F466846

General Info

Members Datasets Scaffolds Average Seq Length
589 424 448 301

Family's Representative Sequence

Representative Sequence 3300006163|Ga0070715_10130533|Ga0070715_101305332
Length 325
Sequence LNAGQSTSDRDRRTEFLALAGELRPELHRYCARLMGSVIDGEDVVQDTFARALVALGEIEEMPRIRPWLFRIAHNRALDLLRSRAGRKAEPIEAAADVADQTNPDPMEVLMRQEAVKTAVSRFAELPTIQRSVVILKDVLDEPLKDIAELLDLTVDAVKAHLARGRARLREINAHAATLAEARPASAAVARYVTLFNARNWDGLRALLADDVKLHQSTYPVRVGAADVGMFFTIYAKFEGVRLAPAWVEGREVIAVFEDGTDAKPSYFMWLEWRGDRISFIRDYRYARYIVTDAELMLAVDGEACSQQEYPHQDAIVRDQSANGM

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
3 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
4 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
7 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
8 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
9 2512875024 Mesorhizobium loti R88b Isolate Nodule
10 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
11 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
12 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
13 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
14 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
15 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
16 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
17 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
18 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
19 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
20 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
21 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
22 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
23 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
24 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
25 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
26 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
27 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
28 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
29 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
30 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
31 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
32 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
33 2791355260 Rhizobium sp. L9 Isolate Nodule
34 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
35 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
36 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
37 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
38 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
39 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
40 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
41 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
42 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
43 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
44 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
45 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
46 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
47 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
48 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
49 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
50 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
51 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
52 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
53 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
54 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
55 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
56 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
57 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
58 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
59 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
60 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
61 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
62 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
63 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
64 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
65 2904456579 Variovorax sp. 2002 Isolate Unclassified
66 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
67 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
68 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
69 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
70 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
71 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
72 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
73 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
74 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
75 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
76 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
77 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
78 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
79 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
80 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
81 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
82 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
83 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
84 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
85 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
86 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
87 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
88 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
89 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
90 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
91 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
92 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
93 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
94 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
95 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
96 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
97 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
98 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
99 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
100 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
101 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
102 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
103 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
104 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
105 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
106 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
107 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
108 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
109 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
110 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
111 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
112 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
113 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
114 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
115 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
116 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
117 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
118 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
119 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
120 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
121 3004167301 Mesorhizobium loti 582 Isolate Unclassified
122 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
123 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
124 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
125 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
126 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
127 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
128 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
129 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
130 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
131 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
132 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
133 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
134 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
135 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
136 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
137 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
138 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
139 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
140 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
141 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
142 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
143 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
144 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
145 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
146 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
147 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
148 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
149 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
150 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
151 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
152 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
153 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
154 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
155 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
156 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
157 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
158 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
159 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
160 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
161 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
162 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
163 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
164 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
165 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
166 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
167 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
168 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
169 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
170 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
171 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
172 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
173 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
174 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
175 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
176 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
177 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
178 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
179 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
180 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
181 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
182 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
183 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
184 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
185 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
186 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
187 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
188 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
189 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
190 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
191 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
192 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
193 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
194 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
195 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
196 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
197 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
198 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
199 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
200 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
201 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
202 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
203 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
204 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
205 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
206 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
207 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
208 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
209 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
210 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
211 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
212 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
213 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
214 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
215 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
216 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
217 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
218 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
219 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
220 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
221 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
222 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
223 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
224 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
225 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
226 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
229 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
230 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
231 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
232 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
233 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
234 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
235 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
236 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
237 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
238 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
240 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
241 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
280 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
286 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
287 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
288 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
289 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
290 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
291 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
292 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
293 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
294 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
295 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
296 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
297 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
298 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
299 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
300 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
301 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
302 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
303 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
304 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
305 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
306 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
307 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
308 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
309 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
310 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
311 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
312 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
313 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
314 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
315 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
316 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
317 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
318 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
319 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
320 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
321 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
322 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
323 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
324 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
325 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
326 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
327 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
328 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
329 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
330 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
331 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
332 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
333 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
334 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
335 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
336 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
337 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
338 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
339 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
340 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
341 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
342 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
343 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
344 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
345 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
346 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
347 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
348 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
349 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
350 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
351 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
354 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
355 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
356 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
357 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
358 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
359 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
360 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
361 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
362 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
363 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
364 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
365 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
366 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
367 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
368 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
369 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
370 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
371 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
372 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
373 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
374 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
378 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
379 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
380 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
381 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
382 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
386 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
387 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
388 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
391 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
392 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
393 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
394 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
395 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
396 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
397 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
398 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
399 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
400 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
401 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
402 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
403 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
404 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
405 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
406 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
407 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
408 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
409 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
410 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
411 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
412 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
413 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
414 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
415 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
416 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
417 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
418 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
419 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
420 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
421 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
422 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
423 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
424 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.06
Metatranscriptomes 0
Isolates 23.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.45
Nodule 18.68
Rhizoplane 5.43
Rhizosphere 50.59
Stem 0
Stem Tuber 0
Unclassified 9.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000048 3300002739 Bacteria 27557
2 JGI25157J39369_1000275 3300002741 Bacteria 37720
3 JGI25157J39369_1000447 3300002741 Bacteria 26448
4 JGI25152J39213_1003470 3300002773 Bacteria 5366
5 JGI25152J39213_1008106 3300002773 Bacteria 2640
6 JGI25159J45721_1001278 3300002987 Bacteria 10640
7 JGI25159J45721_1004266 3300002987 Bacteria 4803
8 JGI25153J46596_10002410 3300003215 Bacteria 10798
9 JGI25153J46596_10019046 3300003215 Bacteria 2640
10 rootH2_10024597 3300003320 Bacteria 3162
11 JGI25160J50197_1018991 3300003354 Bacteria 2124
12 JGI25160J50197_1027207 3300003354 Bacteria 1562
13 JGI25161J50226_1000267 3300003374 Bacteria 30667
14 Ga0055526_1003629 3300003771 Bacteria 9663
15 Ga0055526_1006240 3300003771 Bacteria 6536
16 Ga0055526_1010616 3300003771 Bacteria 4263
17 Ga0055526_1034022 3300003771 Bacteria 1400
18 Ga0055537_1022897 3300003773 Bacteria 903
19 Ga0055524_1018952 3300003775 Bacteria 2369
20 Ga0055524_1041739 3300003775 Bacteria 1151
21 Ga0055528_1003043 3300003790 Bacteria 8635
22 Ga0055528_1009119 3300003790 Bacteria 4180
23 Ga0055540_1000625 3300003792 Bacteria 25161
24 Ga0055543_1000065 3300004625 Bacteria 97333
25 Ga0065165_1000620 3300005262 Bacteria 51540
26 Ga0065165_1015708 3300005262 Bacteria 2875
27 Ga0070658_10084854 3300005327 Bacteria 2604
28 Ga0070658_10273813 3300005327 Unclassified 1436
29 Ga0070683_100043996 3300005329 Unclassified 4117
30 Ga0070683_100367488 3300005329 Unclassified 1370
31 Ga0070670_100034914 3300005331 Bacteria 4328
32 Ga0070660_100000440 3300005339 Bacteria 27590
33 Ga0070691_10020480 3300005341 Bacteria 3056
34 Ga0070669_100278197 3300005353 Unclassified 1340
35 Ga0070671_100234860 3300005355 Bacteria 1556
36 Ga0070673_100088264 3300005364 Unclassified 2529
37 Ga0070709_10022102 3300005434 Bacteria 3716
38 Ga0070709_10150123 3300005434 Bacteria 1610
39 Ga0070714_100015299 3300005435 Bacteria 6173
40 Ga0070714_100073584 3300005435 Bacteria 2961
41 Ga0070714_100116701 3300005435 Bacteria 2370
42 Ga0070713_100010807 3300005436 Bacteria 6615
43 Ga0070713_100012954 3300005436 Bacteria 6139
44 Ga0070710_10001502 3300005437 Bacteria 10994
45 Ga0070711_100057746 3300005439 Bacteria 2688
46 Ga0070711_100112773 3300005439 Bacteria 1998
47 Ga0070705_100001785 3300005440 Bacteria 11131
48 Ga0070694_100191373 3300005444 Bacteria 1519
49 Ga0070708_100013986 3300005445 Bacteria 6591
50 Ga0070663_100061193 3300005455 Bacteria 2710
51 Ga0070663_100089297 3300005455 Bacteria 2280
52 Ga0070678_100030472 3300005456 Unclassified 3708
53 Ga0070662_100275706 3300005457 Bacteria 1359
54 Ga0070681_10220774 3300005458 Bacteria 1810
55 Ga0070706_100048438 3300005467 Bacteria 3922
56 Ga0070706_100076602 3300005467 Bacteria 3095
57 Ga0070707_100244382 3300005468 Bacteria 1747
58 Ga0070699_100107346 3300005518 Bacteria 2449
59 Ga0070699_100241996 3300005518 Bacteria 1611
60 Ga0070699_100254209 3300005518 Bacteria 1570
61 Ga0070699_100322423 3300005518 Bacteria 1389
62 Ga0070697_100003278 3300005536 Bacteria 12430
63 Ga0070697_100139421 3300005536 Bacteria 2038
64 Ga0070696_100002384 3300005546 Bacteria 12429
65 Ga0070665_100008836 3300005548 Bacteria 10199
66 Ga0070665_100009026 3300005548 Bacteria 10100
67 Ga0070665_100174031 3300005548 Bacteria 2153
68 Ga0070704_100002161 3300005549 Bacteria 10947
69 Ga0068855_100686748 3300005563 Bacteria 1097
70 Ga0068852_100001546 3300005616 Bacteria 15615
71 Ga0068859_100227538 3300005617 Bacteria 1953
72 Ga0068859_100722165 3300005617 Bacteria 1086
73 Ga0068864_100022500 3300005618 Bacteria 5285
74 Ga0068861_100036943 3300005719 Bacteria 3629
75 Ga0068858_100122988 3300005842 Bacteria 2428
76 Ga0068858_100450200 3300005842 Bacteria 1241
77 Ga0068860_100263490 3300005843 Bacteria 1680
78 Ga0068862_100004120 3300005844 Bacteria 12315
79 Ga0070717_10077865 3300006028 Bacteria 2777
80 Ga0070717_10091649 3300006028 Bacteria 2567
81 Ga0070717_10094032 3300006028 Bacteria 2535
82 Ga0075365_10010329 3300006038 Bacteria 5427
83 Ga0075365_10027162 3300006038 Bacteria 3639
84 Ga0075363_100027917 3300006048 Bacteria 2898
85 Ga0070715_10001855 3300006163 Bacteria 6321
86 Ga0070715_10130025 3300006163 Bacteria 1211
87 Ga0070715_10130533 3300006163 Bacteria 1209
88 Ga0070716_100004571 3300006173 Bacteria 6629
89 Ga0070716_100226841 3300006173 Bacteria 1258
90 Ga0070712_100088730 3300006175 Bacteria 2260
91 Ga0075362_10015002 3300006177 Bacteria 3142
92 Ga0075362_10167325 3300006177 Bacteria 1061
93 Ga0075367_10086038 3300006178 Bacteria 1907
94 Ga0075367_10141357 3300006178 Bacteria 1491
95 Ga0075366_10063870 3300006195 Bacteria 2189
96 Ga0097621_100025734 3300006237 Bacteria 4607
97 Ga0068871_100009415 3300006358 Bacteria 7076
98 Ga0068871_100461046 3300006358 Bacteria 1141
99 Ga0075428_100007608 3300006844 Bacteria 12008
100 Ga0068865_100286638 3300006881 Bacteria 1313
101 Ga0075436_100124029 3300006914 Bacteria 1809
102 Ga0075436_100179011 3300006914 Bacteria 1498
103 Ga0097620_100227559 3300006931 Bacteria 1953
104 Ga0097620_100722120 3300006931 Bacteria 1086
105 Ga0099826_10000048 3300006948 Bacteria 74895
106 Ga0075435_100070375 3300007076 Bacteria 2855
107 Ga0099794_10015044 3300007265 Bacteria 3406
108 Ga0099795_10003674 3300007788 Bacteria 3839
109 Ga0099795_10004364 3300007788 Bacteria 3640
110 Ga0099795_10017346 3300007788 Bacteria 2294
111 Ga0099795_10020178 3300007788 Bacteria 2167
112 Ga0105244_10014085 3300009036 Bacteria 4639
113 Ga0105240_10000347 3300009093 Bacteria 86681
114 Ga0105240_10003911 3300009093 Bacteria 23011
115 Ga0105240_10229086 3300009093 Bacteria 2161
116 Ga0105240_10465956 3300009093 Unclassified 1411
117 Ga0105245_10000158 3300009098 Bacteria 63785
118 Ga0105245_10293824 3300009098 Bacteria 1592
119 Ga0105247_10042421 3300009101 Bacteria 2787
120 Ga0114129_10417677 3300009147 Bacteria 1765
121 Ga0105243_10298323 3300009148 Bacteria 1459
122 Ga0105241_10197551 3300009174 Bacteria 1678
123 Ga0105248_10010141 3300009177 Bacteria 10379
124 Ga0105237_10032105 3300009545 Bacteria 5317
125 Ga0105237_10035214 3300009545 Bacteria 5067
126 Ga0105237_10162557 3300009545 Bacteria 2231
127 Ga0105238_10000652 3300009551 Bacteria 36418
128 Ga0105238_10011631 3300009551 Bacteria 8866
129 Ga0105238_10011692 3300009551 Bacteria 8848
130 Ga0105238_10025745 3300009551 Bacteria 5999
131 Ga0105238_10259529 3300009551 Bacteria 1717
132 Ga0105238_10563623 3300009551 Bacteria 1144
133 Ga0105249_10000147 3300009553 Bacteria 89436
134 Ga0105249_10005424 3300009553 Bacteria 11011
135 Ga0105249_10371545 3300009553 Bacteria 1454
136 Ga0105249_10510270 3300009553 Bacteria 1249
137 Ga0099796_10001617 3300010159 Bacteria 4638
138 Ga0099796_10004111 3300010159 Bacteria 3478
139 Ga0099796_10012057 3300010159 Unclassified 2429
140 Ga0099796_10012156 3300010159 Bacteria 2423
141 Ga0099796_10014092 3300010159 Bacteria 2301
142 Ga0099796_10017901 3300010159 Bacteria 2118
143 Ga0099796_10064311 3300010159 Bacteria 1309
144 Ga0099796_10080961 3300010159 Bacteria 1191
145 Ga0105239_10006979 3300010375 Bacteria 13013
146 Ga0105239_10095975 3300010375 Bacteria 3275
147 Ga0105239_10236065 3300010375 Bacteria 2052
148 Ga0105239_10239162 3300010375 Bacteria 2038
149 Ga0105239_10403250 3300010375 Bacteria 1548
150 Ga0105246_10158277 3300011119 Bacteria 1723
151 Ga0157373_10036351 3300013100 Bacteria 3535
152 Ga0157373_10082420 3300013100 Bacteria 2267
153 Ga0157373_10211853 3300013100 Bacteria 1366
154 Ga0157371_10005288 3300013102 Bacteria 10936
155 Ga0157369_10191135 3300013105 Bacteria 2151
156 Ga0157374_10159250 3300013296 Bacteria 2199
157 Ga0157374_10172479 3300013296 Bacteria 2110
158 Ga0163162_10328750 3300013306 Bacteria 1661
159 Ga0163162_10398025 3300013306 Bacteria 1510
160 Ga0157375_10036930 3300013308 Bacteria 4676
161 Ga0157375_10428840 3300013308 Bacteria 1488
162 Ga0163163_10318078 3300014325 Bacteria 1610
163 Ga0182008_10000711 3300014497 Bacteria 23842
164 Ga0182008_10010121 3300014497 Bacteria 5057
165 Ga0182008_10011898 3300014497 Bacteria 4611
166 Ga0182008_10070777 3300014497 Bacteria 1716
167 Ga0182008_10172750 3300014497 Bacteria 1091
168 Ga0157379_10046432 3300014968 Bacteria 3874
169 Ga0157376_10016887 3300014969 Bacteria 5553
170 Ga0182006_1000964 3300015261 Bacteria 19073
171 Ga0182007_10027390 3300015262 Bacteria 1965
172 Ga0213872_10024857 3300021361 Bacteria 2755
173 Ga0209436_100014 3300025208 Bacteria 127004
174 Ga0209674_101160 3300025226 Bacteria 7621
175 Ga0209258_109151 3300025242 Bacteria 1349
176 Ga0207425_1000834 3300025245 Bacteria 15364
177 Ga0209026_1000002 3300025250 Bacteria 1136158
178 Ga0209026_1000105 3300025250 Bacteria 150738
179 Ga0209759_1000381 3300025256 Bacteria 55381
180 Ga0209759_1008897 3300025256 Bacteria 3089
181 Ga0209129_1001143 3300025258 Bacteria 15345
182 Ga0209129_1001619 3300025258 Bacteria 12212
183 Ga0209233_1008961 3300025261 Bacteria 3062
184 Ga0209565_1000056 3300025263 Bacteria 200189
185 Ga0209673_1001862 3300025273 Bacteria 17116
186 Ga0209673_1010761 3300025273 Bacteria 3830
187 Ga0209130_1000004 3300025284 Bacteria 633436
188 Ga0209130_1000258 3300025284 Bacteria 66568
189 Ga0209564_1001123 3300025295 Bacteria 31480
190 Ga0209564_1001210 3300025295 Bacteria 29473
191 Ga0209564_1002678 3300025295 Bacteria 13511
192 Ga0209564_1011983 3300025295 Bacteria 3824
193 Ga0209758_1000829 3300025297 Bacteria 43270
194 Ga0209758_1010623 3300025297 Bacteria 5479
195 Ga0209758_1023936 3300025297 Bacteria 2741
196 Ga0209758_1030014 3300025297 Bacteria 2259
197 Ga0209050_1010014 3300025298 Bacteria 4741
198 Ga0209256_1004729 3300025299 Bacteria 8332
199 Ga0209256_1008836 3300025299 Bacteria 4559
200 Ga0209256_1012970 3300025299 Bacteria 3133
201 Ga0207426_1000003 3300025302 Bacteria 1063212
202 Ga0207426_1016331 3300025302 Bacteria 2668
203 Ga0207426_1023086 3300025302 Bacteria 2126
204 Ga0207426_1025964 3300025302 Bacteria 1968
205 Ga0209051_1000271 3300025303 Bacteria 86541
206 Ga0209051_1008436 3300025303 Bacteria 5454
207 Ga0209257_1028088 3300025304 Bacteria 1858
208 Ga0209257_1029054 3300025304 Bacteria 1807
209 Ga0207655_1012006 3300025728 Bacteria 5104
210 Ga0207653_10028108 3300025885 Bacteria 1807
211 Ga0207692_10004784 3300025898 Bacteria 5382
212 Ga0207692_10052010 3300025898 Bacteria 2079
213 Ga0207685_10009539 3300025905 Bacteria 2824
214 Ga0207685_10025083 3300025905 Bacteria 2053
215 Ga0207699_10028721 3300025906 Bacteria 3094
216 Ga0207645_10045899 3300025907 Bacteria 2791
217 Ga0207705_10066512 3300025909 Bacteria 2607
218 Ga0207705_10145304 3300025909 Bacteria 1774
219 Ga0207684_10123489 3300025910 Bacteria 2221
220 Ga0207707_10122118 3300025912 Bacteria 2277
221 Ga0207695_10000670 3300025913 Bacteria 67451
222 Ga0207695_10007545 3300025913 Bacteria 13789
223 Ga0207695_10129125 3300025913 Bacteria 2486
224 Ga0207695_10246174 3300025913 Bacteria 1688
225 Ga0207695_10464140 3300025913 Bacteria 1149
226 Ga0207671_10008171 3300025914 Bacteria 8927
227 Ga0207693_10007521 3300025915 Bacteria 8946
228 Ga0207693_10041970 3300025915 Bacteria 3601
229 Ga0207693_10063659 3300025915 Bacteria 2889
230 Ga0207663_10001619 3300025916 Bacteria 10601
231 Ga0207660_10003611 3300025917 Bacteria 10079
232 Ga0207662_10013851 3300025918 Bacteria 4514
233 Ga0207652_10324440 3300025921 Bacteria 1390
234 Ga0207694_10002179 3300025924 Bacteria 16085
235 Ga0207694_10007507 3300025924 Bacteria 8266
236 Ga0207659_10118219 3300025926 Bacteria 2027
237 Ga0207687_10000162 3300025927 Bacteria 45005
238 Ga0207687_10011700 3300025927 Bacteria 5739
239 Ga0207700_10013123 3300025928 Bacteria 5376
240 Ga0207700_10034594 3300025928 Bacteria 3629
241 Ga0207664_10244204 3300025929 Bacteria 1565
242 Ga0207644_10249285 3300025931 Bacteria 1416
243 Ga0207706_10080803 3300025933 Bacteria 2858
244 Ga0207665_10003514 3300025939 Bacteria 10466
245 Ga0207665_10044662 3300025939 Bacteria 2965
246 Ga0207665_10130074 3300025939 Bacteria 1786
247 Ga0207711_10050206 3300025941 Bacteria 3571
248 Ga0207689_10099054 3300025942 Bacteria 2395
249 Ga0207689_10335965 3300025942 Bacteria 1255
250 Ga0207661_10475603 3300025944 Unclassified 1140
251 Ga0207651_10344435 3300025960 Unclassified 1253
252 Ga0207712_10000090 3300025961 Bacteria 104492
253 Ga0207712_10006615 3300025961 Bacteria 7314
254 Ga0207712_10207150 3300025961 Bacteria 1559
255 Ga0207668_10221440 3300025972 Bacteria 1520
256 Ga0207702_10164048 3300026078 Bacteria 2031
257 Ga0207702_10165390 3300026078 Bacteria 2023
258 Ga0207674_10241809 3300026116 Bacteria 1752
259 Ga0207675_100242987 3300026118 Bacteria 1740
260 Ga0207683_10003799 3300026121 Bacteria 13080
261 Ga0207698_10001115 3300026142 Bacteria 15641
262 Ga0209179_1006851 3300027512 Bacteria 1857
263 Ga0209179_1012911 3300027512 Bacteria 1509
264 Ga0209282_1000066 3300027666 Bacteria 87072
265 Ga0209588_1009522 3300027671 Bacteria 2907
266 Ga0209588_1019109 3300027671 Bacteria 2137
267 Ga0209974_10003650 3300027876 Bacteria 5526
268 Ga0268266_10007036 3300028379 Bacteria 10213
269 Ga0268266_10016285 3300028379 Bacteria 6355
270 Ga0268265_10002803 3300028380 Bacteria 12834
271 Ga0268264_10054199 3300028381 Bacteria 3348
272 Ga0268264_10091715 3300028381 Bacteria 2621
273 Ga0268264_10266516 3300028381 Bacteria 1598
274 Ga0265337_1012122 3300028556 Bacteria 2941
275 Ga0265319_1006202 3300028563 Bacteria 5572
276 Ga0265334_10003965 3300028573 Bacteria 6660
277 Ga0265323_10000311 3300028653 Bacteria 28078
278 Ga0265336_10000074 3300028666 Bacteria 82727
279 Ga0307517_10032400 3300028786 Bacteria 6041
280 Ga0307517_10245496 3300028786 Bacteria 1057
281 Ga0307515_10002583 3300028794 Bacteria 39053
282 Ga0265338_10000137 3300028800 Bacteria 135705
283 Ga0265324_10003671 3300029957 Bacteria 7199
284 Ga0265327_10004253 3300031251 Bacteria 12838
285 Ga0307513_10195049 3300031456 Bacteria 1872
286 Ga0307508_10077347 3300031616 Bacteria 2906
287 Ga0265314_10019587 3300031711 Bacteria 5240
288 Ga0265342_10014254 3300031712 Bacteria 5284
289 Ga0265342_10162677 3300031712 Bacteria 1233
290 Ga0307516_10003900 3300031730 Bacteria 18821
291 Ga0307516_10005013 3300031730 Bacteria 16054
292 Ga0307406_10187695 3300031901 Bacteria 1511
293 Ga0307510_10001131 3300033180 Bacteria 28582
294 Ga0307510_10035535 3300033180 Bacteria 5563
295 Ga0373926_0012447 3300035083 Bacteria 2876
296 Ga0373940_0052125 3300035088 Bacteria 1152
297 Ga0373944_0052446 3300035089 Bacteria 1289
298 Ga0373957_0094347 3300035120 Bacteria 1192
299 Ga0373935_0039751 3300035692 Bacteria 2950
300 Ga0373935_0446686 3300035692 Bacteria 934
301 Ga0373927_0066673 3300035695 Bacteria 2329
302 Ga0373933_0063072 3300035724 Bacteria 2240
303 Ga0373947_0035247 3300035725 Bacteria 2962
304 Ga0373937_0101725 3300036401 Bacteria 2667
305 Ga0373925_0094237 3300037068 Bacteria 2292
306 Ga0395899_0026009 3300037312 Bacteria 4416
307 Ga0395900_0088172 3300037418 Plasmid 3189
308 Ga0395900_0110788 3300037418 Bacteria 2820
309 Ga0395898_0003720 3300037466 Bacteria 16921
310 Ga0395898_0317746 3300037466 Bacteria 1486
311 Ga0395898_0512104 3300037466 Bacteria 1141
312 Ga0395905_0097420 3300037471 Plasmid 2761
313 Ga0395901_0021480 3300038443 Bacteria 6614
314 Ga0395901_0216820 3300038443 Bacteria 2001
315 Ga0436361_0052273 3300039447 Bacteria 5189
316 Ga0439465_0005022 3300041413 Bacteria 4250
317 Ga0451787_202810 3300041441 Bacteria 994
318 Ga0451793_1635360 3300041452 Bacteria 1090
319 Ga0451795_0502720 3300041456 Bacteria 953
320 Ga0451807_1641597 3300041486 Bacteria 1052
321 Ga0451807_1695510 3300041486 Bacteria 1490
322 Ga0451839_0567018 3300041496 Bacteria 2997
323 Ga0451845_0637907 3300041501 Bacteria 1593
324 Ga0451845_0717355 3300041501 Bacteria 4025
325 Ga0451847_0263760 3300041503 Bacteria 3222
326 Ga0451849_0301535 3300041505 Bacteria 3198
327 Ga0451843_1036654 3300041509 Bacteria 4112
328 Ga0451855_0164364 3300041511 Bacteria 3867
329 Ga0451853_1588389 3300041512 Bacteria 1017
330 Ga0451853_3204310 3300041512 Bacteria 1723
331 Ga0466965_0015829 3300044683 Bacteria 3583
332 Ga0466959_0008084 3300045049 Bacteria 7418
333 Ga0466959_0024025 3300045049 Bacteria 4513
334 Ga0466958_0149969 3300045836 Bacteria 1471
335 Ga0495638_0000087 3300046460 Bacteria 152531
336 Ga0495651_0077803 3300046462 Bacteria 2510
337 Ga0495650_0000502 3300046471 Bacteria 59150
338 Ga0495650_0000705 3300046471 Bacteria 42734
339 Ga0495606_0000995 3300046507 Bacteria 41346
340 Ga0495610_0022479 3300046512 Bacteria 3449
341 Ga0495610_0124947 3300046512 Bacteria 1123
342 Ga0495620_0075010 3300046515 Bacteria 1377
343 Ga0495632_0083023 3300046519 Bacteria 1526
344 Ga0495643_0017028 3300046522 Bacteria 4259
345 Ga0495643_0177858 3300046522 Bacteria 1036
346 Ga0495648_0008727 3300046524 Bacteria 7937
347 Ga0495648_0058491 3300046524 Bacteria 2305
348 Ga0495648_0114272 3300046524 Bacteria 1463
349 Ga0495640_0062527 3300046533 Bacteria 2525
350 Ga0495645_0119821 3300046543 Bacteria 1854
351 Ga0495668_0005238 3300046616 Bacteria 8884
352 Ga0495625_0043826 3300046660 Bacteria 3242
353 Ga0495623_0046096 3300046679 Bacteria 2768
354 Ga0495670_0000015 3300046691 Bacteria 131137
355 Ga0495672_0003572 3300047320 Bacteria 13229
356 Ga0495672_0043070 3300047320 Bacteria 2717
357 Ga0495676_0264316 3300047321 Bacteria 1170
358 Ga0495686_0048372 3300047472 Bacteria 2682
359 Ga0496101_0070786 3300048904 Bacteria 2555
360 Ga0496102_0003522 3300048905 Bacteria 13266
361 Ga0496102_0142088 3300048905 Bacteria 2251
362 Ga0496102_0446903 3300048905 Bacteria 1213
363 Ga0496103_0058433 3300048906 Bacteria 2396
364 Ga0496104_0019935 3300048907 Bacteria 6141
365 Ga0496104_0440765 3300048907 Bacteria 1214
366 Ga0496105_0052529 3300048908 Bacteria 3366
367 Ga0496106_0000212 3300048909 Bacteria 40609
368 Ga0496106_0005817 3300048909 Bacteria 9115
369 Ga0496107_0063729 3300048910 Bacteria 2671
370 Ga0496107_0202432 3300048910 Bacteria 1476
371 Ga0496109_0027213 3300048912 Bacteria 5104
372 Ga0496110_0034477 3300048913 Bacteria 4384
373 Ga0496111_0115048 3300048914 Bacteria 1983
374 Ga0496111_0410077 3300048914 Bacteria 1001
375 Ga0496112_0043866 3300048915 Bacteria 4379
376 Ga0496112_0063879 3300048915 Bacteria 3632
377 Ga0496112_0122552 3300048915 Bacteria 2570
378 Ga0496114_0058419 3300048917 Bacteria 3221
379 Ga0496114_0144114 3300048917 Bacteria 2064
380 Ga0496115_0002623 3300048918 Bacteria 12905
381 Ga0496115_0011587 3300048918 Bacteria 6613
382 Ga0496115_0104874 3300048918 Bacteria 2320
383 Ga0496115_0255408 3300048918 Bacteria 1442
384 Ga0496116_0240271 3300048919 Bacteria 910
385 Ga0496120_0002851 3300048923 Bacteria 16648
386 Ga0496121_0007858 3300048924 Bacteria 12756
387 Ga0496121_0033710 3300048924 Bacteria 4628
388 Ga0496122_0000488 3300048925 Bacteria 82252
389 Ga0496123_0002461 3300048926 Bacteria 22940
390 Ga0496124_0055855 3300048927 Bacteria 3334
391 Ga0496125_0111273 3300048928 Bacteria 1982
392 Ga0496125_0123814 3300048928 Bacteria 1837
393 Ga0496125_0187464 3300048928 Bacteria 1370
394 Ga0496126_0000338 3300048929 Bacteria 98321
395 Ga0496126_0027737 3300048929 Bacteria 5404
396 Ga0496126_0033299 3300048929 Bacteria 4849
397 Ga0496126_0135369 3300048929 Bacteria 2126
398 Ga0496126_0315371 3300048929 Bacteria 1287
399 Ga0501292_001261 3300049515 Bacteria 3102
400 Ga0501298_011442 3300049521 Bacteria 1541
401 Ga0501032_0011377 3300049569 Bacteria 6391
402 Ga0501046_0205865 3300049580 Unclassified 1462
403 Ga0501047_0005803 3300049581 Bacteria 11620
404 Ga0501047_0075971 3300049581 Bacteria 3233
405 Ga0501047_0373098 3300049581 Bacteria 1262
406 Ga0501206_002017 3300049653 Bacteria 2560
407 Ga0501257_009026 3300049686 Bacteria 2247
408 Ga0501083_0036343 3300049744 Bacteria 3360
409 Ga0501262_003978 3300049759 Bacteria 1704
410 Ga0501265_002761 3300049762 Bacteria 1992
411 Ga0501278_004148 3300049774 Bacteria 1039
412 Ga0501035_0001753 3300049822 Bacteria 21910
413 Ga0501044_0004596 3300049823 Bacteria 15435
414 nmdc:mga03683_111587_c1 3300050489 Bacteria 1209
415 nmdc:mga03683_6403_c1 3300050489 Bacteria 4028
416 nmdc:mga0k408_7113_c2 3300050493 Bacteria 5684
417 nmdc:mga06z11_236968_c1 3300050494 Bacteria 1071
418 nmdc:mga05p37_156705_c1 3300050507 Bacteria 2782
419 nmdc:mga06r32_201853_c1 3300050510 Bacteria 1976
420 nmdc:mga06r32_286325_c1 3300050510 Bacteria 1634
421 nmdc:mga08x19_159757_c1 3300050514 Bacteria 1530
422 Ga0495601_0030066 3300053077 Bacteria 3373
423 Ga0500643_003395 3300053087 Bacteria 7696
424 Ga0500644_0001624 3300053088 Bacteria 5866
425 Ga0500646_0021038 3300053090 Bacteria 1736
426 Ga0500583_0036130 3300053092 Bacteria 2210
427 Ga0500583_0117430 3300053092 Bacteria 1314
428 Ga0500651_0150754 3300053093 Bacteria 1396
429 Ga0500651_0152208 3300053093 Bacteria 1388
430 Ga0500651_0333536 3300053093 Bacteria 864
431 Ga0500641_0014567 3300053096 Bacteria 2903
432 Ga0500594_0002123 3300053118 Bacteria 4282
433 Ga0500595_004871 3300053119 Bacteria 5941
434 Ga0500595_025353 3300053119 Bacteria 2057
435 Ga0500595_042230 3300053119 Bacteria 1460
436 Ga0500652_017934 3300053131 Bacteria 2603
437 Ga0500658_0011126 3300053134 Bacteria 3314
438 Ga0500559_0003189 3300053136 Bacteria 8151
439 Ga0500577_0095524 3300053142 Bacteria 1208
440 Ga0500604_0005828 3300053151 Bacteria 3257
441 Ga0500604_0053566 3300053151 Bacteria 1251
442 Ga0500622_0005070 3300053156 Bacteria 8016
443 Ga0500637_0277620 3300053178 Bacteria 924
444 Ga0500645_001480 3300053730 Bacteria 11799
445 Ga0500596_007300 3300053735 Bacteria 1818
446 Ga0500587_000866 3300053739 Bacteria 4007
447 Ga0501084_0073285 3300054114 Bacteria 2868
448 Ga0501082_0000351 3300060353 Bacteria 40723

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003771 Ga0055526_1006240 Ga0055526_10062405 229
2 3300003771 Ga0055526_1034022 Ga0055526_10340222 229
3 3300003773 Ga0055537_1022897 Ga0055537_10228971 229
4 3300025263 Ga0209565_1000056 Ga0209565_1000056137 229
5 3300025295 Ga0209564_1002678 Ga0209564_10026786 229
6 3300025295 Ga0209564_1011983 Ga0209564_10119835 229
7 3300025297 Ga0209758_1023936 Ga0209758_10239363 229
8 3300025298 Ga0209050_1010014 Ga0209050_10100145 229
9 3300025302 Ga0207426_1023086 Ga0207426_10230862 229
10 3300053151 Ga0500604_0053566 Ga0500604_0053566_97_942 235
11 3300035692 Ga0373935_0446686 Ga0373935_0446686_17_775 238
12 iso_pu_bacteria 2906378014 2906382250 243
13 iso_pu_bacteria 2922178524 2922185184 244
14 3300031251 Ga0265327_10004253 Ga0265327_100042539 246
15 3300053093 Ga0500651_0333536 Ga0500651_0333536_50_853 248
16 iso_pu_bacteria 2958137437 2958141354 254
17 3300048924 Ga0496121_0033710 Ga0496121_0033710_3009_3854 255
18 3300002741 JGI25157J39369_1000447 JGI25157J39369_100044710 256
19 3300025250 Ga0209026_1000002 Ga0209026_10000021060 256
20 3300025256 Ga0209759_1000381 Ga0209759_100038123 256
21 iso_pu_bacteria 2582581867 2585404923 256
22 iso_pu_bacteria 2842163707 2842169528 256
23 3300009093 Ga0105240_10003911 Ga0105240_1000391120 258
24 3300009147 Ga0114129_10417677 Ga0114129_104176772 258
25 3300009174 Ga0105241_10197551 Ga0105241_101975511 258
26 3300009545 Ga0105237_10032105 Ga0105237_100321053 258
27 3300009551 Ga0105238_10011692 Ga0105238_100116925 258
28 3300010159 Ga0099796_10064311 Ga0099796_100643112 258
29 3300010159 Ga0099796_10080961 Ga0099796_100809612 258
30 3300010375 Ga0105239_10006979 Ga0105239_1000697912 258
31 3300039447 Ga0436361_0052273 Ga0436361_0052273_2150_2986 258
32 3300041441 Ga0451787_202810 Ga0451787_202810_74_901 258
33 3300041486 Ga0451807_1641597 Ga0451807_1641597_210_1037 258
34 3300046522 Ga0495643_0177858 Ga0495643_0177858_34_867 258
35 3300046524 Ga0495648_0058491 Ga0495648_0058491_662_1537 258
36 3300047472 Ga0495686_0048372 Ga0495686_0048372_1411_2238 258
37 3300048919 Ga0496116_0240271 Ga0496116_0240271_63_872 258
38 3300048929 Ga0496126_0000338 Ga0496126_0000338_46513_47328 258
39 3300048929 Ga0496126_0315371 Ga0496126_0315371_25_858 258
40 3300050507 nmdc:mga05p37_156705_c1 nmdc:mga05p37_156705_c1_894_1730 258
41 3300053096 Ga0500641_0014567 Ga0500641_0014567_238_1080 258
42 3300053142 Ga0500577_0095524 Ga0500577_0095524_295_1149 258
43 3300053178 Ga0500637_0277620 Ga0500637_0277620_20_853 258
44 3300041456 Ga0451795_0502720 Ga0451795_0502720_92_928 259
45 3300046515 Ga0495620_0075010 Ga0495620_0075010_265_1143 260
46 3300053088 Ga0500644_0001624 Ga0500644_0001624_2801_3679 260
47 3300053093 Ga0500651_0150754 Ga0500651_0150754_320_1198 260
48 3300053118 Ga0500594_0002123 Ga0500594_0002123_176_1054 260
49 3300053136 Ga0500559_0003189 Ga0500559_0003189_3962_4840 260
50 3300053156 Ga0500622_0005070 Ga0500622_0005070_3325_4203 260
51 3300025304 Ga0209257_1028088 Ga0209257_10280882 261
52 3300028786 Ga0307517_10245496 Ga0307517_102454962 261
53 3300046691 Ga0495670_0000015 Ga0495670_0000015_25703_26521 261
54 3300048918 Ga0496115_0002623 Ga0496115_0002623_3350_4168 261
55 3300007788 Ga0099795_10020178 Ga0099795_100201781 265
56 3300010159 Ga0099796_10012156 Ga0099796_100121562 265
57 3300035083 Ga0373926_0012447 Ga0373926_0012447_896_1795 265
58 3300035692 Ga0373935_0039751 Ga0373935_0039751_1180_2079 265
59 3300035725 Ga0373947_0035247 Ga0373947_0035247_1357_2256 265
60 3300037068 Ga0373925_0094237 Ga0373925_0094237_870_1769 265
61 iso_pu_bacteria 2585427633 2585993331 268
62 3300005329 Ga0070683_100367488 Ga0070683_1003674881 269
63 3300005563 Ga0068855_100686748 Ga0068855_1006867482 269
64 3300009093 Ga0105240_10465956 Ga0105240_104659562 269
65 3300009098 Ga0105245_10000158 Ga0105245_1000015840 269
66 3300025927 Ga0207687_10000162 Ga0207687_1000016232 269
67 3300025944 Ga0207661_10475603 Ga0207661_104756031 269
68 3300035089 Ga0373944_0052446 Ga0373944_0052446_139_1008 270
69 3300007788 Ga0099795_10017346 Ga0099795_100173461 271
70 3300010159 Ga0099796_10017901 Ga0099796_100179013 271
71 3300005455 Ga0070663_100061193 Ga0070663_1000611933 272
72 3300014325 Ga0163163_10318078 Ga0163163_103180782 272
73 3300027876 Ga0209974_10003650 Ga0209974_100036505 272
74 3300028786 Ga0307517_10032400 Ga0307517_100324005 272
75 3300005353 Ga0070669_100278197 Ga0070669_1002781971 274
76 3300005364 Ga0070673_100088264 Ga0070673_1000882641 274
77 3300005456 Ga0070678_100030472 Ga0070678_1000304722 274
78 3300025910 Ga0207684_10123489 Ga0207684_101234891 274
79 3300025960 Ga0207651_10344435 Ga0207651_103444352 274
80 3300026121 Ga0207683_10003799 Ga0207683_100037998 274
81 3300031730 Ga0307516_10003900 Ga0307516_1000390011 274
82 3300033180 Ga0307510_10035535 Ga0307510_100355356 274
83 3300037466 Ga0395898_0317746 Ga0395898_0317746_266_1192 274
84 3300046512 Ga0495610_0022479 Ga0495610_0022479_2369_3244 274
85 3300046519 Ga0495632_0083023 Ga0495632_0083023_133_1008 274
86 3300046524 Ga0495648_0114272 Ga0495648_0114272_187_1068 274
87 3300053134 Ga0500658_0011126 Ga0500658_0011126_1390_2265 274
88 3300053739 Ga0500587_000866 Ga0500587_000866_1677_2552 274
89 3300005445 Ga0070708_100013986 Ga0070708_1000139862 275
90 3300009553 Ga0105249_10005424 Ga0105249_1000542416 275
91 3300009553 Ga0105249_10371545 Ga0105249_103715452 275
92 3300010375 Ga0105239_10236065 Ga0105239_102360651 275
93 3300035088 Ga0373940_0052125 Ga0373940_0052125_116_1003 275
94 3300048904 Ga0496101_0070786 Ga0496101_0070786_191_1078 275
95 3300048905 Ga0496102_0003522 Ga0496102_0003522_11724_12611 275
96 3300048906 Ga0496103_0058433 Ga0496103_0058433_89_976 275
97 3300048907 Ga0496104_0440765 Ga0496104_0440765_119_1006 275
98 3300048909 Ga0496106_0000212 Ga0496106_0000212_1214_2101 275
99 3300048909 Ga0496106_0005817 Ga0496106_0005817_7684_8571 275
100 3300048910 Ga0496107_0063729 Ga0496107_0063729_110_997 275
101 3300048918 Ga0496115_0011587 Ga0496115_0011587_5671_6558 275
102 3300053093 Ga0500651_0152208 Ga0500651_0152208_434_1291 276
103 3300045049 Ga0466959_0008084 Ga0466959_0008084_5141_6028 277
104 3300046543 Ga0495645_0119821 Ga0495645_0119821_579_1490 277
105 iso_pu_bacteria 2643221665 2644362669 277
106 3300003792 Ga0055540_1000625 Ga0055540_10006259 279
107 3300005467 Ga0070706_100076602 Ga0070706_1000766023 279
108 3300006177 Ga0075362_10015002 Ga0075362_100150023 279
109 3300025303 Ga0209051_1000271 Ga0209051_100027142 279
110 3300046533 Ga0495640_0062527 Ga0495640_0062527_1034_1978 279
111 3300050489 nmdc:mga03683_6403_c1 nmdc:mga03683_6403_c1_2392_3309 279
112 3300053077 Ga0495601_0030066 Ga0495601_0030066_1971_2915 279
113 3300005339 Ga0070660_100000440 Ga0070660_10000044031 280
114 3300009093 Ga0105240_10229086 Ga0105240_102290863 280
115 3300010159 Ga0099796_10014092 Ga0099796_100140922 280
116 3300013100 Ga0157373_10036351 Ga0157373_100363515 280
117 3300013100 Ga0157373_10211853 Ga0157373_102118532 280
118 3300013105 Ga0157369_10191135 Ga0157369_101911353 280
119 3300013296 Ga0157374_10172479 Ga0157374_101724793 280
120 3300025913 Ga0207695_10246174 Ga0207695_102461742 280
121 3300037418 Ga0395900_0110788 Ga0395900_0110788_63_1010 280
122 3300053090 Ga0500646_0021038 Ga0500646_0021038_515_1438 280
123 3300053092 Ga0500583_0036130 Ga0500583_0036130_97_1020 280
124 3300053151 Ga0500604_0005828 Ga0500604_0005828_2044_2967 280
125 iso_pu_bacteria 2844002411 2844007960 280
126 iso_pu_bacteria 2871466892 2871474015 280
127 3300005327 Ga0070658_10273813 Ga0070658_102738131 281
128 3300009036 Ga0105244_10014085 Ga0105244_100140856 281
129 3300013102 Ga0157371_10005288 Ga0157371_100052882 281
130 3300025728 Ga0207655_1012006 Ga0207655_10120067 281
131 3300053087 Ga0500643_003395 Ga0500643_003395_3789_4715 281
132 iso_pu_bacteria 2856334872 2856338125 281
133 iso_pu_bacteria 2857367948 2857371737 281
134 iso_pu_bacteria 2869249662 2869256415 281
135 iso_pu_bacteria 2869264136 2869268345 281
136 iso_pu_bacteria 2869271264 2869275105 281
137 iso_pu_bacteria 2871459585 2871461237 281
138 iso_pu_bacteria 2874131515 2874132666 281
139 iso_pu_bacteria 2874162495 2874165117 281
140 iso_pu_bacteria 2874168670 2874169318 281
141 iso_pu_bacteria 2876363079 2876368993 281
142 iso_pu_bacteria 2876399893 2876404942 281
143 iso_pu_bacteria 2876406927 2876410364 281
144 iso_pu_bacteria 2878774303 2878779084 281
145 iso_pu_bacteria 2878781027 2878788196 281
146 iso_pu_bacteria 2903448605 2903450784 281
147 iso_pu_bacteria 2903521522 2903527991 281
148 iso_pu_bacteria 2903528002 2903529697 281
149 iso_pu_bacteria 2906370794 2906376976 281
150 iso_pu_bacteria 2906386501 2906392970 281
151 iso_pu_bacteria 2906393657 2906395030 281
152 iso_pu_bacteria 2906408224 2906413618 281
153 iso_pu_bacteria 2922151315 2922157871 281
154 iso_pu_bacteria 2922172374 2922175142 281
155 iso_pu_bacteria 2924748358 2924753592 281
156 iso_pu_bacteria 2937848649 2937854108 281
157 iso_pu_bacteria 3004211236 3004215775 281
158 iso_pu_bacteria 2928531327 2928533349 282
159 3300047320 Ga0495672_0003572 Ga0495672_0003572_1157_2068 283
160 3300048923 Ga0496120_0002851 Ga0496120_0002851_11029_11907 283
161 3300053730 Ga0500645_001480 Ga0500645_001480_5175_6080 283
162 3300013306 Ga0163162_10398025 Ga0163162_103980252 284
163 3300044683 Ga0466965_0015829 Ga0466965_0015829_1599_2501 284
164 3300045049 Ga0466959_0024025 Ga0466959_0024025_1890_2792 284
165 3300045836 Ga0466958_0149969 Ga0466958_0149969_505_1407 284
166 3300053131 Ga0500652_017934 Ga0500652_017934_1022_1927 284
167 iso_pu_bacteria 2509276022 2509395858 284
168 iso_pu_bacteria 2856320880 2856326882 284
169 3300009545 Ga0105237_10162557 Ga0105237_101625572 285
170 3300010375 Ga0105239_10403250 Ga0105239_104032502 285
171 3300013296 Ga0157374_10159250 Ga0157374_101592502 285
172 3300014497 Ga0182008_10010121 Ga0182008_100101214 285
173 3300025261 Ga0209233_1008961 Ga0209233_10089613 285
174 3300037312 Ga0395899_0026009 Ga0395899_0026009_1763_2656 285
175 3300037418 Ga0395900_0088172 Ga0395900_0088172_1689_2582 285
176 3300037466 Ga0395898_0003720 Ga0395898_0003720_4171_5064 285
177 3300037471 Ga0395905_0097420 Ga0395905_0097420_892_1785 285
178 3300038443 Ga0395901_0021480 Ga0395901_0021480_4986_5879 285
179 3300048914 Ga0496111_0410077 Ga0496111_0410077_42_974 285
180 3300048915 Ga0496112_0063879 Ga0496112_0063879_1225_2142 285
181 3300048915 Ga0496112_0122552 Ga0496112_0122552_993_1925 285
182 3300049515 Ga0501292_001261 Ga0501292_001261_1381_2298 285
183 3300049521 Ga0501298_011442 Ga0501298_011442_24_941 285
184 3300049653 Ga0501206_002017 Ga0501206_002017_572_1489 285
185 3300049686 Ga0501257_009026 Ga0501257_009026_987_1904 285
186 3300049759 Ga0501262_003978 Ga0501262_003978_739_1656 285
187 3300049762 Ga0501265_002761 Ga0501265_002761_642_1559 285
188 3300049774 Ga0501278_004148 Ga0501278_004148_28_945 285
189 3300050510 nmdc:mga06r32_286325_c1 nmdc:mga06r32_286325_c1_43_966 285
190 3300053119 Ga0500595_025353 Ga0500595_025353_597_1511 285
191 iso_pu_bacteria 2508501123 2509118789 285
192 iso_pu_bacteria 2869278585 2869283568 285
193 iso_pu_bacteria 2874139085 2874143739 285
194 iso_pu_bacteria 2878738818 2878739003 285
195 iso_pu_bacteria 2888337043 2888338953 285
196 iso_pu_bacteria 2924718760 2924724871 285
197 iso_pu_bacteria 2924776078 2924776365 285
198 iso_pu_bacteria 2937877337 2937884181 285
199 iso_pu_bacteria 2937972304 2937979717 285
200 iso_pu_bacteria 2958034702 2958040080 285
201 iso_pu_bacteria 2958041894 2958054424 285
202 iso_pu_bacteria 2958064165 2958065322 285
203 iso_pu_bacteria 2958084443 2958091492 285
204 iso_pu_bacteria 2958092219 2958099478 285
205 iso_pu_bacteria 2958144490 2958151111 285
206 iso_pu_bacteria 2968016561 2968018923 285
207 iso_pu_bacteria 2970469710 2970470904 285
208 iso_pu_bacteria 2970593180 2970598007 285
209 iso_pu_bacteria 2996348954 2996356560 285
210 iso_pu_bacteria 3004275668 3004282863 285
211 iso_pu_bacteria 8004640170 8004640987 285
212 3300005842 Ga0068858_100122988 Ga0068858_1001229882 286
213 3300014497 Ga0182008_10000711 Ga0182008_100007115 286
214 3300015261 Ga0182006_1000964 Ga0182006_100096418 286
215 3300015262 Ga0182007_10027390 Ga0182007_100273903 286
216 iso_pu_bacteria 2582581279 2585147593 286
217 iso_pu_bacteria 2756170246 2756672091 286
218 iso_pu_bacteria 2844533157 2844535588 286
219 3300005548 Ga0070665_100174031 Ga0070665_1001740313 287
220 3300005617 Ga0068859_100227538 Ga0068859_1002275382 287
221 3300006931 Ga0097620_100227559 Ga0097620_1002275592 287
222 3300009177 Ga0105248_10010141 Ga0105248_100101419 287
223 3300009545 Ga0105237_10035214 Ga0105237_100352143 287
224 3300009551 Ga0105238_10025745 Ga0105238_100257451 287
225 3300010375 Ga0105239_10239162 Ga0105239_102391622 287
226 3300025941 Ga0207711_10050206 Ga0207711_100502062 287
227 3300028379 Ga0268266_10016285 Ga0268266_100162855 287
228 3300037466 Ga0395898_0512104 Ga0395898_0512104_57_992 287
229 3300041486 Ga0451807_1695510 Ga0451807_1695510_552_1463 287
230 3300041512 Ga0451853_1588389 Ga0451853_1588389_71_997 287
231 3300049581 Ga0501047_0075971 Ga0501047_0075971_1494_2402 287
232 3300049581 Ga0501047_0373098 Ga0501047_0373098_329_1240 287
233 3300049744 Ga0501083_0036343 Ga0501083_0036343_1646_2554 287
234 3300054114 Ga0501084_0073285 Ga0501084_0073285_1556_2464 287
235 3300060353 Ga0501082_0000351 Ga0501082_0000351_33962_34870 287
236 iso_pu_bacteria 2509276018 2509371313 287
237 iso_pu_bacteria 2510065059 2510315919 287
238 iso_pu_bacteria 2512875016 2512932003 287
239 iso_pu_bacteria 2512875024 2512959977 287
240 iso_pu_bacteria 2515154113 2515635349 287
241 iso_pu_bacteria 2515154114 2515646038 287
242 iso_pu_bacteria 2687453392 2688598026 287
243 iso_pu_bacteria 2767802442 2770199672 287
244 iso_pu_bacteria 2856328259 2856333735 287
245 iso_pu_bacteria 2874123672 2874124442 287
246 iso_pu_bacteria 2906363423 2906364100 287
247 iso_pu_bacteria 2908739725 2908742957 287
248 iso_pu_bacteria 2924733363 2924734935 287
249 iso_pu_bacteria 2937868953 2937869887 287
250 iso_pu_bacteria 2958122699 2958124142 287
251 iso_pu_bacteria 2961136820 2961137674 287
252 iso_pu_bacteria 2963644680 2963647204 287
253 iso_pu_bacteria 2965025482 2965026028 287
254 iso_pu_bacteria 2965032056 2965036084 287
255 iso_pu_bacteria 2965040258 2965044471 287
256 iso_pu_bacteria 2965047637 2965054982 287
257 iso_pu_bacteria 2965089291 2965094480 287
258 iso_pu_bacteria 2965102966 2965109725 287
259 iso_pu_bacteria 2965110997 2965116570 287
260 iso_pu_bacteria 2968083720 2968087961 287
261 iso_pu_bacteria 2970547951 2970551722 287
262 iso_pu_bacteria 2977872689 2977874886 287
263 iso_pu_bacteria 2977915119 2977916532 287
264 iso_pu_bacteria 2977922695 2977927477 287
265 iso_pu_bacteria 2977935797 2977936612 287
266 iso_pu_bacteria 2977950692 2977957113 287
267 iso_pu_bacteria 2977957713 2977958066 287
268 iso_pu_bacteria 2979793036 2979795756 287
269 iso_pu_bacteria 2987673487 2987678710 287
270 iso_pu_bacteria 3004167301 3004168302 287
271 iso_pu_bacteria 3004195979 3004197793 287
272 iso_pu_bacteria 3004218560 3004224552 287
273 iso_pu_bacteria 3004239961 3004242160 287
274 iso_pu_bacteria 3004334049 3004335097 287
275 iso_pu_bacteria 637000159 637075100 287
276 iso_pu_bacteria 649633066 649872558 287
277 iso_pu_bacteria 8004300914 8004302985 287
278 iso_pu_bacteria 8004361976 8004368962 287
279 iso_pu_bacteria 8004695233 8004696105 287
280 3300002987 JGI25159J45721_1004266 JGI25159J45721_10042662 288
281 3300005262 Ga0065165_1000620 Ga0065165_100062052 288
282 3300007265 Ga0099794_10015044 Ga0099794_100150444 288
283 3300007788 Ga0099795_10003674 Ga0099795_100036742 288
284 3300010159 Ga0099796_10001617 Ga0099796_100016173 288
285 3300025284 Ga0209130_1000258 Ga0209130_100025850 288
286 3300025302 Ga0207426_1016331 Ga0207426_10163312 288
287 3300027512 Ga0209179_1006851 Ga0209179_10068512 288
288 3300038443 Ga0395901_0216820 Ga0395901_0216820_888_1814 288
289 iso_pu_bacteria 2667528175 2671121742 288
290 iso_pu_bacteria 2885374607 2885382101 288
291 iso_pu_bacteria 2945972063 2945972176 288
292 3300005329 Ga0070683_100043996 Ga0070683_1000439963 289
293 3300025913 Ga0207695_10007545 Ga0207695_1000754510 289
294 3300025913 Ga0207695_10129125 Ga0207695_101291254 289
295 3300025914 Ga0207671_10008171 Ga0207671_100081712 289
296 3300025924 Ga0207694_10007507 Ga0207694_100075074 289
297 3300031456 Ga0307513_10195049 Ga0307513_101950492 289
298 3300047321 Ga0495676_0264316 Ga0495676_0264316_60_1007 289
299 3300049569 Ga0501032_0011377 Ga0501032_0011377_4547_5479 289
300 3300049580 Ga0501046_0205865 Ga0501046_0205865_262_1194 289
301 3300049581 Ga0501047_0005803 Ga0501047_0005803_8631_9563 289
302 3300049822 Ga0501035_0001753 Ga0501035_0001753_8656_9588 289
303 3300049823 Ga0501044_0004596 Ga0501044_0004596_169_1101 289
304 iso_pu_bacteria 2904449895 2904453407 289
305 iso_pu_bacteria 2904456579 2904459378 289
306 iso_pu_bacteria 3005474847 3005479970 289
307 3300005341 Ga0070691_10020480 Ga0070691_100204801 290
308 3300005440 Ga0070705_100001785 Ga0070705_1000017852 290
309 3300005444 Ga0070694_100191373 Ga0070694_1001913732 290
310 3300005455 Ga0070663_100089297 Ga0070663_1000892973 290
311 3300005457 Ga0070662_100275706 Ga0070662_1002757061 290
312 3300005458 Ga0070681_10220774 Ga0070681_102207742 290
313 3300005468 Ga0070707_100244382 Ga0070707_1002443822 290
314 3300005518 Ga0070699_100241996 Ga0070699_1002419964 290
315 3300005518 Ga0070699_100254209 Ga0070699_1002542091 290
316 3300005536 Ga0070697_100003278 Ga0070697_10000327820 290
317 3300005546 Ga0070696_100002384 Ga0070696_1000023842 290
318 3300005549 Ga0070704_100002161 Ga0070704_1000021612 290
319 3300005719 Ga0068861_100036943 Ga0068861_1000369435 290
320 3300005843 Ga0068860_100263490 Ga0068860_1002634902 290
321 3300005844 Ga0068862_100004120 Ga0068862_1000041202 290
322 3300006177 Ga0075362_10167325 Ga0075362_101673251 290
323 3300006195 Ga0075366_10063870 Ga0075366_100638703 290
324 3300006881 Ga0068865_100286638 Ga0068865_1002866381 290
325 3300006914 Ga0075436_100179011 Ga0075436_1001790112 290
326 3300006948 Ga0099826_10000048 Ga0099826_1000004852 290
327 3300009148 Ga0105243_10298323 Ga0105243_102983232 290
328 3300010159 Ga0099796_10012057 Ga0099796_100120572 290
329 3300014968 Ga0157379_10046432 Ga0157379_100464327 290
330 3300025885 Ga0207653_10028108 Ga0207653_100281082 290
331 3300025907 Ga0207645_10045899 Ga0207645_100458994 290
332 3300025912 Ga0207707_10122118 Ga0207707_101221183 290
333 3300025915 Ga0207693_10041970 Ga0207693_100419702 290
334 3300025917 Ga0207660_10003611 Ga0207660_100036112 290
335 3300025918 Ga0207662_10013851 Ga0207662_100138513 290
336 3300025921 Ga0207652_10324440 Ga0207652_103244401 290
337 3300025933 Ga0207706_10080803 Ga0207706_100808032 290
338 3300025961 Ga0207712_10006615 Ga0207712_100066152 290
339 3300025961 Ga0207712_10207150 Ga0207712_102071502 290
340 3300026078 Ga0207702_10164048 Ga0207702_101640483 290
341 3300026116 Ga0207674_10241809 Ga0207674_102418092 290
342 3300026118 Ga0207675_100242987 Ga0207675_1002429872 290
343 3300027666 Ga0209282_1000066 Ga0209282_100006629 290
344 3300028380 Ga0268265_10002803 Ga0268265_1000280318 290
345 3300028381 Ga0268264_10054199 Ga0268264_100541991 290
346 3300028381 Ga0268264_10266516 Ga0268264_102665162 290
347 3300031712 Ga0265342_10162677 Ga0265342_101626771 290
348 3300031901 Ga0307406_10187695 Ga0307406_101876952 290
349 3300033180 Ga0307510_10001131 Ga0307510_100011315 290
350 3300046507 Ga0495606_0000995 Ga0495606_0000995_23052_23954 290
351 3300046512 Ga0495610_0124947 Ga0495610_0124947_175_1101 290
352 3300048905 Ga0496102_0446903 Ga0496102_0446903_232_1149 290
353 3300048910 Ga0496107_0202432 Ga0496107_0202432_323_1240 290
354 3300048918 Ga0496115_0255408 Ga0496115_0255408_406_1311 290
355 3300048924 Ga0496121_0007858 Ga0496121_0007858_2684_3586 290
356 3300048928 Ga0496125_0187464 Ga0496125_0187464_137_1039 290
357 3300048929 Ga0496126_0027737 Ga0496126_0027737_160_1092 290
358 3300050489 nmdc:mga03683_111587_c1 nmdc:mga03683_111587_c1_86_1003 290
359 3300050493 nmdc:mga0k408_7113_c2 nmdc:mga0k408_7113_c2_76_993 290
360 3300050514 nmdc:mga08x19_159757_c1 nmdc:mga08x19_159757_c1_348_1253 290
361 3300002741 JGI25157J39369_1000275 JGI25157J39369_100027521 291
362 3300005327 Ga0070658_10084854 Ga0070658_100848542 291
363 3300005331 Ga0070670_100034914 Ga0070670_1000349145 291
364 3300005355 Ga0070671_100234860 Ga0070671_1002348602 291
365 3300005434 Ga0070709_10022102 Ga0070709_100221024 291
366 3300005434 Ga0070709_10150123 Ga0070709_101501232 291
367 3300005435 Ga0070714_100015299 Ga0070714_1000152993 291
368 3300005435 Ga0070714_100073584 Ga0070714_1000735842 291
369 3300005435 Ga0070714_100116701 Ga0070714_1001167012 291
370 3300005436 Ga0070713_100010807 Ga0070713_1000108077 291
371 3300005436 Ga0070713_100012954 Ga0070713_1000129548 291
372 3300005437 Ga0070710_10001502 Ga0070710_100015027 291
373 3300005439 Ga0070711_100057746 Ga0070711_1000577464 291
374 3300005439 Ga0070711_100112773 Ga0070711_1001127732 291
375 3300005467 Ga0070706_100048438 Ga0070706_1000484383 291
376 3300005518 Ga0070699_100107346 Ga0070699_1001073463 291
377 3300005518 Ga0070699_100322423 Ga0070699_1003224232 291
378 3300005536 Ga0070697_100139421 Ga0070697_1001394212 291
379 3300005548 Ga0070665_100008836 Ga0070665_1000088363 291
380 3300005548 Ga0070665_100009026 Ga0070665_1000090267 291
381 3300005616 Ga0068852_100001546 Ga0068852_10000154610 291
382 3300005618 Ga0068864_100022500 Ga0068864_1000225003 291
383 3300005842 Ga0068858_100450200 Ga0068858_1004502002 291
384 3300006028 Ga0070717_10077865 Ga0070717_100778653 291
385 3300006028 Ga0070717_10091649 Ga0070717_100916492 291
386 3300006028 Ga0070717_10094032 Ga0070717_100940321 291
387 3300006038 Ga0075365_10010329 Ga0075365_100103296 291
388 3300006048 Ga0075363_100027917 Ga0075363_1000279173 291
389 3300006163 Ga0070715_10001855 Ga0070715_100018556 291
390 3300006163 Ga0070715_10130025 Ga0070715_101300251 291
391 3300006163 Ga0070715_10130533 Ga0070715_101305332 291
392 3300006173 Ga0070716_100004571 Ga0070716_1000045717 291
393 3300006173 Ga0070716_100226841 Ga0070716_1002268412 291
394 3300006175 Ga0070712_100088730 Ga0070712_1000887302 291
395 3300006178 Ga0075367_10086038 Ga0075367_100860383 291
396 3300006178 Ga0075367_10141357 Ga0075367_101413573 291
397 3300006237 Ga0097621_100025734 Ga0097621_1000257343 291
398 3300006358 Ga0068871_100009415 Ga0068871_1000094153 291
399 3300006358 Ga0068871_100461046 Ga0068871_1004610461 291
400 3300006844 Ga0075428_100007608 Ga0075428_10000760818 291
401 3300006914 Ga0075436_100124029 Ga0075436_1001240292 291
402 3300007076 Ga0075435_100070375 Ga0075435_1000703753 291
403 3300007788 Ga0099795_10004364 Ga0099795_100043642 291
404 3300009093 Ga0105240_10000347 Ga0105240_1000034773 291
405 3300009098 Ga0105245_10293824 Ga0105245_102938243 291
406 3300009551 Ga0105238_10000652 Ga0105238_1000065226 291
407 3300009551 Ga0105238_10011631 Ga0105238_100116314 291
408 3300009551 Ga0105238_10259529 Ga0105238_102595291 291
409 3300009553 Ga0105249_10000147 Ga0105249_1000014761 291
410 3300009553 Ga0105249_10510270 Ga0105249_105102701 291
411 3300010159 Ga0099796_10004111 Ga0099796_100041113 291
412 3300010375 Ga0105239_10095975 Ga0105239_100959753 291
413 3300011119 Ga0105246_10158277 Ga0105246_101582772 291
414 3300013100 Ga0157373_10082420 Ga0157373_100824202 291
415 3300013306 Ga0163162_10328750 Ga0163162_103287502 291
416 3300013308 Ga0157375_10036930 Ga0157375_100369303 291
417 3300013308 Ga0157375_10428840 Ga0157375_104288401 291
418 3300014497 Ga0182008_10011898 Ga0182008_100118983 291
419 3300014497 Ga0182008_10070777 Ga0182008_100707773 291
420 3300014497 Ga0182008_10172750 Ga0182008_101727501 291
421 3300014969 Ga0157376_10016887 Ga0157376_100168872 291
422 3300021361 Ga0213872_10024857 Ga0213872_100248573 291
423 3300025226 Ga0209674_101160 Ga0209674_1011602 291
424 3300025242 Ga0209258_109151 Ga0209258_1091512 291
425 3300025250 Ga0209026_1000105 Ga0209026_1000105120 291
426 3300025256 Ga0209759_1008897 Ga0209759_10088973 291
427 3300025898 Ga0207692_10004784 Ga0207692_100047845 291
428 3300025898 Ga0207692_10052010 Ga0207692_100520101 291
429 3300025905 Ga0207685_10009539 Ga0207685_100095393 291
430 3300025905 Ga0207685_10025083 Ga0207685_100250833 291
431 3300025906 Ga0207699_10028721 Ga0207699_100287213 291
432 3300025909 Ga0207705_10066512 Ga0207705_100665122 291
433 3300025913 Ga0207695_10000670 Ga0207695_1000067039 291
434 3300025913 Ga0207695_10464140 Ga0207695_104641401 291
435 3300025915 Ga0207693_10007521 Ga0207693_100075216 291
436 3300025915 Ga0207693_10063659 Ga0207693_100636592 291
437 3300025916 Ga0207663_10001619 Ga0207663_100016197 291
438 3300025924 Ga0207694_10002179 Ga0207694_100021792 291
439 3300025926 Ga0207659_10118219 Ga0207659_101182192 291
440 3300025927 Ga0207687_10011700 Ga0207687_100117003 291
441 3300025928 Ga0207700_10013123 Ga0207700_100131237 291
442 3300025928 Ga0207700_10034594 Ga0207700_100345942 291
443 3300025929 Ga0207664_10244204 Ga0207664_102442041 291
444 3300025931 Ga0207644_10249285 Ga0207644_102492852 291
445 3300025939 Ga0207665_10003514 Ga0207665_100035147 291
446 3300025939 Ga0207665_10044662 Ga0207665_100446622 291
447 3300025939 Ga0207665_10130074 Ga0207665_101300741 291
448 3300025942 Ga0207689_10335965 Ga0207689_103359651 291
449 3300025961 Ga0207712_10000090 Ga0207712_1000009071 291
450 3300025972 Ga0207668_10221440 Ga0207668_102214401 291
451 3300026078 Ga0207702_10165390 Ga0207702_101653902 291
452 3300026142 Ga0207698_10001115 Ga0207698_1000111510 291
453 3300027512 Ga0209179_1012911 Ga0209179_10129112 291
454 3300027671 Ga0209588_1009522 Ga0209588_10095222 291
455 3300027671 Ga0209588_1019109 Ga0209588_10191093 291
456 3300028379 Ga0268266_10007036 Ga0268266_100070363 291
457 3300028381 Ga0268264_10091715 Ga0268264_100917153 291
458 3300028556 Ga0265337_1012122 Ga0265337_10121223 291
459 3300028563 Ga0265319_1006202 Ga0265319_10062027 291
460 3300028573 Ga0265334_10003965 Ga0265334_100039658 291
461 3300028653 Ga0265323_10000311 Ga0265323_100003118 291
462 3300028666 Ga0265336_10000074 Ga0265336_1000007450 291
463 3300028794 Ga0307515_10002583 Ga0307515_100025837 291
464 3300028800 Ga0265338_10000137 Ga0265338_1000013791 291
465 3300029957 Ga0265324_10003671 Ga0265324_100036717 291
466 3300031616 Ga0307508_10077347 Ga0307508_100773471 291
467 3300031711 Ga0265314_10019587 Ga0265314_100195874 291
468 3300031712 Ga0265342_10014254 Ga0265342_100142545 291
469 3300031730 Ga0307516_10005013 Ga0307516_1000501311 291
470 3300035120 Ga0373957_0094347 Ga0373957_0094347_79_1014 291
471 3300035695 Ga0373927_0066673 Ga0373927_0066673_11_958 291
472 3300035724 Ga0373933_0063072 Ga0373933_0063072_274_1209 291
473 3300036401 Ga0373937_0101725 Ga0373937_0101725_1649_2584 291
474 3300041501 Ga0451845_0637907 Ga0451845_0637907_412_1341 291
475 3300046460 Ga0495638_0000087 Ga0495638_0000087_140499_141434 291
476 3300046471 Ga0495650_0000502 Ga0495650_0000502_38607_39542 291
477 3300046471 Ga0495650_0000705 Ga0495650_0000705_10786_11721 291
478 3300046522 Ga0495643_0017028 Ga0495643_0017028_985_1914 291
479 3300046524 Ga0495648_0008727 Ga0495648_0008727_3387_4322 291
480 3300046616 Ga0495668_0005238 Ga0495668_0005238_6747_7682 291
481 3300046660 Ga0495625_0043826 Ga0495625_0043826_299_1234 291
482 3300047320 Ga0495672_0043070 Ga0495672_0043070_1437_2378 291
483 3300048905 Ga0496102_0142088 Ga0496102_0142088_234_1208 291
484 3300048908 Ga0496105_0052529 Ga0496105_0052529_1726_2700 291
485 3300048912 Ga0496109_0027213 Ga0496109_0027213_2388_3362 291
486 3300048913 Ga0496110_0034477 Ga0496110_0034477_2917_3891 291
487 3300048914 Ga0496111_0115048 Ga0496111_0115048_285_1259 291
488 3300048915 Ga0496112_0043866 Ga0496112_0043866_1130_2104 291
489 3300048917 Ga0496114_0058419 Ga0496114_0058419_2218_3153 291
490 3300048917 Ga0496114_0144114 Ga0496114_0144114_1055_2029 291
491 3300048918 Ga0496115_0104874 Ga0496115_0104874_850_1785 291
492 3300048925 Ga0496122_0000488 Ga0496122_0000488_79138_80049 291
493 3300048926 Ga0496123_0002461 Ga0496123_0002461_2100_3011 291
494 3300048927 Ga0496124_0055855 Ga0496124_0055855_594_1502 291
495 3300048928 Ga0496125_0111273 Ga0496125_0111273_988_1896 291
496 3300048928 Ga0496125_0123814 Ga0496125_0123814_107_1015 291
497 3300048929 Ga0496126_0033299 Ga0496126_0033299_1566_2504 291
498 3300048929 Ga0496126_0135369 Ga0496126_0135369_1007_1942 291
499 3300050494 nmdc:mga06z11_236968_c1 nmdc:mga06z11_236968_c1_14_949 291
500 3300050510 nmdc:mga06r32_201853_c1 nmdc:mga06r32_201853_c1_426_1391 291
501 3300053092 Ga0500583_0117430 Ga0500583_0117430_28_963 291
502 3300053119 Ga0500595_004871 Ga0500595_004871_4826_5746 291
503 3300053735 Ga0500596_007300 Ga0500596_007300_442_1371 291
504 3300005617 Ga0068859_100722165 Ga0068859_1007221652 292
505 3300006931 Ga0097620_100722120 Ga0097620_1007221202 292
506 3300009101 Ga0105247_10042421 Ga0105247_100424213 292
507 3300025909 Ga0207705_10145304 Ga0207705_101453043 292
508 3300025942 Ga0207689_10099054 Ga0207689_100990543 292
509 3300041452 Ga0451793_1635360 Ga0451793_1635360_37_972 292
510 3300048907 Ga0496104_0019935 Ga0496104_0019935_2155_3123 292
511 3300046462 Ga0495651_0077803 Ga0495651_0077803_1110_2060 293
512 3300046679 Ga0495623_0046096 Ga0495623_0046096_704_1654 293
513 3300053119 Ga0500595_042230 Ga0500595_042230_120_1049 293
514 iso_pu_bacteria 2510461076 2510898199 296
515 iso_pu_bacteria 2510917028 2511181625 296
516 iso_pu_bacteria 2510917030 2511197419 296
517 iso_pu_bacteria 2513237084 2513573485 296
518 iso_pu_bacteria 2513237085 2513581006 296
519 iso_pu_bacteria 2513237088 2513596585 296
520 iso_pu_bacteria 2513237138 2513867330 296
521 iso_pu_bacteria 2515075009 2515110847 296
522 iso_pu_bacteria 2515154116 2515661816 296
523 iso_pu_bacteria 2515154134 2515743230 296
524 iso_pu_bacteria 2517287029 2517405449 296
525 iso_pu_bacteria 2582581298 2585226675 296
526 iso_pu_bacteria 2582581299 2585227606 296
527 iso_pu_bacteria 2585427526 2585525185 296
528 iso_pu_bacteria 2585427529 2585550090 296
529 iso_pu_bacteria 2585427590 2585820383 296
530 iso_pu_bacteria 2791355260 2793320196 296
531 iso_pu_bacteria 2896384573 2896390591 296
532 iso_pu_bacteria 2919100787 2919107141 296
533 iso_pu_bacteria 2923556063 2923560802 296
534 iso_pu_bacteria 2933016740 2933018837 296
535 iso_pu_bacteria 2935901341 2935906757 296
536 iso_pu_bacteria 8005301065 8005304240 296
537 iso_pu_bacteria 8005307578 8005310977 296
538 iso_pu_bacteria 8005376324 8005377049 296
539 iso_pu_bacteria 8005460587 8005461485 296
540 iso_pu_bacteria 8005484373 8005489628 296
541 iso_pu_bacteria 8005688590 8005690662 296
542 iso_pu_bacteria 8023680758 8023683546 296
543 3300002739 JGI25158J39367_1000048 JGI25158J39367_100004816 300
544 3300002773 JGI25152J39213_1003470 JGI25152J39213_10034704 300
545 3300002773 JGI25152J39213_1008106 JGI25152J39213_10081062 300
546 3300002987 JGI25159J45721_1001278 JGI25159J45721_10012787 300
547 3300003215 JGI25153J46596_10002410 JGI25153J46596_100024102 300
548 3300003215 JGI25153J46596_10019046 JGI25153J46596_100190462 300
549 3300003320 rootH2_10024597 rootH2_100245974 300
550 3300003354 JGI25160J50197_1018991 JGI25160J50197_10189912 300
551 3300003354 JGI25160J50197_1027207 JGI25160J50197_10272072 300
552 3300003374 JGI25161J50226_1000267 JGI25161J50226_100026719 300
553 3300003771 Ga0055526_1003629 Ga0055526_10036298 300
554 3300003771 Ga0055526_1010616 Ga0055526_10106164 300
555 3300003775 Ga0055524_1018952 Ga0055524_10189521 300
556 3300003775 Ga0055524_1041739 Ga0055524_10417391 300
557 3300003790 Ga0055528_1003043 Ga0055528_10030433 300
558 3300003790 Ga0055528_1009119 Ga0055528_10091193 300
559 3300004625 Ga0055543_1000065 Ga0055543_100006587 300
560 3300005262 Ga0065165_1015708 Ga0065165_10157083 300
561 3300006038 Ga0075365_10027162 Ga0075365_100271625 300
562 3300009551 Ga0105238_10563623 Ga0105238_105636232 300
563 3300025208 Ga0209436_100014 Ga0209436_100014110 300
564 3300025245 Ga0207425_1000834 Ga0207425_100083417 300
565 3300025258 Ga0209129_1001143 Ga0209129_10011433 300
566 3300025258 Ga0209129_1001619 Ga0209129_10016198 300
567 3300025273 Ga0209673_1001862 Ga0209673_100186210 300
568 3300025273 Ga0209673_1010761 Ga0209673_10107612 300
569 3300025284 Ga0209130_1000004 Ga0209130_1000004530 300
570 3300025295 Ga0209564_1001123 Ga0209564_100112324 300
571 3300025295 Ga0209564_1001210 Ga0209564_100121010 300
572 3300025297 Ga0209758_1000829 Ga0209758_100082944 300
573 3300025297 Ga0209758_1010623 Ga0209758_10106232 300
574 3300025297 Ga0209758_1030014 Ga0209758_10300142 300
575 3300025299 Ga0209256_1004729 Ga0209256_10047293 300
576 3300025299 Ga0209256_1008836 Ga0209256_10088362 300
577 3300025299 Ga0209256_1012970 Ga0209256_10129702 300
578 3300025302 Ga0207426_1000003 Ga0207426_1000003196 300
579 3300025302 Ga0207426_1025964 Ga0207426_10259642 300
580 3300025303 Ga0209051_1008436 Ga0209051_10084367 300
581 3300025304 Ga0209257_1029054 Ga0209257_10290542 300
582 3300041413 Ga0439465_0005022 Ga0439465_0005022_89_991 300
583 3300041496 Ga0451839_0567018 Ga0451839_0567018_103_1020 300
584 3300041501 Ga0451845_0717355 Ga0451845_0717355_2682_3599 300
585 3300041503 Ga0451847_0263760 Ga0451847_0263760_397_1314 300
586 3300041505 Ga0451849_0301535 Ga0451849_0301535_1937_2854 300
587 3300041509 Ga0451843_1036654 Ga0451843_1036654_2207_3124 300
588 3300041511 Ga0451855_0164364 Ga0451855_0164364_1978_2895 300
589 3300041512 Ga0451853_3204310 Ga0451853_3204310_380_1297 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

117

169

0.96

PF04542

Sigma70_r2

Sigma-70 region 2

19

87

0.95

PF12680

SnoaL_2

SnoaL-like domain

189

287

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.9873 125 175
1h3l-assembly1.cif.gz_A n-terminal fragment of sigr from streptomyces coelicolor 0.9041 16 83
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.8969 129 177
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.8626 116 173
5f64-assembly2.cif.gz_C putative positive transcription regulator (sensor evgs) from shigella flexneri 0.8589 123 173
ID Description Score Start End Superfamily
4go1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9263 132 170 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9145 129 173 1.10.10.10
1h3lB00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.905 16 83 1.10.1740.10
1h3lA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9041 16 83 1.10.1740.10
3kloB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8966 125 174 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6A7M8E9-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9096 17 297 GO:0003677
GO:0006352
GO:0016987
AF-A0A502RJE7-F1-model_v4 deleted 0.8736 1 300
AF-A0A6A7M8E9-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8713 17 297 GO:0003677
GO:0006352
GO:0016987
AF-A0A502RJE7-F1-model_v4 deleted 0.8709 1 300
AF-A0A4R0YHQ0-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8666 20 300 GO:0003677
GO:0006352
GO:0016987

Feature Viewer

pLDDT pTM Quality
85.08 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map