 3300025294 | Bacteria | 414511 |
| 133 | Ga0209025_1000097 | 3300025294 | Bacteria | 236632 |
| 134 | Ga0209025_1000702 | 3300025294 | Bacteria | 57061 |
| 135 | Ga0209025_1011412 | 3300025294 | Bacteria | 5858 |
| 136 | Ga0209025_1039084 | 3300025294 | Bacteria | 2076 |
| 137 | Ga0209025_1083402 | 3300025294 | Bacteria | 1075 |
| 138 | Ga0209025_1099196 | 3300025294 | Bacteria | 927 |
| 139 | Ga0209564_1000740 | 3300025295 | Bacteria | 46349 |
| 140 | Ga0209758_1000520 | 3300025297 | Bacteria | 61722 |
| 141 | Ga0209758_1001887 | 3300025297 | Bacteria | 22869 |
| 142 | Ga0209758_1019549 | 3300025297 | Bacteria | 3260 |
| 143 | Ga0209050_1004383 | 3300025298 | Bacteria | 9579 |
| 144 | Ga0209256_1000319 | 3300025299 | Bacteria | 82827 |
| 145 | Ga0209256_1002545 | 3300025299 | Bacteria | 14596 |
| 146 | Ga0207426_1000010 | 3300025302 | Bacteria | 796003 |
| 147 | Ga0207426_1000111 | 3300025302 | Bacteria | 234032 |
| 148 | Ga0209051_1000166 | 3300025303 | Bacteria | 120265 |
| 149 | Ga0209051_1003640 | 3300025303 | Bacteria | 9983 |
| 150 | Ga0209051_1107050 | 3300025303 | Bacteria | 738 |
| 151 | Ga0209257_1001307 | 3300025304 | Bacteria | 30337 |
| 152 | Ga0209257_1003894 | 3300025304 | Bacteria | 12172 |
| 153 | Ga0209257_1005270 | 3300025304 | Bacteria | 9217 |
| 154 | Ga0207656_10034847 | 3300025321 | Bacteria | 2104 |
| 155 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 156 | Ga0207671_10000276 | 3300025914 | Bacteria | 76490 |
| 157 | Ga0207646_11254035 | 3300025922 | Bacteria | 649 |
| 158 | Ga0207681_10445217 | 3300025923 | Bacteria | 1053 |
| 159 | Ga0207694_10671638 | 3300025924 | Bacteria | 873 |
| 160 | Ga0207700_11365004 | 3300025928 | Bacteria | 631 |
| 161 | Ga0207709_11096273 | 3300025935 | Bacteria | 654 |
| 162 | Ga0207691_10385241 | 3300025940 | Bacteria | 1197 |
| 163 | Ga0207711_10560539 | 3300025941 | Bacteria | 1066 |
| 164 | Ga0207712_11398552 | 3300025961 | Bacteria | 626 |
| 165 | Ga0207668_10275568 | 3300025972 | Bacteria | 1377 |
| 166 | Ga0207640_10060572 | 3300025981 | Bacteria | 2503 |
| 167 | Ga0207703_11360423 | 3300026035 | Bacteria | 683 |
| 168 | Ga0207639_11603234 | 3300026041 | Bacteria | 610 |
| 169 | Ga0207702_10100675 | 3300026078 | Bacteria | 2550 |
| 170 | Ga0207698_10095170 | 3300026142 | Bacteria | 2451 |
| 171 | Ga0209281_1000036 | 3300027111 | Bacteria | 369415 |
| 172 | Ga0209281_1000047 | 3300027111 | Bacteria | 326514 |
| 173 | Ga0209281_1000268 | 3300027111 | Bacteria | 100508 |
| 174 | Ga0209371_1000178 | 3300027312 | Bacteria | 93894 |
| 175 | Ga0209371_1000382 | 3300027312 | Bacteria | 47344 |
| 176 | Ga0209371_1001444 | 3300027312 | Bacteria | 16135 |
| 177 | Ga0209371_1002027 | 3300027312 | Bacteria | 12116 |
| 178 | Ga0209282_1000026 | 3300027666 | Bacteria | 166272 |
| 179 | Ga0209282_1000095 | 3300027666 | Bacteria | 60099 |
| 180 | Ga0209282_1079392 | 3300027666 | Bacteria | 1757 |
| 181 | Ga0209813_10005272 | 3300027866 | Bacteria | 3129 |
| 182 | Ga0268266_10025145 | 3300028379 | Bacteria | 5068 |
| 183 | Ga0268266_10030382 | 3300028379 | Bacteria | 4590 |
| 184 | Ga0268266_10598234 | 3300028379 | Bacteria | 1059 |
| 185 | Ga0307515_10000656 | 3300028794 | Bacteria | 79816 |
| 186 | Ga0268256_1000837 | 3300030500 | Bacteria | 21879 |
| 187 | Ga0268256_1002533 | 3300030500 | Bacteria | 9201 |
| 188 | Ga0268256_1014606 | 3300030500 | Bacteria | 2321 |
| 189 | Ga0316182_1300461 | 3300030745 | Bacteria | 964 |
| 190 | Ga0307408_101033425 | 3300031548 | Bacteria | 759 |
| 191 | Ga0307407_10662959 | 3300031903 | Bacteria | 783 |
| 192 | Ga0315914_1000008 | 3300031967 | Bacteria | 209133 |
| 193 | Ga0307409_100896747 | 3300031995 | Bacteria | 900 |
| 194 | Ga0315913_1000137 | 3300033430 | Bacteria | 47802 |
| 195 | Ga0315915_1000014 | 3300033464 | Bacteria | 171068 |
| 196 | Ga0373927_0002192 | 3300035695 | Bacteria | 14352 |
| 197 | Ga0373925_0016473 | 3300037068 | Bacteria | 5355 |
| 198 | Ga0436360_0816593 | 3300039438 | Bacteria | 1456 |
| 199 | Ga0439438_068707 | 3300041405 | Bacteria | 879 |
| 200 | Ga0439466_0062925 | 3300041411 | Bacteria | 1192 |
| 201 | Ga0439465_0380175 | 3300041413 | Bacteria | 536 |
| 202 | Ga0451795_0672550 | 3300041456 | Bacteria | 805 |
| 203 | Ga0451798_0357052 | 3300041458 | Bacteria | 529 |
| 204 | Ga0451807_0617558 | 3300041486 | Bacteria | 846 |
| 205 | Ga0451833_0164686 | 3300041491 | Bacteria | 1235 |
| 206 | Ga0451835_0501641 | 3300041492 | Bacteria | 1407 |
| 207 | Ga0451837_0609112 | 3300041494 | Bacteria | 588 |
| 208 | Ga0451841_1387287 | 3300041498 | Bacteria | 2352 |
| 209 | Ga0451845_0265737 | 3300041501 | Bacteria | 919 |
| 210 | Ga0451846_44962 | 3300041502 | Bacteria | 1013 |
| 211 | Ga0451850_24435 | 3300041506 | Bacteria | 1617 |
| 212 | Ga0451851_0456096 | 3300041507 | Bacteria | 785 |
| 213 | Ga0451843_0429565 | 3300041509 | Bacteria | 3247 |
| 214 | Ga0451855_0262920 | 3300041511 | Bacteria | 1387 |
| 215 | Ga0451853_0932150 | 3300041512 | Bacteria | 2858 |
| 216 | Ga0452271_23420 | 3300041916 | Bacteria | 1167 |
| 217 | Ga0439433_0039980 | 3300041999 | Bacteria | 1090 |
| 218 | Ga0439449_0152855 | 3300042007 | Bacteria | 861 |
| 219 | Ga0466966_0512868 | 3300044684 | Bacteria | 721 |
| 220 | Ga0466963_0271616 | 3300044694 | Bacteria | 1191 |
| 221 | Ga0466968_0067578 | 3300044735 | Bacteria | 1550 |
| 222 | Ga0466970_0004213 | 3300044765 | Bacteria | 7078 |
| 223 | Ga0466970_0096626 | 3300044765 | Bacteria | 1607 |
| 224 | Ga0466960_0069638 | 3300044901 | Bacteria | 1748 |
| 225 | Ga0466958_0622491 | 3300045836 | Bacteria | 702 |
| 226 | Ga0466967_0976422 | 3300045976 | Bacteria | 843 |
| 227 | Ga0495629_0039145 | 3300046459 | Bacteria | 3337 |
| 228 | Ga0495638_0082374 | 3300046460 | Bacteria | 1951 |
| 229 | Ga0495651_0043436 | 3300046462 | Bacteria | 3488 |
| 230 | Ga0495653_0368417 | 3300046463 | Bacteria | 920 |
| 231 | Ga0495639_0088449 | 3300046475 | Bacteria | 1451 |
| 232 | Ga0495662_0032625 | 3300046476 | Bacteria | 2516 |
| 233 | Ga0495585_0056387 | 3300046492 | Bacteria | 2170 |
| 234 | Ga0495585_0162551 | 3300046492 | Bacteria | 1158 |
| 235 | Ga0495606_0144680 | 3300046507 | Bacteria | 1401 |
| 236 | Ga0495618_0186173 | 3300046514 | Bacteria | 1318 |
| 237 | Ga0495628_0045009 | 3300046516 | Bacteria | 3510 |
| 238 | Ga0495666_0092263 | 3300046526 | Bacteria | 1429 |
| 239 | Ga0495640_0092724 | 3300046533 | Bacteria | 1992 |
| 240 | Ga0495622_0012582 | 3300046557 | Bacteria | 3921 |
| 241 | Ga0495633_0021766 | 3300046558 | Bacteria | 3202 |
| 242 | Ga0495633_0183359 | 3300046558 | Bacteria | 963 |
| 243 | Ga0495656_0643419 | 3300046615 | Bacteria | 569 |
| 244 | Ga0495634_0575656 | 3300046642 | Bacteria | 655 |
| 245 | Ga0495625_0243184 | 3300046660 | Bacteria | 1171 |
| 246 | Ga0495635_0090827 | 3300046663 | Bacteria | 2089 |
| 247 | Ga0495661_0422501 | 3300046665 | Bacteria | 645 |
| 248 | Ga0495588_0001225 | 3300046674 | Bacteria | 11061 |
| 249 | Ga0495657_0041037 | 3300046675 | Bacteria | 3170 |
| 250 | Ga0495658_0029296 | 3300046683 | Bacteria | 2979 |
| 251 | Ga0495613_0756144 | 3300046689 | Bacteria | 637 |
| 252 | Ga0495600_0131859 | 3300046809 | Bacteria | 1624 |
| 253 | Ga0495604_0058840 | 3300047317 | Bacteria | 2949 |
| 254 | Ga0495676_0382676 | 3300047321 | Bacteria | 936 |
| 255 | Ga0495683_0284816 | 3300047323 | Bacteria | 714 |
| 256 | Ga0495681_0042887 | 3300047470 | Bacteria | 2186 |
| 257 | Ga0495686_0070708 | 3300047472 | Bacteria | 2150 |
| 258 | Ga0495686_0151862 | 3300047472 | Bacteria | 1359 |
| 259 | Ga0495602_0816187 | 3300048088 | Bacteria | 625 |
| 260 | Ga0496103_0005774 | 3300048906 | Bacteria | 7388 |
| 261 | Ga0496104_0827853 | 3300048907 | Bacteria | 831 |
| 262 | Ga0496112_0632430 | 3300048915 | Bacteria | 1001 |
| 263 | Ga0496113_0074829 | 3300048916 | Bacteria | 2583 |
| 264 | Ga0496114_0445459 | 3300048917 | Bacteria | 1147 |
| 265 | Ga0496116_0000061 | 3300048919 | Bacteria | 271860 |
| 266 | Ga0496116_0013279 | 3300048919 | Bacteria | 6658 |
| 267 | Ga0496116_0045233 | 3300048919 | Bacteria | 2982 |
| 268 | Ga0496116_0282763 | 3300048919 | Bacteria | 802 |
| 269 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 270 | Ga0496117_0001684 | 3300048920 | Bacteria | 30795 |
| 271 | Ga0496117_0033913 | 3300048920 | Bacteria | 3854 |
| 272 | Ga0496117_0251379 | 3300048920 | Bacteria | 964 |
| 273 | Ga0496118_0000460 | 3300048921 | Bacteria | 67445 |
| 274 | Ga0496118_0000756 | 3300048921 | Bacteria | 52299 |
| 275 | Ga0496118_0044985 | 3300048921 | Bacteria | 3451 |
| 276 | Ga0496118_0045994 | 3300048921 | Bacteria | 3400 |
| 277 | Ga0496118_0073755 | 3300048921 | Bacteria | 2443 |
| 278 | Ga0496119_0009961 | 3300048922 | Bacteria | 8058 |
| 279 | Ga0496119_0021313 | 3300048922 | Bacteria | 4689 |
| 280 | Ga0496120_0000078 | 3300048923 | Bacteria | 162312 |
| 281 | Ga0496120_0005495 | 3300048923 | Bacteria | 10088 |
| 282 | Ga0496120_0027751 | 3300048923 | Bacteria | 3477 |
| 283 | Ga0496120_0436944 | 3300048923 | Bacteria | 572 |
| 284 | Ga0496120_0505738 | 3300048923 | Bacteria | 518 |
| 285 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 286 | Ga0496121_0001247 | 3300048924 | Bacteria | 44170 |
| 287 | Ga0496121_0038531 | 3300048924 | Bacteria | 4229 |
| 288 | Ga0496121_0152962 | 3300048924 | Bacteria | 1695 |
| 289 | Ga0496121_0306688 | 3300048924 | Bacteria | 1075 |
| 290 | Ga0496121_0491537 | 3300048924 | Bacteria | 781 |
| 291 | Ga0496121_0501856 | 3300048924 | Bacteria | 770 |
| 292 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 293 | Ga0496122_0012559 | 3300048925 | Bacteria | 8410 |
| 294 | Ga0496122_0013836 | 3300048925 | Bacteria | 7856 |
| 295 | Ga0496122_0031709 | 3300048925 | Bacteria | 4389 |
| 296 | Ga0496122_0037942 | 3300048925 | Bacteria | 3868 |
| 297 | Ga0496122_0088691 | 3300048925 | Bacteria | 2118 |
| 298 | Ga0496122_0236302 | 3300048925 | Bacteria | 1034 |
| 299 | Ga0496122_0616777 | 3300048925 | Bacteria | 504 |
| 300 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 301 | Ga0496123_0012058 | 3300048926 | Bacteria | 7411 |
| 302 | Ga0496123_0151979 | 3300048926 | Bacteria | 1247 |
| 303 | Ga0496123_0174681 | 3300048926 | Bacteria | 1129 |
| 304 | Ga0496123_0199911 | 3300048926 | Bacteria | 1025 |
| 305 | Ga0496123_0376627 | 3300048926 | Bacteria | 652 |
| 306 | Ga0496124_0000112 | 3300048927 | Bacteria | 166282 |
| 307 | Ga0496124_0015634 | 3300048927 | Bacteria | 7264 |
| 308 | Ga0496124_0029389 | 3300048927 | Bacteria | 4899 |
| 309 | Ga0496124_0070150 | 3300048927 | Bacteria | 2908 |
| 310 | Ga0496124_0154215 | 3300048927 | Bacteria | 1798 |
| 311 | Ga0496124_0290244 | 3300048927 | Bacteria | 1187 |
| 312 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 313 | Ga0496125_0028452 | 3300048928 | Bacteria | 5048 |
| 314 | Ga0496125_0203684 | 3300048928 | Bacteria | 1292 |
| 315 | Ga0496126_0000397 | 3300048929 | Bacteria | 89305 |
| 316 | Ga0496126_0052378 | 3300048929 | Bacteria | 3710 |
| 317 | Ga0496126_0099260 | 3300048929 | Bacteria | 2550 |
| 318 | Ga0501034_0027452 | 3300049571 | Bacteria | 5791 |
| 319 | Ga0501034_0248837 | 3300049571 | Bacteria | 1722 |
| 320 | Ga0501038_0852827 | 3300049574 | Bacteria | 674 |
| 321 | Ga0501041_0282908 | 3300049577 | Bacteria | 1044 |
| 322 | Ga0501075_0540134 | 3300049591 | Bacteria | 890 |
| 323 | Ga0501076_0374757 | 3300049592 | Bacteria | 1170 |
| 324 | Ga0501077_0820847 | 3300049593 | Bacteria | 598 |
| 325 | Ga0501238_076260 | 3300049671 | Bacteria | 525 |
| 326 | Ga0501081_0125733 | 3300049743 | Bacteria | 1829 |
| 327 | Ga0501280_005471 | 3300049776 | Bacteria | 1815 |
| 328 | nmdc:mga03683_10679_c1 | 3300050489 | Bacteria | 3299 |
| 329 | nmdc:mga03n38_73294_c1 | 3300050490 | Bacteria | 1590 |
| 330 | nmdc:mga00v17_153564_c1 | 3300050491 | Bacteria | 1480 |
| 331 | nmdc:mga00v17_444949_c1 | 3300050491 | Bacteria | 841 |
| 332 | nmdc:mga00v17_80_c1 | 3300050491 | Bacteria | 58183 |
| 333 | nmdc:mga0yw44_323535_c1 | 3300050492 | Bacteria | 1036 |
| 334 | nmdc:mga0yw44_391458_c1 | 3300050492 | Bacteria | 939 |
| 335 | nmdc:mga0yw44_45095_c1 | 3300050492 | Bacteria | 2641 |
| 336 | nmdc:mga0k408_114871_c1 | 3300050493 | Bacteria | 1224 |
| 337 | nmdc:mga0k408_555272_c1 | 3300050493 | Bacteria | 679 |
| 338 | nmdc:mga0k408_643689_c1 | 3300050493 | Bacteria | 624 |
| 339 | nmdc:mga06z11_248270_c1 | 3300050494 | Bacteria | 1047 |
| 340 | nmdc:mga06z11_411576_c1 | 3300050494 | Bacteria | 815 |
| 341 | nmdc:mga04h51_105456_c1 | 3300050495 | Bacteria | 1033 |
| 342 | nmdc:mga07m45_187475_c1 | 3300050496 | Bacteria | 1203 |
| 343 | nmdc:mga07m45_297585_c1 | 3300050496 | Bacteria | 939 |
| 344 | nmdc:mga0sz30_198681_c1 | 3300050516 | Bacteria | 890 |
| 345 | nmdc:mga0sz30_8434_c1 | 3300050516 | Bacteria | 3893 |
| 346 | Ga0495619_0179729 | 3300053085 | Bacteria | 1464 |
| 347 | Ga0500644_0052166 | 3300053088 | Bacteria | 1407 |
| 348 | Ga0500646_0332894 | 3300053090 | Bacteria | 550 |
| 349 | Ga0500560_067141 | 3300053107 | Bacteria | 1177 |
| 350 | Ga0500607_189560 | 3300053121 | Bacteria | 900 |
| 351 | Ga0500608_021456 | 3300053122 | Bacteria | 2985 |
| 352 | Ga0500614_174722 | 3300053123 | Bacteria | 655 |
| 353 | Ga0500618_000510 | 3300053125 | Bacteria | 24654 |
| 354 | Ga0500561_0000062 | 3300053137 | Bacteria | 21493 |
| 355 | Ga0500568_0041443 | 3300053139 | Bacteria | 1850 |
| 356 | Ga0500573_0003702 | 3300053140 | Bacteria | 7954 |
| 357 | Ga0500590_014477 | 3300053148 | Bacteria | 4066 |
| 358 | Ga0500616_0000647 | 3300053153 | Bacteria | 41713 |
| 359 | Ga0500616_0073580 | 3300053153 | Bacteria | 1734 |
| 360 | Ga0500619_215789 | 3300053154 | Bacteria | 640 |
| 361 | Ga0500622_0000158 | 3300053156 | Bacteria | 71215 |
| 362 | Ga0500624_000357 | 3300053157 | Bacteria | 14815 |
| 363 | Ga0500627_0004905 | 3300053158 | Bacteria | 4371 |
| 364 | Ga0500627_0092249 | 3300053158 | Bacteria | 1356 |
| 365 | Ga0500627_0112499 | 3300053158 | Bacteria | 1226 |
| 366 | Ga0500634_0054472 | 3300053161 | Bacteria | 2143 |
| 367 | Ga0500636_0000019 | 3300053177 | Bacteria | 105042 |
| 368 | Ga0500636_0001577 | 3300053177 | Bacteria | 12406 |
| 369 | Ga0500636_0349540 | 3300053177 | Bacteria | 706 |
| 370 | Ga0587073_0123744 | 3300059492 | Bacteria | 701 |
| 371 | Ga0587073_0168309 | 3300059492 | Bacteria | 634 |
| 372 | Ga0587080_021315 | 3300059503 | Bacteria | 1065 |
| 373 | Ga0587082_095103 | 3300059504 | Bacteria | 641 |
| 374 | Ga0587086_097385 | 3300059507 | Bacteria | 538 |
| 375 | Ga0587088_010730 | 3300059508 | Bacteria | 1349 |
| 376 | Ga0587089_101380 | 3300059509 | Bacteria | 523 |
| 377 | Ga0587099_002533 | 3300059622 | Bacteria | 1448 |
| 378 | Ga0587068_150723 | 3300059641 | Bacteria | 526 |
| 379 | Ga0587069_028962 | 3300059642 | Bacteria | 883 |
| 380 | Ga0587075_125420 | 3300059644 | Bacteria | 535 |
| 381 | Ga0587076_081239 | 3300059645 | Bacteria | 692 |
| 382 | Ga0587071_151812 | 3300060344 | Bacteria | 576 |
| 383 | Ga0587111_0207985 | 3300060346 | Bacteria | 558 |
| 384 | Ga0501082_0469705 | 3300060353 | Bacteria | 1099 |
| 385 | 2509442688 | 2509276033 | Bacteria | 7180565 |
| 386 | 2510132767 | 2510065019 | Bacteria | 6903379 |
| 387 | 2511132482 | 2510917022 | Bacteria | 6504556 |
| 388 | 2511391417 | 2511231027 | Bacteria | 5013807 |
| 389 | 2513632908 | 2513237093 | Bacteria | 7545552 |
| 390 | 2513710360 | 2513237103 | Bacteria | 7647401 |
| 391 | 2515111712 | 2515075009 | Bacteria | 7288508 |
| 392 | 2515634798 | 2515154113 | Bacteria | 7807172 |
| 393 | 2517040404 | 2516653077 | Bacteria | 7555578 |
| 394 | 2517094475 | 2517093000 | Bacteria | 7412387 |
| 395 | 2524461303 | 2524023209 | Bacteria | 6679728 |
| 396 | 2530645005 | 2529292951 | Bacteria | 6916614 |
| 397 | 2537875957 | 2537561587 | Bacteria | 5425293 |
| 398 | 2554247787 | 2554235003 | Bacteria | 5877155 |
| 399 | 2559294920 | 2558860242 | Bacteria | 5568029 |
| 400 | 2561468944 | 2558860983 | Bacteria | 4133860 |
| 401 | 2585168363 | 2582581283 | Bacteria | 6030556 |
| 402 | 2585232503 | 2582581299 | Bacteria | 6518058 |
| 403 | 2585272907 | 2582581307 | Bacteria | 6597605 |
| 404 | 2585276841 | 2582581308 | Bacteria | 7413247 |
| 405 | 2585324160 | 2582581315 | Bacteria | 7318924 |
| 406 | 2585333447 | 2582581316 | Bacteria | 7774528 |
| 407 | 2585534856 | 2585427527 | Bacteria | 7273426 |
| 408 | 2585540250 | 2585427528 | Bacteria | 6842387 |
| 409 | 2585551699 | 2585427530 | Bacteria | 7383882 |
| 410 | 2585558185 | 2585427531 | Bacteria | 6992870 |
| 411 | 2585838448 | 2585427593 | Bacteria | 7141551 |
| 412 | 2585897579 | 2585427608 | Bacteria | 6544331 |
| 413 | 2585904827 | 2585427609 | Bacteria | 6667127 |
| 414 | 2587980057 | 2585428125 | Bacteria | 6662905 |
| 415 | 2599604181 | 2599185210 | Bacteria | 5624189 |
| 416 | 2600192390 | 2599185352 | Bacteria | 7228948 |
| 417 | 2601608026 | 2600255279 | Bacteria | 5605316 |
| 418 | 2601744801 | 2600255308 | Bacteria | 5611129 |
| 419 | 2616308214 | 2615840626 | Bacteria | 7921970 |
| 420 | 2616556764 | 2615840698 | Bacteria | 7319877 |
| 421 | 2617381569 | 2617270742 | Bacteria | 6808054 |
| 422 | 2643808471 | 2643221557 | Bacteria | 7184309 |
| 423 | 2643812134 | 2643221558 | Bacteria | 5460675 |
| 424 | 2644005979 | 2643221599 | Bacteria | 6292121 |
| 425 | 2644049499 | 2643221607 | Bacteria | 6314006 |
| 426 | 2644066436 | 2643221610 | Bacteria | 7480339 |
| 427 | 2644193196 | 2643221634 | Bacteria | 6705461 |
| 428 | 2644204093 | 2643221636 | Bacteria | 6583769 |
| 429 | 2644210998 | 2643221637 | Bacteria | 5345260 |
| 430 | 2644238198 | 2643221643 | Bacteria | 5749658 |
| 431 | 2644300216 | 2643221653 | Bacteria | 4569637 |
| 432 | 2644378024 | 2643221668 | Bacteria | 7306521 |
| 433 | 2644415351 | 2643221675 | Bacteria | 7473456 |
| 434 | 2644450248 | 2643221680 | Bacteria | 7473610 |
| 435 | 2644482533 | 2643221686 | Bacteria | 6310811 |
| 436 | 2644499036 | 2643221689 | Bacteria | 6042950 |
| 437 | 2644522313 | 2643221693 | Bacteria | 5513853 |
| 438 | 2644654653 | 2643221718 | Bacteria | 5345506 |
| 439 | 2644658442 | 2643221719 | Bacteria | 4568197 |
| 440 | 2644677965 | 2643221723 | Bacteria | 7095460 |
| 441 | 2644687800 | 2643221726 | Bacteria | 7455827 |
| 442 | 2671115611 | 2667528174 | Bacteria | 6435400 |
| 443 | 2719385259 | 2718217927 | Bacteria | 6972593 |
| 444 | 2721398980 | 2718218423 | Bacteria | 6438183 |
| 445 | 2724037793 | 2721755809 | Bacteria | 6438790 |
| 446 | 2725951731 | 2724679232 | Bacteria | 7646494 |
| 447 | 2757569988 | 2757320392 | Bacteria | 3737298 |
| 448 | 2765465060 | 2765235802 | Bacteria | 5618596 |
| 449 | 2766068046 | 2765235942 | Bacteria | 7445910 |
| 450 | 2770198227 | 2767802442 | Bacteria | 5747986 |
| 451 | 2776271165 | 2775506902 | Bacteria | 6208009 |
| 452 | 2776280838 | 2775506904 | Bacteria | 5954060 |
| 453 | 2778176356 | 2775507266 | Bacteria | 7392367 |
| 454 | 2793297033 | 2791355256 | Bacteria | 6798008 |
| 455 | 2793315605 | 2791355259 | Bacteria | 7254731 |
| 456 | 2793321359 | 2791355260 | Bacteria | 6598818 |
| 457 | 2793330008 | 2791355261 | Bacteria | 6661293 |
| 458 | 2793335227 | 2791355262 | Bacteria | 6774204 |
| 459 | 2793342699 | 2791355263 | Bacteria | 6872478 |
| 460 | 2793352138 | 2791355265 | Bacteria | 6539969 |
| 461 | 2793360500 | 2791355266 | Bacteria | 7116587 |
| 462 | 2793366287 | 2791355267 | Bacteria | 7222458 |
| 463 | 2805930056 | 2802429605 | Bacteria | 6875453 |
| 464 | 2806045652 | 2802429633 | Bacteria | 7341974 |
| 465 | 2806072879 | 2802429637 | Bacteria | 7067217 |
| 466 | 2808985310 | 2808606387 | Bacteria | 5697198 |
| 467 | 2819242167 | 2818991272 | Bacteria | 4622173 |
| 468 | 2819559743 | 2818991439 | Bacteria | 6907412 |
| 469 | 2819610526 | 2818991448 | Bacteria | 6772224 |
| 470 | 2819638273 | 2818991453 | Bacteria | 7181617 |
| 471 | 2837683120 | 2837678835 | Bacteria | 5252418 |
| 472 | 2838022694 | 2838022645 | Bacteria | 6494267 |
| 473 | 2838032299 | 2838029111 | Bacteria | 6603031 |
| 474 | 2838047687 | 2838042994 | Bacteria | 6046894 |
| 475 | 2838676154 | 2838675328 | Bacteria | 4909118 |
| 476 | 2838682761 | 2838680041 | Bacteria | 6545511 |
| 477 | 2838697395 | 2838694306 | Bacteria | 6853137 |
| 478 | 2838709427 | 2838707686 | Bacteria | 6619912 |
| 479 | 2838715036 | 2838714209 | Bacteria | 5525906 |
| 480 | 2838721164 | 2838719591 | Bacteria | 5523910 |
| 481 | 2838725795 | 2838724970 | Bacteria | 4908691 |
| 482 | 2839994998 | 2839993093 | Bacteria | 5512535 |
| 483 | 2840767887 | 2840764183 | Bacteria | 6358399 |
| 484 | 2841848121 | 2841846520 | Bacteria | 5345850 |
| 485 | 2841859328 | 2841859092 | Bacteria | 5436171 |
| 486 | 2841865067 | 2841864319 | Bacteria | 6742987 |
| 487 | 2842077538 | 2842077413 | Bacteria | 6508645 |
| 488 | 2842111058 | 2842110456 | Bacteria | 7656360 |
| 489 | 2842119953 | 2842118031 | Bacteria | 7033875 |
| 490 | 2842125849 | 2842124991 | Bacteria | 5346824 |
| 491 | 2842131048 | 2842130223 | Bacteria | 4909145 |
| 492 | 2842153782 | 2842152218 | Bacteria | 4908957 |
| 493 | 2842171279 | 2842170452 | Bacteria | 5525737 |
| 494 | 2842177402 | 2842175837 | Bacteria | 4908771 |
| 495 | 2842188144 | 2842187318 | Bacteria | 5524014 |
| 496 | 2842201479 | 2842198810 | Bacteria | 6608673 |
| 497 | 2842206575 | 2842205361 | Bacteria | 6340321 |
| 498 | 2842212455 | 2842211629 | Bacteria | 5523832 |
| 499 | 2842220470 | 2842217011 | Bacteria | 7497767 |
| 500 | 2842225926 | 2842224351 | Bacteria | 5524473 |
| 501 | 2842238840 | 2842237096 | Bacteria | 6620661 |
| 502 | 2842280032 | 2842278818 | Bacteria | 6340002 |
| 503 | 2842287661 | 2842285085 | Bacteria | 6011953 |
| 504 | 2842291200 | 2842291075 | Bacteria | 7076806 |
| 505 | 2842302893 | 2842298080 | Bacteria | 6123127 |
| 506 | 2842318419 | 2842317721 | Bacteria | 6793725 |
| 507 | 2842347060 | 2842341865 | Bacteria | 7003929 |
| 508 | 2842362569 | 2842357229 | Bacteria | 6485165 |
| 509 | 2842366892 | 2842363717 | Bacteria | 6844742 |
| 510 | 2842373391 | 2842370503 | Bacteria | 7038661 |
| 511 | 2842377596 | 2842377471 | Bacteria | 7140707 |
| 512 | 2842386463 | 2842384541 | Bacteria | 7057858 |
| 513 | 2842399652 | 2842395702 | Bacteria | 6780583 |
| 514 | 2842404810 | 2842402390 | Bacteria | 6681310 |
| 515 | 2842411393 | 2842409023 | Bacteria | 6687331 |
| 516 | 2842418156 | 2842415677 | Bacteria | 6596907 |
| 517 | 2842479072 | 2842475841 | Bacteria | 6603183 |
| 518 | 2842500606 | 2842495871 | Bacteria | 6820686 |
| 519 | 2842506208 | 2842502639 | Bacteria | 6604161 |
| 520 | 2842510085 | 2842509118 | Bacteria | 6850950 |
| 521 | 2842516112 | 2842515876 | Bacteria | 5436280 |
| 522 | 2852389475 | 2852387548 | Bacteria | 8025568 |
| 523 | 2857523038 | 2857516855 | Bacteria | 7787325 |
| 524 | 2894656441 | 2894652903 | Bacteria | 4587256 |
| 525 | 2896387049 | 2896384573 | Bacteria | 7700774 |
| 526 | 2899794198 | 2899792073 | Bacteria | 4926588 |
| 527 | 2899807416 | 2899803654 | Bacteria | 5577784 |
| 528 | 2899846503 | 2899845264 | Bacteria | 5672268 |
| 529 | 2904581044 | 2904578770 | Bacteria | 5302906 |
| 530 | 2917556863 | 2917554339 | Bacteria | 4987857 |
| 531 | 2919115127 | 2919114240 | Bacteria | 5700270 |
| 532 | 2919121163 | 2919119836 | Bacteria | 5208557 |
| 533 | 2919409659 | 2919408235 | Bacteria | 6149349 |
| 534 | 2920824280 | 2920822456 | Bacteria | 6897201 |
| 535 | 2926756172 | 2926754445 | Bacteria | 5964435 |
| 536 | 2926760404 | 2926760298 | Bacteria | 5505990 |
| 537 | 2928523505 | 2928521798 | Bacteria | 4960112 |
| 538 | 2929139803 | 2929138655 | Bacteria | 5810547 |
| 539 | 2933008428 | 2933006813 | Bacteria | 4912075 |
| 540 | 2933013244 | 2933011516 | Bacteria | 5439334 |
| 541 | 2933587083 | 2933586486 | Bacteria | 7667493 |
| 542 | 2933597933 | 2933594066 | Bacteria | 5594265 |
| 543 | 2935900471 | 2935894831 | Bacteria | 6620579 |
| 544 | 2936384697 | 2936381700 | Bacteria | 7006523 |
| 545 | 2937846093 | 2937843397 | Bacteria | 5256375 |
| 546 | 2941499765 | 2941499720 | Bacteria | 7599444 |
| 547 | 2954015786 | 2954011201 | Bacteria | 4762601 |
| 548 | 2979094321 | 2979089926 | Bacteria | 5670289 |
| 549 | 2979098298 | 2979095461 | Bacteria | 5669583 |
| 550 | 2979103554 | 2979100975 | Bacteria | 5423623 |
| 551 | 2984511878 | 2984509177 | Bacteria | 5274802 |
| 552 | 2984521762 | 2984518228 | Bacteria | 5277463 |
| 553 | 2984541059 | 2984537506 | Bacteria | 5277481 |
| 554 | 2984603340 | 2984601300 | Bacteria | 5455244 |
| 555 | 2989776084 | 2989771324 | Bacteria | 5605128 |
| 556 | 2989778556 | 2989776772 | Bacteria | 4843317 |
| 557 | 2996892325 | 2996887358 | Bacteria | 5795980 |
| 558 | 2996893909 | 2996893221 | Bacteria | 5823108 |
| 559 | 3002144158 | 3002141150 | Bacteria | 5254435 |
| 560 | 3003933284 | 3003930520 | Bacteria | 5667563 |
| 561 | 3005453826 | 3005452660 | Bacteria | 5889319 |
| 562 | 639647921 | 639633055 | Bacteria | 7751309 |
| 563 | 650740176 | 650716007 | Bacteria | 5573770 |
| 564 | 8002285586 | 8002285264 | Bacteria | 6717907 |
| 565 | 8005259607 | 8005258706 | Bacteria | 6184835 |
| 566 | 8005280065 | 8005275841 | Bacteria | 6929066 |
| 567 | 8005294643 | 8005289223 | Bacteria | 6634003 |
| 568 | 8005307183 | 8005301065 | Bacteria | 6614431 |
| 569 | 8005326852 | 8005321885 | Bacteria | 5795980 |
| 570 | 8005462368 | 8005460587 | Bacteria | 7157962 |
| 571 | 8005486504 | 8005484373 | Bacteria | 6297373 |
| 572 | 8005544746 | 8005542996 | Bacteria | 7077758 |
| 573 | 8005558266 | 8005556819 | Bacteria | 6908598 |
| 574 | 8005569447 | 8005563573 | Bacteria | 7153261 |
| 575 | 8005646417 | 8005645114 | Bacteria | 6950293 |
| 576 | 8005686480 | 8005682033 | Bacteria | 6726518 |
| 577 | 8005695093 | 8005688590 | Bacteria | 6610080 |
| 578 | 8005696322 | 8005695170 | Bacteria | 6912330 |
| 579 | 8018152619 | 8018150411 | Bacteria | 5549903 |
| 580 | 8018167943 | 8018163183 | Bacteria | 7277977 |
| 581 | 8024485594 | 8024479707 | Bacteria | 6954785 |
| 582 | 8024505064 | 8024501048 | Bacteria | 6427847 |
| 583 | 8045865152 | 8045864390 | Bacteria | 5043873 |
| 584 | 8046768593 | 8046767195 | Bacteria | 7547379 |
| 585 | 8056379997 | 8056375014 | Bacteria | 7006639 |
| 586 | 8056387707 | 8056382006 | Bacteria | 6408074 |
| 587 | 8056876699 | 8056875544 | Bacteria | 4355797 |
| 588 | 8057578127 | 8057575449 | Bacteria | 7367519 |
| 589 | 8057875646 | 8057874678 | Bacteria | 7494653 |
| 590 | Ga0081455_10638707 | |||
| 591 | JGI25155J39150_1000011 | |||
| 592 | JGI25156J39149_1000027 | |||
| 593 | JGI25162J39368_1000963 | |||
| 594 | JGI25154J39366_1000181 | |||
| 595 | JGI25157J39369_1000010 | |||
| 596 | JGI25159J45721_1000006 | |||
| 597 | JGI25159J45721_1002092 | |||
| 598 | JGI25151J46595_10000326 | |||
| 599 | JGI25151J46595_10002380 | |||
| 600 | JGI25151J46595_10018050 | |||
| 601 | JGI25151J46595_10026360 | |||
| 602 | JGI25165J46597_1000900 | |||
| 603 | JGI25165J46597_1000920 | |||
| 604 | JGI25165J46597_1001027 | |||
| 605 | JGI25153J46596_10102139 | |||
| 606 | rootH1_10012915 | |||
| 607 | rootL2_10018543 | |||
| 608 | JGI25160J50197_1000004 | |||
| 609 | JGI25160J50197_1000019 | |||
| 610 | JGI25161J50226_1000003 | |||
| 611 | JGI25161J50226_1000467 | |||
| 612 | Ga0006562J51391_1008590 | |||
| 613 | Ga0006562J51391_1053935 | |||
| 614 | Ga0055539_1004307 | |||
| 615 | Ga0055526_1000462 | |||
| 616 | Ga0055524_1035440 | |||
| 617 | Ga0055536_1002723 | |||
| 618 | Ga0055530_10011193 | |||
| 619 | Ga0055540_1002665 | |||
| 620 | Ga0055540_1014671 | |||
| 621 | Ga0055531_10002882 | |||
| 622 | Ga0055531_10003417 | |||
| 623 | Ga0055531_10075107 | |||
| 624 | Ga0058692_1002873 | |||
| 625 | Ga0058692_1039309 | |||
| 626 | Ga0055543_1000001 | |||
| 627 | Ga0055543_1000275 | |||
| 628 | Ga0065165_1000149 | |||
| 629 | Ga0065165_1000272 | |||
| 630 | Ga0065704_10206666 | |||
| 631 | Ga0070669_100490185 | |||
| 632 | Ga0070678_100546319 | |||
| 633 | Ga0070707_101166976 | |||
| 634 | Ga0068853_101803677 | |||
| 635 | Ga0070672_100618594 | |||
| 636 | Ga0070665_100025262 | |||
| 637 | Ga0070665_100040711 | |||
| 638 | Ga0068856_100389696 | |||
| 639 | Ga0068852_100040901 | |||
| 640 | Ga0068866_11388406 | |||
| 641 | Ga0068861_100464409 | |||
| 642 | Ga0068851_10072973 | |||
| 643 | Ga0068858_101561116 | |||
| 644 | Ga0081455_10965889 | |||
| 645 | Ga0075365_10135802 | |||
| 646 | Ga0075365_10432131 | |||
| 647 | Ga0075368_10151362 | |||
| 648 | Ga0075368_10542853 | |||
| 649 | Ga0075363_100012575 | |||
| 650 | Ga0075364_10001918 | |||
| 651 | Ga0075364_10402263 | |||
| 652 | Ga0075362_10100273 | |||
| 653 | Ga0075367_10006256 | |||
| 654 | Ga0075367_10345775 | |||
| 655 | Ga0075370_10014017 | |||
| 656 | Ga0075370_10028124 | |||
| 657 | Ga0075370_10436392 | |||
| 658 | Ga0079104_1000129 | |||
| 659 | Ga0099826_10002926 | |||
| 660 | Ga0099826_10023176 | |||
| 661 | Ga0105240_10000005 | |||
| 662 | Ga0105247_10137204 | |||
| 663 | Ga0105243_10005858 | |||
| 664 | Ga0105242_12822471 | |||
| 665 | Ga0105248_10764104 | |||
| 666 | Ga0105237_10001991 | |||
| 667 | Ga0105249_12185818 | |||
| 668 | Ga0105249_12194975 | |||
| 669 | Ga0123341_1000001 | |||
| 670 | Ga0123342_1023582 | |||
| 671 | Ga0105239_10003100 | |||
| 672 | Ga0105246_10665759 | |||
| 673 | Ga0157319_1004456 | |||
| 674 | Ga0157373_10005196 | |||
| 675 | Ga0157371_10000015 | |||
| 676 | Ga0157370_10000309 | |||
| 677 | Ga0157370_10000665 | |||
| 678 | Ga0157369_10281895 | |||
| 679 | Ga0157369_10398896 | |||
| 680 | Ga0157369_10415738 | |||
| 681 | Ga0171463_1011 | |||
| 682 | Ga0163162_10848509 | |||
| 683 | Ga0157372_10567411 | |||
| 684 | Ga0157372_10985243 | |||
| 685 | Ga0182007_10000998 | |||
| 686 | Ga0182005_1009577 | |||
| 687 | Ga0183363_1143 | |||
| 688 | Ga0206349_1725640 | |||
| 689 | Ga0154015_1207814 | |||
| 690 | Ga0228711_1000528 | |||
| 691 | Ga0228710_1000006 | |||
| 692 | Ga0209435_100022 | |||
| 693 | Ga0209436_100390 | |||
| 694 | Ga0209672_101326 | |||
| 695 | Ga0209672_115196 | |||
| 696 | Ga0209437_100153 | |||
| 697 | Ga0209437_100201 | |||
| 698 | Ga0209437_108911 | |||
| 699 | Ga0207425_1014295 | |||
| 700 | Ga0207425_1037107 | |||
| 701 | Ga0207425_1074758 | |||
| 702 | Ga0209646_1000078 | |||
| 703 | Ga0209026_1000065 | |||
| 704 | Ga0209026_1054798 | |||
| 705 | Ga0209677_101154 | |||
| 706 | Ga0209148_1015119 | |||
| 707 | Ga0209759_1000055 | |||
| 708 | Ga0209759_1026496 | |||
| 709 | Ga0209129_1000470 | |||
| 710 | Ga0209129_1013211 | |||
| 711 | Ga0209129_1054669 | |||
| 712 | Ga0209233_1000175 | |||
| 713 | Ga0209233_1000226 | |||
| 714 | Ga0209233_1000248 | |||
| 715 | Ga0209455_1027369 | |||
| 716 | Ga0209455_1028396 | |||
| 717 | Ga0209673_1003247 | |||
| 718 | Ga0209130_1000007 | |||
| 719 | Ga0209130_1000012 | |||
| 720 | Ga0209676_1002948 | |||
| 721 | Ga0209025_1000033 | |||
| 722 | Ga0209025_1000097 | |||
| 723 | Ga0209025_1000702 | |||
| 724 | Ga0209025_1011412 | |||
| 725 | Ga0209025_1039084 | |||
| 726 | Ga0209025_1083402 | |||
| 727 | Ga0209025_1099196 | |||
| 728 | Ga0209564_1000740 | |||
| 729 | Ga0209758_1000520 | |||
| 730 | Ga0209758_1001887 | |||
| 731 | Ga0209758_1019549 | |||
| 732 | Ga0209050_1004383 | |||
| 733 | Ga0209256_1000319 | |||
| 734 | Ga0209256_1002545 | |||
| 735 | Ga0207426_1000010 | |||
| 736 | Ga0207426_1000111 | |||
| 737 | Ga0209051_1000166 | |||
| 738 | Ga0209051_1003640 | |||
| 739 | Ga0209051_1107050 | |||
| 740 | Ga0209257_1001307 | |||
| 741 | Ga0209257_1003894 | |||
| 742 | Ga0209257_1005270 | |||
| 743 | Ga0207656_10034847 | |||
| 744 | Ga0207695_10000011 | |||
| 745 | Ga0207671_10000276 | |||
| 746 | Ga0207646_11254035 | |||
| 747 | Ga0207681_10445217 | |||
| 748 | Ga0207694_10671638 | |||
| 749 | Ga0207700_11365004 | |||
| 750 | Ga0207709_11096273 | |||
| 751 | Ga0207691_10385241 | |||
| 752 | Ga0207711_10560539 | |||
| 753 | Ga0207712_11398552 | |||
| 754 | Ga0207668_10275568 | |||
| 755 | Ga0207640_10060572 | |||
| 756 | Ga0207703_11360423 | |||
| 757 | Ga0207639_11603234 | |||
| 758 | Ga0207702_10100675 | |||
| 759 | Ga0207698_10095170 | |||
| 760 | Ga0209281_1000036 | |||
| 761 | Ga0209281_1000047 | |||
| 762 | Ga0209281_1000268 | |||
| 763 | Ga0209371_1000178 | |||
| 764 | Ga0209371_1000382 | |||
| 765 | Ga0209371_1001444 | |||
| 766 | Ga0209371_1002027 | |||
| 767 | Ga0209282_1000026 | |||
| 768 | Ga0209282_1000095 | |||
| 769 | Ga0209282_1079392 | |||
| 770 | Ga0209813_10005272 | |||
| 771 | Ga0268266_10025145 | |||
| 772 | Ga0268266_10030382 | |||
| 773 | Ga0268266_10598234 | |||
| 774 | Ga0307515_10000656 | |||
| 775 | Ga0268256_1000837 | |||
| 776 | Ga0268256_1002533 | |||
| 777 | Ga0268256_1014606 | |||
| 778 | Ga0316182_1300461 | |||
| 779 | Ga0307408_101033425 | |||
| 780 | Ga0307407_10662959 | |||
| 781 | Ga0315914_1000008 | |||
| 782 | Ga0307409_100896747 | |||
| 783 | Ga0315913_1000137 | |||
| 784 | Ga0315915_1000014 | |||
| 785 | Ga0373927_0002192 | |||
| 786 | Ga0373925_0016473 | |||
| 787 | Ga0436360_0816593 | |||
| 788 | Ga0439438_068707 | |||
| 789 | Ga0439466_0062925 | |||
| 790 | Ga0439465_0380175 | |||
| 791 | Ga0451795_0672550 | |||
| 792 | Ga0451798_0357052 | |||
| 793 | Ga0451807_0617558 | |||
| 794 | Ga0451833_0164686 | |||
| 795 | Ga0451835_0501641 | |||
| 796 | Ga0451837_0609112 | |||
| 797 | Ga0451841_1387287 | |||
| 798 | Ga0451845_0265737 | |||
| 799 | Ga0451846_44962 | |||
| 800 | Ga0451850_24435 | |||
| 801 | Ga0451851_0456096 | |||
| 802 | Ga0451843_0429565 | |||
| 803 | Ga0451855_0262920 | |||
| 804 | Ga0451853_0932150 | |||
| 805 | Ga0452271_23420 | |||
| 806 | Ga0439433_0039980 | |||
| 807 | Ga0439449_0152855 | |||
| 808 | Ga0466966_0512868 | |||
| 809 | Ga0466963_0271616 | |||
| 810 | Ga0466968_0067578 | |||
| 811 | Ga0466970_0004213 | |||
| 812 | Ga0466970_0096626 | |||
| 813 | Ga0466960_0069638 | |||
| 814 | Ga0466958_0622491 | |||
| 815 | Ga0466967_0976422 | |||
| 816 | Ga0495629_0039145 | |||
| 817 | Ga0495638_0082374 | |||
| 818 | Ga0495651_0043436 | |||
| 819 | Ga0495653_0368417 | |||
| 820 | Ga0495639_0088449 | |||
| 821 | Ga0495662_0032625 | |||
| 822 | Ga0495585_0056387 | |||
| 823 | Ga0495585_0162551 | |||
| 824 | Ga0495606_0144680 | |||
| 825 | Ga0495618_0186173 | |||
| 826 | Ga0495628_0045009 | |||
| 827 | Ga0495666_0092263 | |||
| 828 | Ga0495640_0092724 | |||
| 829 | Ga0495622_0012582 | |||
| 830 | Ga0495633_0021766 | |||
| 831 | Ga0495633_0183359 | |||
| 832 | Ga0495656_0643419 | |||
| 833 | Ga0495634_0575656 | |||
| 834 | Ga0495625_0243184 | |||
| 835 | Ga0495635_0090827 | |||
| 836 | Ga0495661_0422501 | |||
| 837 | Ga0495588_0001225 | |||
| 838 | Ga0495657_0041037 | |||
| 839 | Ga0495658_0029296 | |||
| 840 | Ga0495613_0756144 | |||
| 841 | Ga0495600_0131859 | |||
| 842 | Ga0495604_0058840 | |||
| 843 | Ga0495676_0382676 | |||
| 844 | Ga0495683_0284816 | |||
| 845 | Ga0495681_0042887 | |||
| 846 | Ga0495686_0070708 | |||
| 847 | Ga0495686_0151862 | |||
| 848 | Ga0495602_0816187 | |||
| 849 | Ga0496103_0005774 | |||
| 850 | Ga0496104_0827853 | |||
| 851 | Ga0496112_0632430 | |||
| 852 | Ga0496113_0074829 | |||
| 853 | Ga0496114_0445459 | |||
| 854 | Ga0496116_0000061 | |||
| 855 | Ga0496116_0013279 | |||
| 856 | Ga0496116_0045233 | |||
| 857 | Ga0496116_0282763 | |||
| 858 | Ga0496117_0000002 | |||
| 859 | Ga0496117_0001684 | |||
| 860 | Ga0496117_0033913 | |||
| 861 | Ga0496117_0251379 | |||
| 862 | Ga0496118_0000460 | |||
| 863 | Ga0496118_0000756 | |||
| 864 | Ga0496118_0044985 | |||
| 865 | Ga0496118_0045994 | |||
| 866 | Ga0496118_0073755 | |||
| 867 | Ga0496119_0009961 | |||
| 868 | Ga0496119_0021313 | |||
| 869 | Ga0496120_0000078 | |||
| 870 | Ga0496120_0005495 | |||
| 871 | Ga0496120_0027751 | |||
| 872 | Ga0496120_0436944 | |||
| 873 | Ga0496120_0505738 | |||
| 874 | Ga0496121_0000001 | |||
| 875 | Ga0496121_0001247 | |||
| 876 | Ga0496121_0038531 | |||
| 877 | Ga0496121_0152962 | |||
| 878 | Ga0496121_0306688 | |||
| 879 | Ga0496121_0491537 | |||
| 880 | Ga0496121_0501856 | |||
| 881 | Ga0496122_0000001 | |||
| 882 | Ga0496122_0012559 | |||
| 883 | Ga0496122_0013836 | |||
| 884 | Ga0496122_0031709 | |||
| 885 | Ga0496122_0037942 | |||
| 886 | Ga0496122_0088691 | |||
| 887 | Ga0496122_0236302 | |||
| 888 | Ga0496122_0616777 | |||
| 889 | Ga0496123_0000001 | |||
| 890 | Ga0496123_0012058 | |||
| 891 | Ga0496123_0151979 | |||
| 892 | Ga0496123_0174681 | |||
| 893 | Ga0496123_0199911 | |||
| 894 | Ga0496123_0376627 | |||
| 895 | Ga0496124_0000112 | |||
| 896 | Ga0496124_0015634 | |||
| 897 | Ga0496124_0029389 | |||
| 898 | Ga0496124_0070150 | |||
| 899 | Ga0496124_0154215 | |||
| 900 | Ga0496124_0290244 | |||
| 901 | Ga0496125_0000001 | |||
| 902 | Ga0496125_0028452 | |||
| 903 | Ga0496125_0203684 | |||
| 904 | Ga0496126_0000397 | |||
| 905 | Ga0496126_0052378 | |||
| 906 | Ga0496126_0099260 | |||
| 907 | Ga0501034_0027452 | |||
| 908 | Ga0501034_0248837 | |||
| 909 | Ga0501038_0852827 | |||
| 910 | Ga0501041_0282908 | |||
| 911 | Ga0501075_0540134 | |||
| 912 | Ga0501076_0374757 | |||
| 913 | Ga0501077_0820847 | |||
| 914 | Ga0501238_076260 | |||
| 915 | Ga0501081_0125733 | |||
| 916 | Ga0501280_005471 | |||
| 917 | nmdc:mga03683_10679_c1 | |||
| 918 | nmdc:mga03n38_73294_c1 | |||
| 919 | nmdc:mga00v17_153564_c1 | |||
| 920 | nmdc:mga00v17_444949_c1 | |||
| 921 | nmdc:mga00v17_80_c1 | |||
| 922 | nmdc:mga0yw44_323535_c1 | |||
| 923 | nmdc:mga0yw44_391458_c1 | |||
| 924 | nmdc:mga0yw44_45095_c1 | |||
| 925 | nmdc:mga0k408_114871_c1 | |||
| 926 | nmdc:mga0k408_555272_c1 | |||
| 927 | nmdc:mga0k408_643689_c1 | |||
| 928 | nmdc:mga06z11_248270_c1 | |||
| 929 | nmdc:mga06z11_411576_c1 | |||
| 930 | nmdc:mga04h51_105456_c1 | |||
| 931 | nmdc:mga07m45_187475_c1 | |||
| 932 | nmdc:mga07m45_297585_c1 | |||
| 933 | nmdc:mga0sz30_198681_c1 | |||
| 934 | nmdc:mga0sz30_8434_c1 | |||
| 935 | Ga0495619_0179729 | |||
| 936 | Ga0500644_0052166 | |||
| 937 | Ga0500646_0332894 | |||
| 938 | Ga0500560_067141 | |||
| 939 | Ga0500607_189560 | |||
| 940 | Ga0500608_021456 | |||
| 941 | Ga0500614_174722 | |||
| 942 | Ga0500618_000510 | |||
| 943 | Ga0500561_0000062 | |||
| 944 | Ga0500568_0041443 | |||
| 945 | Ga0500573_0003702 | |||
| 946 | Ga0500590_014477 | |||
| 947 | Ga0500616_0000647 | |||
| 948 | Ga0500616_0073580 | |||
| 949 | Ga0500619_215789 | |||
| 950 | Ga0500622_0000158 | |||
| 951 | Ga0500624_000357 | |||
| 952 | Ga0500627_0004905 | |||
| 953 | Ga0500627_0092249 | |||
| 954 | Ga0500627_0112499 | |||
| 955 | Ga0500634_0054472 | |||
| 956 | Ga0500636_0000019 | |||
| 957 | Ga0500636_0001577 | |||
| 958 | Ga0500636_0349540 | |||
| 959 | Ga0587073_0123744 | |||
| 960 | Ga0587073_0168309 | |||
| 961 | Ga0587080_021315 | |||
| 962 | Ga0587082_095103 | |||
| 963 | Ga0587086_097385 | |||
| 964 | Ga0587088_010730 | |||
| 965 | Ga0587089_101380 | |||
| 966 | Ga0587099_002533 | |||
| 967 | Ga0587068_150723 | |||
| 968 | Ga0587069_028962 | |||
| 969 | Ga0587075_125420 | |||
| 970 | Ga0587076_081239 | |||
| 971 | Ga0587071_151812 | |||
| 972 | Ga0587111_0207985 | |||
| 973 | Ga0501082_0469705 | |||
| 974 | 2509442688 | |||
| 975 | 2510132767 | |||
| 976 | 2511132482 | |||
| 977 | 2511391417 | |||
| 978 | 2513632908 | |||
| 979 | 2513710360 | |||
| 980 | 2515111712 | |||
| 981 | 2515634798 | |||
| 982 | 2517040404 | |||
| 983 | 2517094475 | |||
| 984 | 2524461303 | |||
| 985 | 2530645005 | |||
| 986 | 2537875957 | |||
| 987 | 2554247787 | |||
| 988 | 2559294920 | |||
| 989 | 2561468944 | |||
| 990 | 2585168363 | |||
| 991 | 2585232503 | |||
| 992 | 2585272907 | |||
| 993 | 2585276841 | |||
| 994 | 2585324160 | |||
| 995 | 2585333447 | |||
| 996 | 2585534856 | |||
| 997 | 2585540250 | |||
| 998 | 2585551699 | |||
| 999 | 2585558185 | |||
| 1000 | 2585838448 | |||
| 1001 | 2585897579 | |||
| 1002 | 2585904827 | |||
| 1003 | 2587980057 | |||
| 1004 | 2599604181 | |||
| 1005 | 2600192390 | |||
| 1006 | 2601608026 | |||
| 1007 | 2601744801 | |||
| 1008 | 2616308214 | |||
| 1009 | 2616556764 | |||
| 1010 | 2617381569 | |||
| 1011 | 2643808471 | |||
| 1012 | 2643812134 | |||
| 1013 | 2644005979 | |||
| 1014 | 2644049499 | |||
| 1015 | 2644066436 | |||
| 1016 | 2644193196 | |||
| 1017 | 2644204093 | |||
| 1018 | 2644210998 | |||
| 1019 | 2644238198 | |||
| 1020 | 2644300216 | |||
| 1021 | 2644378024 | |||
| 1022 | 2644415351 | |||
| 1023 | 2644450248 | |||
| 1024 | 2644482533 | |||
| 1025 | 2644499036 | |||
| 1026 | 2644522313 | |||
| 1027 | 2644654653 | |||
| 1028 | 2644658442 | |||
| 1029 | 2644677965 | |||
| 1030 | 2644687800 | |||
| 1031 | 2671115611 | |||
| 1032 | 2719385259 | |||
| 1033 | 2721398980 | |||
| 1034 | 2724037793 | |||
| 1035 | 2725951731 | |||
| 1036 | 2757569988 | |||
| 1037 | 2765465060 | |||
| 1038 | 2766068046 | |||
| 1039 | 2770198227 | |||
| 1040 | 2776271165 | |||
| 1041 | 2776280838 | |||
| 1042 | 2778176356 | |||
| 1043 | 2793297033 | |||
| 1044 | 2793315605 | |||
| 1045 | 2793321359 | |||
| 1046 | 2793330008 | |||
| 1047 | 2793335227 | |||
| 1048 | 2793342699 | |||
| 1049 | 2793352138 | |||
| 1050 | 2793360500 | |||
| 1051 | 2793366287 | |||
| 1052 | 2805930056 | |||
| 1053 | 2806045652 | |||
| 1054 | 2806072879 | |||
| 1055 | 2808985310 | |||
| 1056 | 2819242167 | |||
| 1057 | 2819559743 | |||
| 1058 | 2819610526 | |||
| 1059 | 2819638273 | |||
| 1060 | 2837683120 | |||
| 1061 | 2838022694 | |||
| 1062 | 2838032299 | |||
| 1063 | 2838047687 | |||
| 1064 | 2838676154 | |||
| 1065 | 2838682761 | |||
| 1066 | 2838697395 | |||
| 1067 | 2838709427 | |||
| 1068 | 2838715036 | |||
| 1069 | 2838721164 | |||
| 1070 | 2838725795 | |||
| 1071 | 2839994998 | |||
| 1072 | 2840767887 | |||
| 1073 | 2841848121 | |||
| 1074 | 2841859328 | |||
| 1075 | 2841865067 | |||
| 1076 | 2842077538 | |||
| 1077 | 2842111058 | |||
| 1078 | 2842119953 | |||
| 1079 | 2842125849 | |||
| 1080 | 2842131048 | |||
| 1081 | 2842153782 | |||
| 1082 | 2842171279 | |||
| 1083 | 2842177402 | |||
| 1084 | 2842188144 | |||
| 1085 | 2842201479 | |||
| 1086 | 2842206575 | |||
| 1087 | 2842212455 | |||
| 1088 | 2842220470 | |||
| 1089 | 2842225926 | |||
| 1090 | 2842238840 | |||
| 1091 | 2842280032 | |||
| 1092 | 2842287661 | |||
| 1093 | 2842291200 | |||
| 1094 | 2842302893 | |||
| 1095 | 2842318419 | |||
| 1096 | 2842347060 | |||
| 1097 | 2842362569 | |||
| 1098 | 2842366892 | |||
| 1099 | 2842373391 | |||
| 1100 | 2842377596 | |||
| 1101 | 2842386463 | |||
| 1102 | 2842399652 | |||
| 1103 | 2842404810 | |||
| 1104 | 2842411393 | |||
| 1105 | 2842418156 | |||
| 1106 | 2842479072 | |||
| 1107 | 2842500606 | |||
| 1108 | 2842506208 | |||
| 1109 | 2842510085 | |||
| 1110 | 2842516112 | |||
| 1111 | 2852389475 | |||
| 1112 | 2857523038 | |||
| 1113 | 2894656441 | |||
| 1114 | 2896387049 | |||
| 1115 | 2899794198 | |||
| 1116 | 2899807416 | |||
| 1117 | 2899846503 | |||
| 1118 | 2904581044 | |||
| 1119 | 2917556863 | |||
| 1120 | 2919115127 | |||
| 1121 | 2919121163 | |||
| 1122 | 2919409659 | |||
| 1123 | 2920824280 | |||
| 1124 | 2926756172 | |||
| 1125 | 2926760404 | |||
| 1126 | 2928523505 | |||
| 1127 | 2929139803 | |||
| 1128 | 2933008428 | |||
| 1129 | 2933013244 | |||
| 1130 | 2933587083 | |||
| 1131 | 2933597933 | |||
| 1132 | 2935900471 | |||
| 1133 | 2936384697 | |||
| 1134 | 2937846093 | |||
| 1135 | 2941499765 | |||
| 1136 | 2954015786 | |||
| 1137 | 2979094321 | |||
| 1138 | 2979098298 | |||
| 1139 | 2979103554 | |||
| 1140 | 2984511878 | |||
| 1141 | 2984521762 | |||
| 1142 | 2984541059 | |||
| 1143 | 2984603340 | |||
| 1144 | 2989776084 | |||
| 1145 | 2989778556 | |||
| 1146 | 2996892325 | |||
| 1147 | 2996893909 | |||
| 1148 | 3002144158 | |||
| 1149 | 3003933284 | |||
| 1150 | 3005453826 | |||
| 1151 | 639647921 | |||
| 1152 | 650740176 | |||
| 1153 | 8002285586 | |||
| 1154 | 8005259607 | |||
| 1155 | 8005280065 | |||
| 1156 | 8005294643 | |||
| 1157 | 8005307183 | |||
| 1158 | 8005326852 | |||
| 1159 | 8005462368 | |||
| 1160 | 8005486504 | |||
| 1161 | 8005544746 | |||
| 1162 | 8005558266 | |||
| 1163 | 8005569447 | |||
| 1164 | 8005646417 | |||
| 1165 | 8005686480 | |||
| 1166 | 8005695093 | |||
| 1167 | 8005696322 | |||
| 1168 | 8018152619 | |||
| 1169 | 8018167943 | |||
| 1170 | 8024485594 | |||
| 1171 | 8024505064 | |||
| 1172 | 8045865152 | |||
| 1173 | 8046768593 | |||
| 1174 | 8056379997 | |||
| 1175 | 8056387707 | |||
| 1176 | 8056876699 | |||
| 1177 | 8057578127 | |||
| 1178 | 8057875646 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d2a-assembly2.cif.gz_B-2 | crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters | 0.9134 | 1 | 98 |
| 2d2a-assembly2.cif.gz_B-2 | crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters | 0.8378 | 1 | 98 |
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.8346 | 1 | 98 |
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.8276 | 5 | 98 |
| 2k4z-assembly1.cif.gz_A | solution nmr structure of allochromatium vinosum dsrr: northeast structural genomics consortium target op5 | 0.8248 | 6 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d2aB01 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.9342 | 5 | 98 | 2.60.300.12 |
| 2d2aB01 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.9245 | 5 | 98 | 2.60.300.12 |
| af_A0A0R0F1L8_21_105_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.863 | 5 | 87 | 2.60.300.12 |
| af_I3ITR1_24_129_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8589 | 5 | 110 | 2.60.300.12 |
| af_P77667_17_122_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8554 | 5 | 110 | 2.60.300.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5R2N9K1-F1-model_v4 | Iron-sulfur cluster assembly accessory protein | 0.9362 | 2 | 98 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
| AF-A0A1G1M7N8-F1-model_v4 | FeS cluster biogenesis domain-containing protein | 0.9317 | 5 | 98 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
| AF-A0A7W1ANF1-F1-model_v4 | Iron-sulfur cluster insertion protein ErpA | 0.9196 | 6 | 103 |
GO:0005506
GO:0016226 GO:0051537 GO:0051539 GO:0106035 |
| AF-A0A2X1KGP0-F1-model_v4 | Fe-S cluster assembly protein | 0.9169 | 5 | 98 |
GO:0005829
GO:0016226 GO:0046872 GO:0051537 GO:0097428 |
| AF-A0A0B1SWC3-F1-model_v4 | Iron-sulfur cluster assembly 1 homolog, mitochondrial | 0.9149 | 6 | 98 |
GO:0005739
GO:0016226 GO:0051537 GO:0097428 |