F466846
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 589 | 424 | 448 | 301 |
Family's Representative Sequence
| Representative Sequence | 3300006163|Ga0070715_10130533|Ga0070715_101305332 |
| Length | 325 |
| Sequence | LNAGQSTSDRDRRTEFLALAGELRPELHRYCARLMGSVIDGEDVVQDTFARALVALGEIEEMPRIRPWLFRIAHNRALDLLRSRAGRKAEPIEAAADVADQTNPDPMEVLMRQEAVKTAVSRFAELPTIQRSVVILKDVLDEPLKDIAELLDLTVDAVKAHLARGRARLREINAHAATLAEARPASAAVARYVTLFNARNWDGLRALLADDVKLHQSTYPVRVGAADVGMFFTIYAKFEGVRLAPAWVEGREVIAVFEDGTDAKPSYFMWLEWRGDRISFIRDYRYARYIVTDAELMLAVDGEACSQQEYPHQDAIVRDQSANGM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 2 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 3 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 4 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 5 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 6 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 7 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 8 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 9 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 10 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 11 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 12 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 13 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 14 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 15 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 16 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 17 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 18 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 19 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 20 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 21 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 22 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 23 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 24 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 25 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 26 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 27 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 28 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 29 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 30 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 31 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 32 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 33 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 34 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 35 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 36 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 37 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 38 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 39 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 40 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 41 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 42 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 43 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 44 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 45 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 46 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 47 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 48 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 49 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 50 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 51 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 52 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 53 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 54 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 55 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 56 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 57 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 58 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 59 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 60 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 61 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 62 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 63 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 64 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 65 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 66 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 67 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 68 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 69 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 70 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 71 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 72 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 73 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 74 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 75 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 76 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 77 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 78 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 79 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 80 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 81 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 82 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 83 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 84 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 85 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 86 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 87 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 88 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 89 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 90 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 91 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 92 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 93 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 94 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 95 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 96 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 97 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 98 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 99 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 100 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 101 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 102 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 103 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 104 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 105 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 106 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 107 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 108 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 109 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 110 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 111 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 112 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 113 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 114 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 115 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 116 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 117 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 118 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 119 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 120 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 121 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 122 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 123 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 124 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 125 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 126 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 127 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 128 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 129 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 130 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 131 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 132 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 133 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 134 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 135 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 136 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 137 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 138 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 139 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 140 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 141 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 142 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 143 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 144 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 146 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 149 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 153 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 155 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 156 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 159 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 164 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 165 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 166 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 168 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 171 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 172 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 173 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 174 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 175 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 176 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 177 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 178 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 179 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 181 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 182 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 183 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 184 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 185 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 186 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 187 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 188 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 190 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 191 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 192 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 193 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 195 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 196 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 197 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 198 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 210 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 220 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 223 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 224 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 225 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 229 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 230 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 231 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 232 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 234 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 235 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 237 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 240 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 280 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 286 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 287 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 288 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 289 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 290 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 291 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 292 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 293 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 294 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 295 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 296 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 297 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 298 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 299 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 300 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 301 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 302 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 303 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 304 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 305 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 306 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 307 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 308 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 309 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 310 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 311 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 312 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 313 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 314 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 315 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 316 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 317 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 318 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 319 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 320 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 322 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 323 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 324 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 325 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 326 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 327 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 328 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 329 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 330 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 331 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 332 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 333 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 353 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 354 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 355 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 356 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 357 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 361 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 362 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 363 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 364 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 365 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 366 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 367 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 368 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 369 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 370 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 371 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 372 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 373 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 374 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 378 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 379 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 381 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 382 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 383 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 387 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 388 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 393 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 395 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 396 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 397 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 398 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 399 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 400 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 401 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 403 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 404 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 405 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 406 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 407 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 408 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 409 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 410 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 413 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 414 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 415 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 416 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 417 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 418 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 419 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 420 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 421 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 422 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 423 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 424 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.06 |
| Metatranscriptomes | 0 |
| Isolates | 23.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.45 |
| Nodule | 18.68 |
| Rhizoplane | 5.43 |
| Rhizosphere | 50.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1000048 | 3300002739 | Bacteria | 27557 |
| 2 | JGI25157J39369_1000275 | 3300002741 | Bacteria | 37720 |
| 3 | JGI25157J39369_1000447 | 3300002741 | Bacteria | 26448 |
| 4 | JGI25152J39213_1003470 | 3300002773 | Bacteria | 5366 |
| 5 | JGI25152J39213_1008106 | 3300002773 | Bacteria | 2640 |
| 6 | JGI25159J45721_1001278 | 3300002987 | Bacteria | 10640 |
| 7 | JGI25159J45721_1004266 | 3300002987 | Bacteria | 4803 |
| 8 | JGI25153J46596_10002410 | 3300003215 | Bacteria | 10798 |
| 9 | JGI25153J46596_10019046 | 3300003215 | Bacteria | 2640 |
| 10 | rootH2_10024597 | 3300003320 | Bacteria | 3162 |
| 11 | JGI25160J50197_1018991 | 3300003354 | Bacteria | 2124 |
| 12 | JGI25160J50197_1027207 | 3300003354 | Bacteria | 1562 |
| 13 | JGI25161J50226_1000267 | 3300003374 | Bacteria | 30667 |
| 14 | Ga0055526_1003629 | 3300003771 | Bacteria | 9663 |
| 15 | Ga0055526_1006240 | 3300003771 | Bacteria | 6536 |
| 16 | Ga0055526_1010616 | 3300003771 | Bacteria | 4263 |
| 17 | Ga0055526_1034022 | 3300003771 | Bacteria | 1400 |
| 18 | Ga0055537_1022897 | 3300003773 | Bacteria | 903 |
| 19 | Ga0055524_1018952 | 3300003775 | Bacteria | 2369 |
| 20 | Ga0055524_1041739 | 3300003775 | Bacteria | 1151 |
| 21 | Ga0055528_1003043 | 3300003790 | Bacteria | 8635 |
| 22 | Ga0055528_1009119 | 3300003790 | Bacteria | 4180 |
| 23 | Ga0055540_1000625 | 3300003792 | Bacteria | 25161 |
| 24 | Ga0055543_1000065 | 3300004625 | Bacteria | 97333 |
| 25 | Ga0065165_1000620 | 3300005262 | Bacteria | 51540 |
| 26 | Ga0065165_1015708 | 3300005262 | Bacteria | 2875 |
| 27 | Ga0070658_10084854 | 3300005327 | Bacteria | 2604 |
| 28 | Ga0070658_10273813 | 3300005327 | Unclassified | 1436 |
| 29 | Ga0070683_100043996 | 3300005329 | Unclassified | 4117 |
| 30 | Ga0070683_100367488 | 3300005329 | Unclassified | 1370 |
| 31 | Ga0070670_100034914 | 3300005331 | Bacteria | 4328 |
| 32 | Ga0070660_100000440 | 3300005339 | Bacteria | 27590 |
| 33 | Ga0070691_10020480 | 3300005341 | Bacteria | 3056 |
| 34 | Ga0070669_100278197 | 3300005353 | Unclassified | 1340 |
| 35 | Ga0070671_100234860 | 3300005355 | Bacteria | 1556 |
| 36 | Ga0070673_100088264 | 3300005364 | Unclassified | 2529 |
| 37 | Ga0070709_10022102 | 3300005434 | Bacteria | 3716 |
| 38 | Ga0070709_10150123 | 3300005434 | Bacteria | 1610 |
| 39 | Ga0070714_100015299 | 3300005435 | Bacteria | 6173 |
| 40 | Ga0070714_100073584 | 3300005435 | Bacteria | 2961 |
| 41 | Ga0070714_100116701 | 3300005435 | Bacteria | 2370 |
| 42 | Ga0070713_100010807 | 3300005436 | Bacteria | 6615 |
| 43 | Ga0070713_100012954 | 3300005436 | Bacteria | 6139 |
| 44 | Ga0070710_10001502 | 3300005437 | Bacteria | 10994 |
| 45 | Ga0070711_100057746 | 3300005439 | Bacteria | 2688 |
| 46 | Ga0070711_100112773 | 3300005439 | Bacteria | 1998 |
| 47 | Ga0070705_100001785 | 3300005440 | Bacteria | 11131 |
| 48 | Ga0070694_100191373 | 3300005444 | Bacteria | 1519 |
| 49 | Ga0070708_100013986 | 3300005445 | Bacteria | 6591 |
| 50 | Ga0070663_100061193 | 3300005455 | Bacteria | 2710 |
| 51 | Ga0070663_100089297 | 3300005455 | Bacteria | 2280 |
| 52 | Ga0070678_100030472 | 3300005456 | Unclassified | 3708 |
| 53 | Ga0070662_100275706 | 3300005457 | Bacteria | 1359 |
| 54 | Ga0070681_10220774 | 3300005458 | Bacteria | 1810 |
| 55 | Ga0070706_100048438 | 3300005467 | Bacteria | 3922 |
| 56 | Ga0070706_100076602 | 3300005467 | Bacteria | 3095 |
| 57 | Ga0070707_100244382 | 3300005468 | Bacteria | 1747 |
| 58 | Ga0070699_100107346 | 3300005518 | Bacteria | 2449 |
| 59 | Ga0070699_100241996 | 3300005518 | Bacteria | 1611 |
| 60 | Ga0070699_100254209 | 3300005518 | Bacteria | 1570 |
| 61 | Ga0070699_100322423 | 3300005518 | Bacteria | 1389 |
| 62 | Ga0070697_100003278 | 3300005536 | Bacteria | 12430 |
| 63 | Ga0070697_100139421 | 3300005536 | Bacteria | 2038 |
| 64 | Ga0070696_100002384 | 3300005546 | Bacteria | 12429 |
| 65 | Ga0070665_100008836 | 3300005548 | Bacteria | 10199 |
| 66 | Ga0070665_100009026 | 3300005548 | Bacteria | 10100 |
| 67 | Ga0070665_100174031 | 3300005548 | Bacteria | 2153 |
| 68 | Ga0070704_100002161 | 3300005549 | Bacteria | 10947 |
| 69 | Ga0068855_100686748 | 3300005563 | Bacteria | 1097 |
| 70 | Ga0068852_100001546 | 3300005616 | Bacteria | 15615 |
| 71 | Ga0068859_100227538 | 3300005617 | Bacteria | 1953 |
| 72 | Ga0068859_100722165 | 3300005617 | Bacteria | 1086 |
| 73 | Ga0068864_100022500 | 3300005618 | Bacteria | 5285 |
| 74 | Ga0068861_100036943 | 3300005719 | Bacteria | 3629 |
| 75 | Ga0068858_100122988 | 3300005842 | Bacteria | 2428 |
| 76 | Ga0068858_100450200 | 3300005842 | Bacteria | 1241 |
| 77 | Ga0068860_100263490 | 3300005843 | Bacteria | 1680 |
| 78 | Ga0068862_100004120 | 3300005844 | Bacteria | 12315 |
| 79 | Ga0070717_10077865 | 3300006028 | Bacteria | 2777 |
| 80 | Ga0070717_10091649 | 3300006028 | Bacteria | 2567 |
| 81 | Ga0070717_10094032 | 3300006028 | Bacteria | 2535 |
| 82 | Ga0075365_10010329 | 3300006038 | Bacteria | 5427 |
| 83 | Ga0075365_10027162 | 3300006038 | Bacteria | 3639 |
| 84 | Ga0075363_100027917 | 3300006048 | Bacteria | 2898 |
| 85 | Ga0070715_10001855 | 3300006163 | Bacteria | 6321 |
| 86 | Ga0070715_10130025 | 3300006163 | Bacteria | 1211 |
| 87 | Ga0070715_10130533 | 3300006163 | Bacteria | 1209 |
| 88 | Ga0070716_100004571 | 3300006173 | Bacteria | 6629 |
| 89 | Ga0070716_100226841 | 3300006173 | Bacteria | 1258 |
| 90 | Ga0070712_100088730 | 3300006175 | Bacteria | 2260 |
| 91 | Ga0075362_10015002 | 3300006177 | Bacteria | 3142 |
| 92 | Ga0075362_10167325 | 3300006177 | Bacteria | 1061 |
| 93 | Ga0075367_10086038 | 3300006178 | Bacteria | 1907 |
| 94 | Ga0075367_10141357 | 3300006178 | Bacteria | 1491 |
| 95 | Ga0075366_10063870 | 3300006195 | Bacteria | 2189 |
| 96 | Ga0097621_100025734 | 3300006237 | Bacteria | 4607 |
| 97 | Ga0068871_100009415 | 3300006358 | Bacteria | 7076 |
| 98 | Ga0068871_100461046 | 3300006358 | Bacteria | 1141 |
| 99 | Ga0075428_100007608 | 3300006844 | Bacteria | 12008 |
| 100 | Ga0068865_100286638 | 3300006881 | Bacteria | 1313 |
| 101 | Ga0075436_100124029 | 3300006914 | Bacteria | 1809 |
| 102 | Ga0075436_100179011 | 3300006914 | Bacteria | 1498 |
| 103 | Ga0097620_100227559 | 3300006931 | Bacteria | 1953 |
| 104 | Ga0097620_100722120 | 3300006931 | Bacteria | 1086 |
| 105 | Ga0099826_10000048 | 3300006948 | Bacteria | 74895 |
| 106 | Ga0075435_100070375 | 3300007076 | Bacteria | 2855 |
| 107 | Ga0099794_10015044 | 3300007265 | Bacteria | 3406 |
| 108 | Ga0099795_10003674 | 3300007788 | Bacteria | 3839 |
| 109 | Ga0099795_10004364 | 3300007788 | Bacteria | 3640 |
| 110 | Ga0099795_10017346 | 3300007788 | Bacteria | 2294 |
| 111 | Ga0099795_10020178 | 3300007788 | Bacteria | 2167 |
| 112 | Ga0105244_10014085 | 3300009036 | Bacteria | 4639 |
| 113 | Ga0105240_10000347 | 3300009093 | Bacteria | 86681 |
| 114 | Ga0105240_10003911 | 3300009093 | Bacteria | 23011 |
| 115 | Ga0105240_10229086 | 3300009093 | Bacteria | 2161 |
| 116 | Ga0105240_10465956 | 3300009093 | Unclassified | 1411 |
| 117 | Ga0105245_10000158 | 3300009098 | Bacteria | 63785 |
| 118 | Ga0105245_10293824 | 3300009098 | Bacteria | 1592 |
| 119 | Ga0105247_10042421 | 3300009101 | Bacteria | 2787 |
| 120 | Ga0114129_10417677 | 3300009147 | Bacteria | 1765 |
| 121 | Ga0105243_10298323 | 3300009148 | Bacteria | 1459 |
| 122 | Ga0105241_10197551 | 3300009174 | Bacteria | 1678 |
| 123 | Ga0105248_10010141 | 3300009177 | Bacteria | 10379 |
| 124 | Ga0105237_10032105 | 3300009545 | Bacteria | 5317 |
| 125 | Ga0105237_10035214 | 3300009545 | Bacteria | 5067 |
| 126 | Ga0105237_10162557 | 3300009545 | Bacteria | 2231 |
| 127 | Ga0105238_10000652 | 3300009551 | Bacteria | 36418 |
| 128 | Ga0105238_10011631 | 3300009551 | Bacteria | 8866 |
| 129 | Ga0105238_10011692 | 3300009551 | Bacteria | 8848 |
| 130 | Ga0105238_10025745 | 3300009551 | Bacteria | 5999 |
| 131 | Ga0105238_10259529 | 3300009551 | Bacteria | 1717 |
| 132 | Ga0105238_10563623 | 3300009551 | Bacteria | 1144 |
| 133 | Ga0105249_10000147 | 3300009553 | Bacteria | 89436 |
| 134 | Ga0105249_10005424 | 3300009553 | Bacteria | 11011 |
| 135 | Ga0105249_10371545 | 3300009553 | Bacteria | 1454 |
| 136 | Ga0105249_10510270 | 3300009553 | Bacteria | 1249 |
| 137 | Ga0099796_10001617 | 3300010159 | Bacteria | 4638 |
| 138 | Ga0099796_10004111 | 3300010159 | Bacteria | 3478 |
| 139 | Ga0099796_10012057 | 3300010159 | Unclassified | 2429 |
| 140 | Ga0099796_10012156 | 3300010159 | Bacteria | 2423 |
| 141 | Ga0099796_10014092 | 3300010159 | Bacteria | 2301 |
| 142 | Ga0099796_10017901 | 3300010159 | Bacteria | 2118 |
| 143 | Ga0099796_10064311 | 3300010159 | Bacteria | 1309 |
| 144 | Ga0099796_10080961 | 3300010159 | Bacteria | 1191 |
| 145 | Ga0105239_10006979 | 3300010375 | Bacteria | 13013 |
| 146 | Ga0105239_10095975 | 3300010375 | Bacteria | 3275 |
| 147 | Ga0105239_10236065 | 3300010375 | Bacteria | 2052 |
| 148 | Ga0105239_10239162 | 3300010375 | Bacteria | 2038 |
| 149 | Ga0105239_10403250 | 3300010375 | Bacteria | 1548 |
| 150 | Ga0105246_10158277 | 3300011119 | Bacteria | 1723 |
| 151 | Ga0157373_10036351 | 3300013100 | Bacteria | 3535 |
| 152 | Ga0157373_10082420 | 3300013100 | Bacteria | 2267 |
| 153 | Ga0157373_10211853 | 3300013100 | Bacteria | 1366 |
| 154 | Ga0157371_10005288 | 3300013102 | Bacteria | 10936 |
| 155 | Ga0157369_10191135 | 3300013105 | Bacteria | 2151 |
| 156 | Ga0157374_10159250 | 3300013296 | Bacteria | 2199 |
| 157 | Ga0157374_10172479 | 3300013296 | Bacteria | 2110 |
| 158 | Ga0163162_10328750 | 3300013306 | Bacteria | 1661 |
| 159 | Ga0163162_10398025 | 3300013306 | Bacteria | 1510 |
| 160 | Ga0157375_10036930 | 3300013308 | Bacteria | 4676 |
| 161 | Ga0157375_10428840 | 3300013308 | Bacteria | 1488 |
| 162 | Ga0163163_10318078 | 3300014325 | Bacteria | 1610 |
| 163 | Ga0182008_10000711 | 3300014497 | Bacteria | 23842 |
| 164 | Ga0182008_10010121 | 3300014497 | Bacteria | 5057 |
| 165 | Ga0182008_10011898 | 3300014497 | Bacteria | 4611 |
| 166 | Ga0182008_10070777 | 3300014497 | Bacteria | 1716 |
| 167 | Ga0182008_10172750 | 3300014497 | Bacteria | 1091 |
| 168 | Ga0157379_10046432 | 3300014968 | Bacteria | 3874 |
| 169 | Ga0157376_10016887 | 3300014969 | Bacteria | 5553 |
| 170 | Ga0182006_1000964 | 3300015261 | Bacteria | 19073 |
| 171 | Ga0182007_10027390 | 3300015262 | Bacteria | 1965 |
| 172 | Ga0213872_10024857 | 3300021361 | Bacteria | 2755 |
| 173 | Ga0209436_100014 | 3300025208 | Bacteria | 127004 |
| 174 | Ga0209674_101160 | 3300025226 | Bacteria | 7621 |
| 175 | Ga0209258_109151 | 3300025242 | Bacteria | 1349 |
| 176 | Ga0207425_1000834 | 3300025245 | Bacteria | 15364 |
| 177 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 178 | Ga0209026_1000105 | 3300025250 | Bacteria | 150738 |
| 179 | Ga0209759_1000381 | 3300025256 | Bacteria | 55381 |
| 180 | Ga0209759_1008897 | 3300025256 | Bacteria | 3089 |
| 181 | Ga0209129_1001143 | 3300025258 | Bacteria | 15345 |
| 182 | Ga0209129_1001619 | 3300025258 | Bacteria | 12212 |
| 183 | Ga0209233_1008961 | 3300025261 | Bacteria | 3062 |
| 184 | Ga0209565_1000056 | 3300025263 | Bacteria | 200189 |
| 185 | Ga0209673_1001862 | 3300025273 | Bacteria | 17116 |
| 186 | Ga0209673_1010761 | 3300025273 | Bacteria | 3830 |
| 187 | Ga0209130_1000004 | 3300025284 | Bacteria | 633436 |
| 188 | Ga0209130_1000258 | 3300025284 | Bacteria | 66568 |
| 189 | Ga0209564_1001123 | 3300025295 | Bacteria | 31480 |
| 190 | Ga0209564_1001210 | 3300025295 | Bacteria | 29473 |
| 191 | Ga0209564_1002678 | 3300025295 | Bacteria | 13511 |
| 192 | Ga0209564_1011983 | 3300025295 | Bacteria | 3824 |
| 193 | Ga0209758_1000829 | 3300025297 | Bacteria | 43270 |
| 194 | Ga0209758_1010623 | 3300025297 | Bacteria | 5479 |
| 195 | Ga0209758_1023936 | 3300025297 | Bacteria | 2741 |
| 196 | Ga0209758_1030014 | 3300025297 | Bacteria | 2259 |
| 197 | Ga0209050_1010014 | 3300025298 | Bacteria | 4741 |
| 198 | Ga0209256_1004729 | 3300025299 | Bacteria | 8332 |
| 199 | Ga0209256_1008836 | 3300025299 | Bacteria | 4559 |
| 200 | Ga0209256_1012970 | 3300025299 | Bacteria | 3133 |
| 201 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 202 | Ga0207426_1016331 | 3300025302 | Bacteria | 2668 |
| 203 | Ga0207426_1023086 | 3300025302 | Bacteria | 2126 |
| 204 | Ga0207426_1025964 | 3300025302 | Bacteria | 1968 |
| 205 | Ga0209051_1000271 | 3300025303 | Bacteria | 86541 |
| 206 | Ga0209051_1008436 | 3300025303 | Bacteria | 5454 |
| 207 | Ga0209257_1028088 | 3300025304 | Bacteria | 1858 |
| 208 | Ga0209257_1029054 | 3300025304 | Bacteria | 1807 |
| 209 | Ga0207655_1012006 | 3300025728 | Bacteria | 5104 |
| 210 | Ga0207653_10028108 | 3300025885 | Bacteria | 1807 |
| 211 | Ga0207692_10004784 | 3300025898 | Bacteria | 5382 |
| 212 | Ga0207692_10052010 | 3300025898 | Bacteria | 2079 |
| 213 | Ga0207685_10009539 | 3300025905 | Bacteria | 2824 |
| 214 | Ga0207685_10025083 | 3300025905 | Bacteria | 2053 |
| 215 | Ga0207699_10028721 | 3300025906 | Bacteria | 3094 |
| 216 | Ga0207645_10045899 | 3300025907 | Bacteria | 2791 |
| 217 | Ga0207705_10066512 | 3300025909 | Bacteria | 2607 |
| 218 | Ga0207705_10145304 | 3300025909 | Bacteria | 1774 |
| 219 | Ga0207684_10123489 | 3300025910 | Bacteria | 2221 |
| 220 | Ga0207707_10122118 | 3300025912 | Bacteria | 2277 |
| 221 | Ga0207695_10000670 | 3300025913 | Bacteria | 67451 |
| 222 | Ga0207695_10007545 | 3300025913 | Bacteria | 13789 |
| 223 | Ga0207695_10129125 | 3300025913 | Bacteria | 2486 |
| 224 | Ga0207695_10246174 | 3300025913 | Bacteria | 1688 |
| 225 | Ga0207695_10464140 | 3300025913 | Bacteria | 1149 |
| 226 | Ga0207671_10008171 | 3300025914 | Bacteria | 8927 |
| 227 | Ga0207693_10007521 | 3300025915 | Bacteria | 8946 |
| 228 | Ga0207693_10041970 | 3300025915 | Bacteria | 3601 |
| 229 | Ga0207693_10063659 | 3300025915 | Bacteria | 2889 |
| 230 | Ga0207663_10001619 | 3300025916 | Bacteria | 10601 |
| 231 | Ga0207660_10003611 | 3300025917 | Bacteria | 10079 |
| 232 | Ga0207662_10013851 | 3300025918 | Bacteria | 4514 |
| 233 | Ga0207652_10324440 | 3300025921 | Bacteria | 1390 |
| 234 | Ga0207694_10002179 | 3300025924 | Bacteria | 16085 |
| 235 | Ga0207694_10007507 | 3300025924 | Bacteria | 8266 |
| 236 | Ga0207659_10118219 | 3300025926 | Bacteria | 2027 |
| 237 | Ga0207687_10000162 | 3300025927 | Bacteria | 45005 |
| 238 | Ga0207687_10011700 | 3300025927 | Bacteria | 5739 |
| 239 | Ga0207700_10013123 | 3300025928 | Bacteria | 5376 |
| 240 | Ga0207700_10034594 | 3300025928 | Bacteria | 3629 |
| 241 | Ga0207664_10244204 | 3300025929 | Bacteria | 1565 |
| 242 | Ga0207644_10249285 | 3300025931 | Bacteria | 1416 |
| 243 | Ga0207706_10080803 | 3300025933 | Bacteria | 2858 |
| 244 | Ga0207665_10003514 | 3300025939 | Bacteria | 10466 |
| 245 | Ga0207665_10044662 | 3300025939 | Bacteria | 2965 |
| 246 | Ga0207665_10130074 | 3300025939 | Bacteria | 1786 |
| 247 | Ga0207711_10050206 | 3300025941 | Bacteria | 3571 |
| 248 | Ga0207689_10099054 | 3300025942 | Bacteria | 2395 |
| 249 | Ga0207689_10335965 | 3300025942 | Bacteria | 1255 |
| 250 | Ga0207661_10475603 | 3300025944 | Unclassified | 1140 |
| 251 | Ga0207651_10344435 | 3300025960 | Unclassified | 1253 |
| 252 | Ga0207712_10000090 | 3300025961 | Bacteria | 104492 |
| 253 | Ga0207712_10006615 | 3300025961 | Bacteria | 7314 |
| 254 | Ga0207712_10207150 | 3300025961 | Bacteria | 1559 |
| 255 | Ga0207668_10221440 | 3300025972 | Bacteria | 1520 |
| 256 | Ga0207702_10164048 | 3300026078 | Bacteria | 2031 |
| 257 | Ga0207702_10165390 | 3300026078 | Bacteria | 2023 |
| 258 | Ga0207674_10241809 | 3300026116 | Bacteria | 1752 |
| 259 | Ga0207675_100242987 | 3300026118 | Bacteria | 1740 |
| 260 | Ga0207683_10003799 | 3300026121 | Bacteria | 13080 |
| 261 | Ga0207698_10001115 | 3300026142 | Bacteria | 15641 |
| 262 | Ga0209179_1006851 | 3300027512 | Bacteria | 1857 |
| 263 | Ga0209179_1012911 | 3300027512 | Bacteria | 1509 |
| 264 | Ga0209282_1000066 | 3300027666 | Bacteria | 87072 |
| 265 | Ga0209588_1009522 | 3300027671 | Bacteria | 2907 |
| 266 | Ga0209588_1019109 | 3300027671 | Bacteria | 2137 |
| 267 | Ga0209974_10003650 | 3300027876 | Bacteria | 5526 |
| 268 | Ga0268266_10007036 | 3300028379 | Bacteria | 10213 |
| 269 | Ga0268266_10016285 | 3300028379 | Bacteria | 6355 |
| 270 | Ga0268265_10002803 | 3300028380 | Bacteria | 12834 |
| 271 | Ga0268264_10054199 | 3300028381 | Bacteria | 3348 |
| 272 | Ga0268264_10091715 | 3300028381 | Bacteria | 2621 |
| 273 | Ga0268264_10266516 | 3300028381 | Bacteria | 1598 |
| 274 | Ga0265337_1012122 | 3300028556 | Bacteria | 2941 |
| 275 | Ga0265319_1006202 | 3300028563 | Bacteria | 5572 |
| 276 | Ga0265334_10003965 | 3300028573 | Bacteria | 6660 |
| 277 | Ga0265323_10000311 | 3300028653 | Bacteria | 28078 |
| 278 | Ga0265336_10000074 | 3300028666 | Bacteria | 82727 |
| 279 | Ga0307517_10032400 | 3300028786 | Bacteria | 6041 |
| 280 | Ga0307517_10245496 | 3300028786 | Bacteria | 1057 |
| 281 | Ga0307515_10002583 | 3300028794 | Bacteria | 39053 |
| 282 | Ga0265338_10000137 | 3300028800 | Bacteria | 135705 |
| 283 | Ga0265324_10003671 | 3300029957 | Bacteria | 7199 |
| 284 | Ga0265327_10004253 | 3300031251 | Bacteria | 12838 |
| 285 | Ga0307513_10195049 | 3300031456 | Bacteria | 1872 |
| 286 | Ga0307508_10077347 | 3300031616 | Bacteria | 2906 |
| 287 | Ga0265314_10019587 | 3300031711 | Bacteria | 5240 |
| 288 | Ga0265342_10014254 | 3300031712 | Bacteria | 5284 |
| 289 | Ga0265342_10162677 | 3300031712 | Bacteria | 1233 |
| 290 | Ga0307516_10003900 | 3300031730 | Bacteria | 18821 |
| 291 | Ga0307516_10005013 | 3300031730 | Bacteria | 16054 |
| 292 | Ga0307406_10187695 | 3300031901 | Bacteria | 1511 |
| 293 | Ga0307510_10001131 | 3300033180 | Bacteria | 28582 |
| 294 | Ga0307510_10035535 | 3300033180 | Bacteria | 5563 |
| 295 | Ga0373926_0012447 | 3300035083 | Bacteria | 2876 |
| 296 | Ga0373940_0052125 | 3300035088 | Bacteria | 1152 |
| 297 | Ga0373944_0052446 | 3300035089 | Bacteria | 1289 |
| 298 | Ga0373957_0094347 | 3300035120 | Bacteria | 1192 |
| 299 | Ga0373935_0039751 | 3300035692 | Bacteria | 2950 |
| 300 | Ga0373935_0446686 | 3300035692 | Bacteria | 934 |
| 301 | Ga0373927_0066673 | 3300035695 | Bacteria | 2329 |
| 302 | Ga0373933_0063072 | 3300035724 | Bacteria | 2240 |
| 303 | Ga0373947_0035247 | 3300035725 | Bacteria | 2962 |
| 304 | Ga0373937_0101725 | 3300036401 | Bacteria | 2667 |
| 305 | Ga0373925_0094237 | 3300037068 | Bacteria | 2292 |
| 306 | Ga0395899_0026009 | 3300037312 | Bacteria | 4416 |
| 307 | Ga0395900_0088172 | 3300037418 | Plasmid | 3189 |
| 308 | Ga0395900_0110788 | 3300037418 | Bacteria | 2820 |
| 309 | Ga0395898_0003720 | 3300037466 | Bacteria | 16921 |
| 310 | Ga0395898_0317746 | 3300037466 | Bacteria | 1486 |
| 311 | Ga0395898_0512104 | 3300037466 | Bacteria | 1141 |
| 312 | Ga0395905_0097420 | 3300037471 | Plasmid | 2761 |
| 313 | Ga0395901_0021480 | 3300038443 | Bacteria | 6614 |
| 314 | Ga0395901_0216820 | 3300038443 | Bacteria | 2001 |
| 315 | Ga0436361_0052273 | 3300039447 | Bacteria | 5189 |
| 316 | Ga0439465_0005022 | 3300041413 | Bacteria | 4250 |
| 317 | Ga0451787_202810 | 3300041441 | Bacteria | 994 |
| 318 | Ga0451793_1635360 | 3300041452 | Bacteria | 1090 |
| 319 | Ga0451795_0502720 | 3300041456 | Bacteria | 953 |
| 320 | Ga0451807_1641597 | 3300041486 | Bacteria | 1052 |
| 321 | Ga0451807_1695510 | 3300041486 | Bacteria | 1490 |
| 322 | Ga0451839_0567018 | 3300041496 | Bacteria | 2997 |
| 323 | Ga0451845_0637907 | 3300041501 | Bacteria | 1593 |
| 324 | Ga0451845_0717355 | 3300041501 | Bacteria | 4025 |
| 325 | Ga0451847_0263760 | 3300041503 | Bacteria | 3222 |
| 326 | Ga0451849_0301535 | 3300041505 | Bacteria | 3198 |
| 327 | Ga0451843_1036654 | 3300041509 | Bacteria | 4112 |
| 328 | Ga0451855_0164364 | 3300041511 | Bacteria | 3867 |
| 329 | Ga0451853_1588389 | 3300041512 | Bacteria | 1017 |
| 330 | Ga0451853_3204310 | 3300041512 | Bacteria | 1723 |
| 331 | Ga0466965_0015829 | 3300044683 | Bacteria | 3583 |
| 332 | Ga0466959_0008084 | 3300045049 | Bacteria | 7418 |
| 333 | Ga0466959_0024025 | 3300045049 | Bacteria | 4513 |
| 334 | Ga0466958_0149969 | 3300045836 | Bacteria | 1471 |
| 335 | Ga0495638_0000087 | 3300046460 | Bacteria | 152531 |
| 336 | Ga0495651_0077803 | 3300046462 | Bacteria | 2510 |
| 337 | Ga0495650_0000502 | 3300046471 | Bacteria | 59150 |
| 338 | Ga0495650_0000705 | 3300046471 | Bacteria | 42734 |
| 339 | Ga0495606_0000995 | 3300046507 | Bacteria | 41346 |
| 340 | Ga0495610_0022479 | 3300046512 | Bacteria | 3449 |
| 341 | Ga0495610_0124947 | 3300046512 | Bacteria | 1123 |
| 342 | Ga0495620_0075010 | 3300046515 | Bacteria | 1377 |
| 343 | Ga0495632_0083023 | 3300046519 | Bacteria | 1526 |
| 344 | Ga0495643_0017028 | 3300046522 | Bacteria | 4259 |
| 345 | Ga0495643_0177858 | 3300046522 | Bacteria | 1036 |
| 346 | Ga0495648_0008727 | 3300046524 | Bacteria | 7937 |
| 347 | Ga0495648_0058491 | 3300046524 | Bacteria | 2305 |
| 348 | Ga0495648_0114272 | 3300046524 | Bacteria | 1463 |
| 349 | Ga0495640_0062527 | 3300046533 | Bacteria | 2525 |
| 350 | Ga0495645_0119821 | 3300046543 | Bacteria | 1854 |
| 351 | Ga0495668_0005238 | 3300046616 | Bacteria | 8884 |
| 352 | Ga0495625_0043826 | 3300046660 | Bacteria | 3242 |
| 353 | Ga0495623_0046096 | 3300046679 | Bacteria | 2768 |
| 354 | Ga0495670_0000015 | 3300046691 | Bacteria | 131137 |
| 355 | Ga0495672_0003572 | 3300047320 | Bacteria | 13229 |
| 356 | Ga0495672_0043070 | 3300047320 | Bacteria | 2717 |
| 357 | Ga0495676_0264316 | 3300047321 | Bacteria | 1170 |
| 358 | Ga0495686_0048372 | 3300047472 | Bacteria | 2682 |
| 359 | Ga0496101_0070786 | 3300048904 | Bacteria | 2555 |
| 360 | Ga0496102_0003522 | 3300048905 | Bacteria | 13266 |
| 361 | Ga0496102_0142088 | 3300048905 | Bacteria | 2251 |
| 362 | Ga0496102_0446903 | 3300048905 | Bacteria | 1213 |
| 363 | Ga0496103_0058433 | 3300048906 | Bacteria | 2396 |
| 364 | Ga0496104_0019935 | 3300048907 | Bacteria | 6141 |
| 365 | Ga0496104_0440765 | 3300048907 | Bacteria | 1214 |
| 366 | Ga0496105_0052529 | 3300048908 | Bacteria | 3366 |
| 367 | Ga0496106_0000212 | 3300048909 | Bacteria | 40609 |
| 368 | Ga0496106_0005817 | 3300048909 | Bacteria | 9115 |
| 369 | Ga0496107_0063729 | 3300048910 | Bacteria | 2671 |
| 370 | Ga0496107_0202432 | 3300048910 | Bacteria | 1476 |
| 371 | Ga0496109_0027213 | 3300048912 | Bacteria | 5104 |
| 372 | Ga0496110_0034477 | 3300048913 | Bacteria | 4384 |
| 373 | Ga0496111_0115048 | 3300048914 | Bacteria | 1983 |
| 374 | Ga0496111_0410077 | 3300048914 | Bacteria | 1001 |
| 375 | Ga0496112_0043866 | 3300048915 | Bacteria | 4379 |
| 376 | Ga0496112_0063879 | 3300048915 | Bacteria | 3632 |
| 377 | Ga0496112_0122552 | 3300048915 | Bacteria | 2570 |
| 378 | Ga0496114_0058419 | 3300048917 | Bacteria | 3221 |
| 379 | Ga0496114_0144114 | 3300048917 | Bacteria | 2064 |
| 380 | Ga0496115_0002623 | 3300048918 | Bacteria | 12905 |
| 381 | Ga0496115_0011587 | 3300048918 | Bacteria | 6613 |
| 382 | Ga0496115_0104874 | 3300048918 | Bacteria | 2320 |
| 383 | Ga0496115_0255408 | 3300048918 | Bacteria | 1442 |
| 384 | Ga0496116_0240271 | 3300048919 | Bacteria | 910 |
| 385 | Ga0496120_0002851 | 3300048923 | Bacteria | 16648 |
| 386 | Ga0496121_0007858 | 3300048924 | Bacteria | 12756 |
| 387 | Ga0496121_0033710 | 3300048924 | Bacteria | 4628 |
| 388 | Ga0496122_0000488 | 3300048925 | Bacteria | 82252 |
| 389 | Ga0496123_0002461 | 3300048926 | Bacteria | 22940 |
| 390 | Ga0496124_0055855 | 3300048927 | Bacteria | 3334 |
| 391 | Ga0496125_0111273 | 3300048928 | Bacteria | 1982 |
| 392 | Ga0496125_0123814 | 3300048928 | Bacteria | 1837 |
| 393 | Ga0496125_0187464 | 3300048928 | Bacteria | 1370 |
| 394 | Ga0496126_0000338 | 3300048929 | Bacteria | 98321 |
| 395 | Ga0496126_0027737 | 3300048929 | Bacteria | 5404 |
| 396 | Ga0496126_0033299 | 3300048929 | Bacteria | 4849 |
| 397 | Ga0496126_0135369 | 3300048929 | Bacteria | 2126 |
| 398 | Ga0496126_0315371 | 3300048929 | Bacteria | 1287 |
| 399 | Ga0501292_001261 | 3300049515 | Bacteria | 3102 |
| 400 | Ga0501298_011442 | 3300049521 | Bacteria | 1541 |
| 401 | Ga0501032_0011377 | 3300049569 | Bacteria | 6391 |
| 402 | Ga0501046_0205865 | 3300049580 | Unclassified | 1462 |
| 403 | Ga0501047_0005803 | 3300049581 | Bacteria | 11620 |
| 404 | Ga0501047_0075971 | 3300049581 | Bacteria | 3233 |
| 405 | Ga0501047_0373098 | 3300049581 | Bacteria | 1262 |
| 406 | Ga0501206_002017 | 3300049653 | Bacteria | 2560 |
| 407 | Ga0501257_009026 | 3300049686 | Bacteria | 2247 |
| 408 | Ga0501083_0036343 | 3300049744 | Bacteria | 3360 |
| 409 | Ga0501262_003978 | 3300049759 | Bacteria | 1704 |
| 410 | Ga0501265_002761 | 3300049762 | Bacteria | 1992 |
| 411 | Ga0501278_004148 | 3300049774 | Bacteria | 1039 |
| 412 | Ga0501035_0001753 | 3300049822 | Bacteria | 21910 |
| 413 | Ga0501044_0004596 | 3300049823 | Bacteria | 15435 |
| 414 | nmdc:mga03683_111587_c1 | 3300050489 | Bacteria | 1209 |
| 415 | nmdc:mga03683_6403_c1 | 3300050489 | Bacteria | 4028 |
| 416 | nmdc:mga0k408_7113_c2 | 3300050493 | Bacteria | 5684 |
| 417 | nmdc:mga06z11_236968_c1 | 3300050494 | Bacteria | 1071 |
| 418 | nmdc:mga05p37_156705_c1 | 3300050507 | Bacteria | 2782 |
| 419 | nmdc:mga06r32_201853_c1 | 3300050510 | Bacteria | 1976 |
| 420 | nmdc:mga06r32_286325_c1 | 3300050510 | Bacteria | 1634 |
| 421 | nmdc:mga08x19_159757_c1 | 3300050514 | Bacteria | 1530 |
| 422 | Ga0495601_0030066 | 3300053077 | Bacteria | 3373 |
| 423 | Ga0500643_003395 | 3300053087 | Bacteria | 7696 |
| 424 | Ga0500644_0001624 | 3300053088 | Bacteria | 5866 |
| 425 | Ga0500646_0021038 | 3300053090 | Bacteria | 1736 |
| 426 | Ga0500583_0036130 | 3300053092 | Bacteria | 2210 |
| 427 | Ga0500583_0117430 | 3300053092 | Bacteria | 1314 |
| 428 | Ga0500651_0150754 | 3300053093 | Bacteria | 1396 |
| 429 | Ga0500651_0152208 | 3300053093 | Bacteria | 1388 |
| 430 | Ga0500651_0333536 | 3300053093 | Bacteria | 864 |
| 431 | Ga0500641_0014567 | 3300053096 | Bacteria | 2903 |
| 432 | Ga0500594_0002123 | 3300053118 | Bacteria | 4282 |
| 433 | Ga0500595_004871 | 3300053119 | Bacteria | 5941 |
| 434 | Ga0500595_025353 | 3300053119 | Bacteria | 2057 |
| 435 | Ga0500595_042230 | 3300053119 | Bacteria | 1460 |
| 436 | Ga0500652_017934 | 3300053131 | Bacteria | 2603 |
| 437 | Ga0500658_0011126 | 3300053134 | Bacteria | 3314 |
| 438 | Ga0500559_0003189 | 3300053136 | Bacteria | 8151 |
| 439 | Ga0500577_0095524 | 3300053142 | Bacteria | 1208 |
| 440 | Ga0500604_0005828 | 3300053151 | Bacteria | 3257 |
| 441 | Ga0500604_0053566 | 3300053151 | Bacteria | 1251 |
| 442 | Ga0500622_0005070 | 3300053156 | Bacteria | 8016 |
| 443 | Ga0500637_0277620 | 3300053178 | Bacteria | 924 |
| 444 | Ga0500645_001480 | 3300053730 | Bacteria | 11799 |
| 445 | Ga0500596_007300 | 3300053735 | Bacteria | 1818 |
| 446 | Ga0500587_000866 | 3300053739 | Bacteria | 4007 |
| 447 | Ga0501084_0073285 | 3300054114 | Bacteria | 2868 |
| 448 | Ga0501082_0000351 | 3300060353 | Bacteria | 40723 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003771 | Ga0055526_1006240 | Ga0055526_10062405 | 229 |
| 2 | 3300003771 | Ga0055526_1034022 | Ga0055526_10340222 | 229 |
| 3 | 3300003773 | Ga0055537_1022897 | Ga0055537_10228971 | 229 |
| 4 | 3300025263 | Ga0209565_1000056 | Ga0209565_1000056137 | 229 |
| 5 | 3300025295 | Ga0209564_1002678 | Ga0209564_10026786 | 229 |
| 6 | 3300025295 | Ga0209564_1011983 | Ga0209564_10119835 | 229 |
| 7 | 3300025297 | Ga0209758_1023936 | Ga0209758_10239363 | 229 |
| 8 | 3300025298 | Ga0209050_1010014 | Ga0209050_10100145 | 229 |
| 9 | 3300025302 | Ga0207426_1023086 | Ga0207426_10230862 | 229 |
| 10 | 3300053151 | Ga0500604_0053566 | Ga0500604_0053566_97_942 | 235 |
| 11 | 3300035692 | Ga0373935_0446686 | Ga0373935_0446686_17_775 | 238 |
| 12 | iso_pu_bacteria | 2906378014 | 2906382250 | 243 |
| 13 | iso_pu_bacteria | 2922178524 | 2922185184 | 244 |
| 14 | 3300031251 | Ga0265327_10004253 | Ga0265327_100042539 | 246 |
| 15 | 3300053093 | Ga0500651_0333536 | Ga0500651_0333536_50_853 | 248 |
| 16 | iso_pu_bacteria | 2958137437 | 2958141354 | 254 |
| 17 | 3300048924 | Ga0496121_0033710 | Ga0496121_0033710_3009_3854 | 255 |
| 18 | 3300002741 | JGI25157J39369_1000447 | JGI25157J39369_100044710 | 256 |
| 19 | 3300025250 | Ga0209026_1000002 | Ga0209026_10000021060 | 256 |
| 20 | 3300025256 | Ga0209759_1000381 | Ga0209759_100038123 | 256 |
| 21 | iso_pu_bacteria | 2582581867 | 2585404923 | 256 |
| 22 | iso_pu_bacteria | 2842163707 | 2842169528 | 256 |
| 23 | 3300009093 | Ga0105240_10003911 | Ga0105240_1000391120 | 258 |
| 24 | 3300009147 | Ga0114129_10417677 | Ga0114129_104176772 | 258 |
| 25 | 3300009174 | Ga0105241_10197551 | Ga0105241_101975511 | 258 |
| 26 | 3300009545 | Ga0105237_10032105 | Ga0105237_100321053 | 258 |
| 27 | 3300009551 | Ga0105238_10011692 | Ga0105238_100116925 | 258 |
| 28 | 3300010159 | Ga0099796_10064311 | Ga0099796_100643112 | 258 |
| 29 | 3300010159 | Ga0099796_10080961 | Ga0099796_100809612 | 258 |
| 30 | 3300010375 | Ga0105239_10006979 | Ga0105239_1000697912 | 258 |
| 31 | 3300039447 | Ga0436361_0052273 | Ga0436361_0052273_2150_2986 | 258 |
| 32 | 3300041441 | Ga0451787_202810 | Ga0451787_202810_74_901 | 258 |
| 33 | 3300041486 | Ga0451807_1641597 | Ga0451807_1641597_210_1037 | 258 |
| 34 | 3300046522 | Ga0495643_0177858 | Ga0495643_0177858_34_867 | 258 |
| 35 | 3300046524 | Ga0495648_0058491 | Ga0495648_0058491_662_1537 | 258 |
| 36 | 3300047472 | Ga0495686_0048372 | Ga0495686_0048372_1411_2238 | 258 |
| 37 | 3300048919 | Ga0496116_0240271 | Ga0496116_0240271_63_872 | 258 |
| 38 | 3300048929 | Ga0496126_0000338 | Ga0496126_0000338_46513_47328 | 258 |
| 39 | 3300048929 | Ga0496126_0315371 | Ga0496126_0315371_25_858 | 258 |
| 40 | 3300050507 | nmdc:mga05p37_156705_c1 | nmdc:mga05p37_156705_c1_894_1730 | 258 |
| 41 | 3300053096 | Ga0500641_0014567 | Ga0500641_0014567_238_1080 | 258 |
| 42 | 3300053142 | Ga0500577_0095524 | Ga0500577_0095524_295_1149 | 258 |
| 43 | 3300053178 | Ga0500637_0277620 | Ga0500637_0277620_20_853 | 258 |
| 44 | 3300041456 | Ga0451795_0502720 | Ga0451795_0502720_92_928 | 259 |
| 45 | 3300046515 | Ga0495620_0075010 | Ga0495620_0075010_265_1143 | 260 |
| 46 | 3300053088 | Ga0500644_0001624 | Ga0500644_0001624_2801_3679 | 260 |
| 47 | 3300053093 | Ga0500651_0150754 | Ga0500651_0150754_320_1198 | 260 |
| 48 | 3300053118 | Ga0500594_0002123 | Ga0500594_0002123_176_1054 | 260 |
| 49 | 3300053136 | Ga0500559_0003189 | Ga0500559_0003189_3962_4840 | 260 |
| 50 | 3300053156 | Ga0500622_0005070 | Ga0500622_0005070_3325_4203 | 260 |
| 51 | 3300025304 | Ga0209257_1028088 | Ga0209257_10280882 | 261 |
| 52 | 3300028786 | Ga0307517_10245496 | Ga0307517_102454962 | 261 |
| 53 | 3300046691 | Ga0495670_0000015 | Ga0495670_0000015_25703_26521 | 261 |
| 54 | 3300048918 | Ga0496115_0002623 | Ga0496115_0002623_3350_4168 | 261 |
| 55 | 3300007788 | Ga0099795_10020178 | Ga0099795_100201781 | 265 |
| 56 | 3300010159 | Ga0099796_10012156 | Ga0099796_100121562 | 265 |
| 57 | 3300035083 | Ga0373926_0012447 | Ga0373926_0012447_896_1795 | 265 |
| 58 | 3300035692 | Ga0373935_0039751 | Ga0373935_0039751_1180_2079 | 265 |
| 59 | 3300035725 | Ga0373947_0035247 | Ga0373947_0035247_1357_2256 | 265 |
| 60 | 3300037068 | Ga0373925_0094237 | Ga0373925_0094237_870_1769 | 265 |
| 61 | iso_pu_bacteria | 2585427633 | 2585993331 | 268 |
| 62 | 3300005329 | Ga0070683_100367488 | Ga0070683_1003674881 | 269 |
| 63 | 3300005563 | Ga0068855_100686748 | Ga0068855_1006867482 | 269 |
| 64 | 3300009093 | Ga0105240_10465956 | Ga0105240_104659562 | 269 |
| 65 | 3300009098 | Ga0105245_10000158 | Ga0105245_1000015840 | 269 |
| 66 | 3300025927 | Ga0207687_10000162 | Ga0207687_1000016232 | 269 |
| 67 | 3300025944 | Ga0207661_10475603 | Ga0207661_104756031 | 269 |
| 68 | 3300035089 | Ga0373944_0052446 | Ga0373944_0052446_139_1008 | 270 |
| 69 | 3300007788 | Ga0099795_10017346 | Ga0099795_100173461 | 271 |
| 70 | 3300010159 | Ga0099796_10017901 | Ga0099796_100179013 | 271 |
| 71 | 3300005455 | Ga0070663_100061193 | Ga0070663_1000611933 | 272 |
| 72 | 3300014325 | Ga0163163_10318078 | Ga0163163_103180782 | 272 |
| 73 | 3300027876 | Ga0209974_10003650 | Ga0209974_100036505 | 272 |
| 74 | 3300028786 | Ga0307517_10032400 | Ga0307517_100324005 | 272 |
| 75 | 3300005353 | Ga0070669_100278197 | Ga0070669_1002781971 | 274 |
| 76 | 3300005364 | Ga0070673_100088264 | Ga0070673_1000882641 | 274 |
| 77 | 3300005456 | Ga0070678_100030472 | Ga0070678_1000304722 | 274 |
| 78 | 3300025910 | Ga0207684_10123489 | Ga0207684_101234891 | 274 |
| 79 | 3300025960 | Ga0207651_10344435 | Ga0207651_103444352 | 274 |
| 80 | 3300026121 | Ga0207683_10003799 | Ga0207683_100037998 | 274 |
| 81 | 3300031730 | Ga0307516_10003900 | Ga0307516_1000390011 | 274 |
| 82 | 3300033180 | Ga0307510_10035535 | Ga0307510_100355356 | 274 |
| 83 | 3300037466 | Ga0395898_0317746 | Ga0395898_0317746_266_1192 | 274 |
| 84 | 3300046512 | Ga0495610_0022479 | Ga0495610_0022479_2369_3244 | 274 |
| 85 | 3300046519 | Ga0495632_0083023 | Ga0495632_0083023_133_1008 | 274 |
| 86 | 3300046524 | Ga0495648_0114272 | Ga0495648_0114272_187_1068 | 274 |
| 87 | 3300053134 | Ga0500658_0011126 | Ga0500658_0011126_1390_2265 | 274 |
| 88 | 3300053739 | Ga0500587_000866 | Ga0500587_000866_1677_2552 | 274 |
| 89 | 3300005445 | Ga0070708_100013986 | Ga0070708_1000139862 | 275 |
| 90 | 3300009553 | Ga0105249_10005424 | Ga0105249_1000542416 | 275 |
| 91 | 3300009553 | Ga0105249_10371545 | Ga0105249_103715452 | 275 |
| 92 | 3300010375 | Ga0105239_10236065 | Ga0105239_102360651 | 275 |
| 93 | 3300035088 | Ga0373940_0052125 | Ga0373940_0052125_116_1003 | 275 |
| 94 | 3300048904 | Ga0496101_0070786 | Ga0496101_0070786_191_1078 | 275 |
| 95 | 3300048905 | Ga0496102_0003522 | Ga0496102_0003522_11724_12611 | 275 |
| 96 | 3300048906 | Ga0496103_0058433 | Ga0496103_0058433_89_976 | 275 |
| 97 | 3300048907 | Ga0496104_0440765 | Ga0496104_0440765_119_1006 | 275 |
| 98 | 3300048909 | Ga0496106_0000212 | Ga0496106_0000212_1214_2101 | 275 |
| 99 | 3300048909 | Ga0496106_0005817 | Ga0496106_0005817_7684_8571 | 275 |
| 100 | 3300048910 | Ga0496107_0063729 | Ga0496107_0063729_110_997 | 275 |
| 101 | 3300048918 | Ga0496115_0011587 | Ga0496115_0011587_5671_6558 | 275 |
| 102 | 3300053093 | Ga0500651_0152208 | Ga0500651_0152208_434_1291 | 276 |
| 103 | 3300045049 | Ga0466959_0008084 | Ga0466959_0008084_5141_6028 | 277 |
| 104 | 3300046543 | Ga0495645_0119821 | Ga0495645_0119821_579_1490 | 277 |
| 105 | iso_pu_bacteria | 2643221665 | 2644362669 | 277 |
| 106 | 3300003792 | Ga0055540_1000625 | Ga0055540_10006259 | 279 |
| 107 | 3300005467 | Ga0070706_100076602 | Ga0070706_1000766023 | 279 |
| 108 | 3300006177 | Ga0075362_10015002 | Ga0075362_100150023 | 279 |
| 109 | 3300025303 | Ga0209051_1000271 | Ga0209051_100027142 | 279 |
| 110 | 3300046533 | Ga0495640_0062527 | Ga0495640_0062527_1034_1978 | 279 |
| 111 | 3300050489 | nmdc:mga03683_6403_c1 | nmdc:mga03683_6403_c1_2392_3309 | 279 |
| 112 | 3300053077 | Ga0495601_0030066 | Ga0495601_0030066_1971_2915 | 279 |
| 113 | 3300005339 | Ga0070660_100000440 | Ga0070660_10000044031 | 280 |
| 114 | 3300009093 | Ga0105240_10229086 | Ga0105240_102290863 | 280 |
| 115 | 3300010159 | Ga0099796_10014092 | Ga0099796_100140922 | 280 |
| 116 | 3300013100 | Ga0157373_10036351 | Ga0157373_100363515 | 280 |
| 117 | 3300013100 | Ga0157373_10211853 | Ga0157373_102118532 | 280 |
| 118 | 3300013105 | Ga0157369_10191135 | Ga0157369_101911353 | 280 |
| 119 | 3300013296 | Ga0157374_10172479 | Ga0157374_101724793 | 280 |
| 120 | 3300025913 | Ga0207695_10246174 | Ga0207695_102461742 | 280 |
| 121 | 3300037418 | Ga0395900_0110788 | Ga0395900_0110788_63_1010 | 280 |
| 122 | 3300053090 | Ga0500646_0021038 | Ga0500646_0021038_515_1438 | 280 |
| 123 | 3300053092 | Ga0500583_0036130 | Ga0500583_0036130_97_1020 | 280 |
| 124 | 3300053151 | Ga0500604_0005828 | Ga0500604_0005828_2044_2967 | 280 |
| 125 | iso_pu_bacteria | 2844002411 | 2844007960 | 280 |
| 126 | iso_pu_bacteria | 2871466892 | 2871474015 | 280 |
| 127 | 3300005327 | Ga0070658_10273813 | Ga0070658_102738131 | 281 |
| 128 | 3300009036 | Ga0105244_10014085 | Ga0105244_100140856 | 281 |
| 129 | 3300013102 | Ga0157371_10005288 | Ga0157371_100052882 | 281 |
| 130 | 3300025728 | Ga0207655_1012006 | Ga0207655_10120067 | 281 |
| 131 | 3300053087 | Ga0500643_003395 | Ga0500643_003395_3789_4715 | 281 |
| 132 | iso_pu_bacteria | 2856334872 | 2856338125 | 281 |
| 133 | iso_pu_bacteria | 2857367948 | 2857371737 | 281 |
| 134 | iso_pu_bacteria | 2869249662 | 2869256415 | 281 |
| 135 | iso_pu_bacteria | 2869264136 | 2869268345 | 281 |
| 136 | iso_pu_bacteria | 2869271264 | 2869275105 | 281 |
| 137 | iso_pu_bacteria | 2871459585 | 2871461237 | 281 |
| 138 | iso_pu_bacteria | 2874131515 | 2874132666 | 281 |
| 139 | iso_pu_bacteria | 2874162495 | 2874165117 | 281 |
| 140 | iso_pu_bacteria | 2874168670 | 2874169318 | 281 |
| 141 | iso_pu_bacteria | 2876363079 | 2876368993 | 281 |
| 142 | iso_pu_bacteria | 2876399893 | 2876404942 | 281 |
| 143 | iso_pu_bacteria | 2876406927 | 2876410364 | 281 |
| 144 | iso_pu_bacteria | 2878774303 | 2878779084 | 281 |
| 145 | iso_pu_bacteria | 2878781027 | 2878788196 | 281 |
| 146 | iso_pu_bacteria | 2903448605 | 2903450784 | 281 |
| 147 | iso_pu_bacteria | 2903521522 | 2903527991 | 281 |
| 148 | iso_pu_bacteria | 2903528002 | 2903529697 | 281 |
| 149 | iso_pu_bacteria | 2906370794 | 2906376976 | 281 |
| 150 | iso_pu_bacteria | 2906386501 | 2906392970 | 281 |
| 151 | iso_pu_bacteria | 2906393657 | 2906395030 | 281 |
| 152 | iso_pu_bacteria | 2906408224 | 2906413618 | 281 |
| 153 | iso_pu_bacteria | 2922151315 | 2922157871 | 281 |
| 154 | iso_pu_bacteria | 2922172374 | 2922175142 | 281 |
| 155 | iso_pu_bacteria | 2924748358 | 2924753592 | 281 |
| 156 | iso_pu_bacteria | 2937848649 | 2937854108 | 281 |
| 157 | iso_pu_bacteria | 3004211236 | 3004215775 | 281 |
| 158 | iso_pu_bacteria | 2928531327 | 2928533349 | 282 |
| 159 | 3300047320 | Ga0495672_0003572 | Ga0495672_0003572_1157_2068 | 283 |
| 160 | 3300048923 | Ga0496120_0002851 | Ga0496120_0002851_11029_11907 | 283 |
| 161 | 3300053730 | Ga0500645_001480 | Ga0500645_001480_5175_6080 | 283 |
| 162 | 3300013306 | Ga0163162_10398025 | Ga0163162_103980252 | 284 |
| 163 | 3300044683 | Ga0466965_0015829 | Ga0466965_0015829_1599_2501 | 284 |
| 164 | 3300045049 | Ga0466959_0024025 | Ga0466959_0024025_1890_2792 | 284 |
| 165 | 3300045836 | Ga0466958_0149969 | Ga0466958_0149969_505_1407 | 284 |
| 166 | 3300053131 | Ga0500652_017934 | Ga0500652_017934_1022_1927 | 284 |
| 167 | iso_pu_bacteria | 2509276022 | 2509395858 | 284 |
| 168 | iso_pu_bacteria | 2856320880 | 2856326882 | 284 |
| 169 | 3300009545 | Ga0105237_10162557 | Ga0105237_101625572 | 285 |
| 170 | 3300010375 | Ga0105239_10403250 | Ga0105239_104032502 | 285 |
| 171 | 3300013296 | Ga0157374_10159250 | Ga0157374_101592502 | 285 |
| 172 | 3300014497 | Ga0182008_10010121 | Ga0182008_100101214 | 285 |
| 173 | 3300025261 | Ga0209233_1008961 | Ga0209233_10089613 | 285 |
| 174 | 3300037312 | Ga0395899_0026009 | Ga0395899_0026009_1763_2656 | 285 |
| 175 | 3300037418 | Ga0395900_0088172 | Ga0395900_0088172_1689_2582 | 285 |
| 176 | 3300037466 | Ga0395898_0003720 | Ga0395898_0003720_4171_5064 | 285 |
| 177 | 3300037471 | Ga0395905_0097420 | Ga0395905_0097420_892_1785 | 285 |
| 178 | 3300038443 | Ga0395901_0021480 | Ga0395901_0021480_4986_5879 | 285 |
| 179 | 3300048914 | Ga0496111_0410077 | Ga0496111_0410077_42_974 | 285 |
| 180 | 3300048915 | Ga0496112_0063879 | Ga0496112_0063879_1225_2142 | 285 |
| 181 | 3300048915 | Ga0496112_0122552 | Ga0496112_0122552_993_1925 | 285 |
| 182 | 3300049515 | Ga0501292_001261 | Ga0501292_001261_1381_2298 | 285 |
| 183 | 3300049521 | Ga0501298_011442 | Ga0501298_011442_24_941 | 285 |
| 184 | 3300049653 | Ga0501206_002017 | Ga0501206_002017_572_1489 | 285 |
| 185 | 3300049686 | Ga0501257_009026 | Ga0501257_009026_987_1904 | 285 |
| 186 | 3300049759 | Ga0501262_003978 | Ga0501262_003978_739_1656 | 285 |
| 187 | 3300049762 | Ga0501265_002761 | Ga0501265_002761_642_1559 | 285 |
| 188 | 3300049774 | Ga0501278_004148 | Ga0501278_004148_28_945 | 285 |
| 189 | 3300050510 | nmdc:mga06r32_286325_c1 | nmdc:mga06r32_286325_c1_43_966 | 285 |
| 190 | 3300053119 | Ga0500595_025353 | Ga0500595_025353_597_1511 | 285 |
| 191 | iso_pu_bacteria | 2508501123 | 2509118789 | 285 |
| 192 | iso_pu_bacteria | 2869278585 | 2869283568 | 285 |
| 193 | iso_pu_bacteria | 2874139085 | 2874143739 | 285 |
| 194 | iso_pu_bacteria | 2878738818 | 2878739003 | 285 |
| 195 | iso_pu_bacteria | 2888337043 | 2888338953 | 285 |
| 196 | iso_pu_bacteria | 2924718760 | 2924724871 | 285 |
| 197 | iso_pu_bacteria | 2924776078 | 2924776365 | 285 |
| 198 | iso_pu_bacteria | 2937877337 | 2937884181 | 285 |
| 199 | iso_pu_bacteria | 2937972304 | 2937979717 | 285 |
| 200 | iso_pu_bacteria | 2958034702 | 2958040080 | 285 |
| 201 | iso_pu_bacteria | 2958041894 | 2958054424 | 285 |
| 202 | iso_pu_bacteria | 2958064165 | 2958065322 | 285 |
| 203 | iso_pu_bacteria | 2958084443 | 2958091492 | 285 |
| 204 | iso_pu_bacteria | 2958092219 | 2958099478 | 285 |
| 205 | iso_pu_bacteria | 2958144490 | 2958151111 | 285 |
| 206 | iso_pu_bacteria | 2968016561 | 2968018923 | 285 |
| 207 | iso_pu_bacteria | 2970469710 | 2970470904 | 285 |
| 208 | iso_pu_bacteria | 2970593180 | 2970598007 | 285 |
| 209 | iso_pu_bacteria | 2996348954 | 2996356560 | 285 |
| 210 | iso_pu_bacteria | 3004275668 | 3004282863 | 285 |
| 211 | iso_pu_bacteria | 8004640170 | 8004640987 | 285 |
| 212 | 3300005842 | Ga0068858_100122988 | Ga0068858_1001229882 | 286 |
| 213 | 3300014497 | Ga0182008_10000711 | Ga0182008_100007115 | 286 |
| 214 | 3300015261 | Ga0182006_1000964 | Ga0182006_100096418 | 286 |
| 215 | 3300015262 | Ga0182007_10027390 | Ga0182007_100273903 | 286 |
| 216 | iso_pu_bacteria | 2582581279 | 2585147593 | 286 |
| 217 | iso_pu_bacteria | 2756170246 | 2756672091 | 286 |
| 218 | iso_pu_bacteria | 2844533157 | 2844535588 | 286 |
| 219 | 3300005548 | Ga0070665_100174031 | Ga0070665_1001740313 | 287 |
| 220 | 3300005617 | Ga0068859_100227538 | Ga0068859_1002275382 | 287 |
| 221 | 3300006931 | Ga0097620_100227559 | Ga0097620_1002275592 | 287 |
| 222 | 3300009177 | Ga0105248_10010141 | Ga0105248_100101419 | 287 |
| 223 | 3300009545 | Ga0105237_10035214 | Ga0105237_100352143 | 287 |
| 224 | 3300009551 | Ga0105238_10025745 | Ga0105238_100257451 | 287 |
| 225 | 3300010375 | Ga0105239_10239162 | Ga0105239_102391622 | 287 |
| 226 | 3300025941 | Ga0207711_10050206 | Ga0207711_100502062 | 287 |
| 227 | 3300028379 | Ga0268266_10016285 | Ga0268266_100162855 | 287 |
| 228 | 3300037466 | Ga0395898_0512104 | Ga0395898_0512104_57_992 | 287 |
| 229 | 3300041486 | Ga0451807_1695510 | Ga0451807_1695510_552_1463 | 287 |
| 230 | 3300041512 | Ga0451853_1588389 | Ga0451853_1588389_71_997 | 287 |
| 231 | 3300049581 | Ga0501047_0075971 | Ga0501047_0075971_1494_2402 | 287 |
| 232 | 3300049581 | Ga0501047_0373098 | Ga0501047_0373098_329_1240 | 287 |
| 233 | 3300049744 | Ga0501083_0036343 | Ga0501083_0036343_1646_2554 | 287 |
| 234 | 3300054114 | Ga0501084_0073285 | Ga0501084_0073285_1556_2464 | 287 |
| 235 | 3300060353 | Ga0501082_0000351 | Ga0501082_0000351_33962_34870 | 287 |
| 236 | iso_pu_bacteria | 2509276018 | 2509371313 | 287 |
| 237 | iso_pu_bacteria | 2510065059 | 2510315919 | 287 |
| 238 | iso_pu_bacteria | 2512875016 | 2512932003 | 287 |
| 239 | iso_pu_bacteria | 2512875024 | 2512959977 | 287 |
| 240 | iso_pu_bacteria | 2515154113 | 2515635349 | 287 |
| 241 | iso_pu_bacteria | 2515154114 | 2515646038 | 287 |
| 242 | iso_pu_bacteria | 2687453392 | 2688598026 | 287 |
| 243 | iso_pu_bacteria | 2767802442 | 2770199672 | 287 |
| 244 | iso_pu_bacteria | 2856328259 | 2856333735 | 287 |
| 245 | iso_pu_bacteria | 2874123672 | 2874124442 | 287 |
| 246 | iso_pu_bacteria | 2906363423 | 2906364100 | 287 |
| 247 | iso_pu_bacteria | 2908739725 | 2908742957 | 287 |
| 248 | iso_pu_bacteria | 2924733363 | 2924734935 | 287 |
| 249 | iso_pu_bacteria | 2937868953 | 2937869887 | 287 |
| 250 | iso_pu_bacteria | 2958122699 | 2958124142 | 287 |
| 251 | iso_pu_bacteria | 2961136820 | 2961137674 | 287 |
| 252 | iso_pu_bacteria | 2963644680 | 2963647204 | 287 |
| 253 | iso_pu_bacteria | 2965025482 | 2965026028 | 287 |
| 254 | iso_pu_bacteria | 2965032056 | 2965036084 | 287 |
| 255 | iso_pu_bacteria | 2965040258 | 2965044471 | 287 |
| 256 | iso_pu_bacteria | 2965047637 | 2965054982 | 287 |
| 257 | iso_pu_bacteria | 2965089291 | 2965094480 | 287 |
| 258 | iso_pu_bacteria | 2965102966 | 2965109725 | 287 |
| 259 | iso_pu_bacteria | 2965110997 | 2965116570 | 287 |
| 260 | iso_pu_bacteria | 2968083720 | 2968087961 | 287 |
| 261 | iso_pu_bacteria | 2970547951 | 2970551722 | 287 |
| 262 | iso_pu_bacteria | 2977872689 | 2977874886 | 287 |
| 263 | iso_pu_bacteria | 2977915119 | 2977916532 | 287 |
| 264 | iso_pu_bacteria | 2977922695 | 2977927477 | 287 |
| 265 | iso_pu_bacteria | 2977935797 | 2977936612 | 287 |
| 266 | iso_pu_bacteria | 2977950692 | 2977957113 | 287 |
| 267 | iso_pu_bacteria | 2977957713 | 2977958066 | 287 |
| 268 | iso_pu_bacteria | 2979793036 | 2979795756 | 287 |
| 269 | iso_pu_bacteria | 2987673487 | 2987678710 | 287 |
| 270 | iso_pu_bacteria | 3004167301 | 3004168302 | 287 |
| 271 | iso_pu_bacteria | 3004195979 | 3004197793 | 287 |
| 272 | iso_pu_bacteria | 3004218560 | 3004224552 | 287 |
| 273 | iso_pu_bacteria | 3004239961 | 3004242160 | 287 |
| 274 | iso_pu_bacteria | 3004334049 | 3004335097 | 287 |
| 275 | iso_pu_bacteria | 637000159 | 637075100 | 287 |
| 276 | iso_pu_bacteria | 649633066 | 649872558 | 287 |
| 277 | iso_pu_bacteria | 8004300914 | 8004302985 | 287 |
| 278 | iso_pu_bacteria | 8004361976 | 8004368962 | 287 |
| 279 | iso_pu_bacteria | 8004695233 | 8004696105 | 287 |
| 280 | 3300002987 | JGI25159J45721_1004266 | JGI25159J45721_10042662 | 288 |
| 281 | 3300005262 | Ga0065165_1000620 | Ga0065165_100062052 | 288 |
| 282 | 3300007265 | Ga0099794_10015044 | Ga0099794_100150444 | 288 |
| 283 | 3300007788 | Ga0099795_10003674 | Ga0099795_100036742 | 288 |
| 284 | 3300010159 | Ga0099796_10001617 | Ga0099796_100016173 | 288 |
| 285 | 3300025284 | Ga0209130_1000258 | Ga0209130_100025850 | 288 |
| 286 | 3300025302 | Ga0207426_1016331 | Ga0207426_10163312 | 288 |
| 287 | 3300027512 | Ga0209179_1006851 | Ga0209179_10068512 | 288 |
| 288 | 3300038443 | Ga0395901_0216820 | Ga0395901_0216820_888_1814 | 288 |
| 289 | iso_pu_bacteria | 2667528175 | 2671121742 | 288 |
| 290 | iso_pu_bacteria | 2885374607 | 2885382101 | 288 |
| 291 | iso_pu_bacteria | 2945972063 | 2945972176 | 288 |
| 292 | 3300005329 | Ga0070683_100043996 | Ga0070683_1000439963 | 289 |
| 293 | 3300025913 | Ga0207695_10007545 | Ga0207695_1000754510 | 289 |
| 294 | 3300025913 | Ga0207695_10129125 | Ga0207695_101291254 | 289 |
| 295 | 3300025914 | Ga0207671_10008171 | Ga0207671_100081712 | 289 |
| 296 | 3300025924 | Ga0207694_10007507 | Ga0207694_100075074 | 289 |
| 297 | 3300031456 | Ga0307513_10195049 | Ga0307513_101950492 | 289 |
| 298 | 3300047321 | Ga0495676_0264316 | Ga0495676_0264316_60_1007 | 289 |
| 299 | 3300049569 | Ga0501032_0011377 | Ga0501032_0011377_4547_5479 | 289 |
| 300 | 3300049580 | Ga0501046_0205865 | Ga0501046_0205865_262_1194 | 289 |
| 301 | 3300049581 | Ga0501047_0005803 | Ga0501047_0005803_8631_9563 | 289 |
| 302 | 3300049822 | Ga0501035_0001753 | Ga0501035_0001753_8656_9588 | 289 |
| 303 | 3300049823 | Ga0501044_0004596 | Ga0501044_0004596_169_1101 | 289 |
| 304 | iso_pu_bacteria | 2904449895 | 2904453407 | 289 |
| 305 | iso_pu_bacteria | 2904456579 | 2904459378 | 289 |
| 306 | iso_pu_bacteria | 3005474847 | 3005479970 | 289 |
| 307 | 3300005341 | Ga0070691_10020480 | Ga0070691_100204801 | 290 |
| 308 | 3300005440 | Ga0070705_100001785 | Ga0070705_1000017852 | 290 |
| 309 | 3300005444 | Ga0070694_100191373 | Ga0070694_1001913732 | 290 |
| 310 | 3300005455 | Ga0070663_100089297 | Ga0070663_1000892973 | 290 |
| 311 | 3300005457 | Ga0070662_100275706 | Ga0070662_1002757061 | 290 |
| 312 | 3300005458 | Ga0070681_10220774 | Ga0070681_102207742 | 290 |
| 313 | 3300005468 | Ga0070707_100244382 | Ga0070707_1002443822 | 290 |
| 314 | 3300005518 | Ga0070699_100241996 | Ga0070699_1002419964 | 290 |
| 315 | 3300005518 | Ga0070699_100254209 | Ga0070699_1002542091 | 290 |
| 316 | 3300005536 | Ga0070697_100003278 | Ga0070697_10000327820 | 290 |
| 317 | 3300005546 | Ga0070696_100002384 | Ga0070696_1000023842 | 290 |
| 318 | 3300005549 | Ga0070704_100002161 | Ga0070704_1000021612 | 290 |
| 319 | 3300005719 | Ga0068861_100036943 | Ga0068861_1000369435 | 290 |
| 320 | 3300005843 | Ga0068860_100263490 | Ga0068860_1002634902 | 290 |
| 321 | 3300005844 | Ga0068862_100004120 | Ga0068862_1000041202 | 290 |
| 322 | 3300006177 | Ga0075362_10167325 | Ga0075362_101673251 | 290 |
| 323 | 3300006195 | Ga0075366_10063870 | Ga0075366_100638703 | 290 |
| 324 | 3300006881 | Ga0068865_100286638 | Ga0068865_1002866381 | 290 |
| 325 | 3300006914 | Ga0075436_100179011 | Ga0075436_1001790112 | 290 |
| 326 | 3300006948 | Ga0099826_10000048 | Ga0099826_1000004852 | 290 |
| 327 | 3300009148 | Ga0105243_10298323 | Ga0105243_102983232 | 290 |
| 328 | 3300010159 | Ga0099796_10012057 | Ga0099796_100120572 | 290 |
| 329 | 3300014968 | Ga0157379_10046432 | Ga0157379_100464327 | 290 |
| 330 | 3300025885 | Ga0207653_10028108 | Ga0207653_100281082 | 290 |
| 331 | 3300025907 | Ga0207645_10045899 | Ga0207645_100458994 | 290 |
| 332 | 3300025912 | Ga0207707_10122118 | Ga0207707_101221183 | 290 |
| 333 | 3300025915 | Ga0207693_10041970 | Ga0207693_100419702 | 290 |
| 334 | 3300025917 | Ga0207660_10003611 | Ga0207660_100036112 | 290 |
| 335 | 3300025918 | Ga0207662_10013851 | Ga0207662_100138513 | 290 |
| 336 | 3300025921 | Ga0207652_10324440 | Ga0207652_103244401 | 290 |
| 337 | 3300025933 | Ga0207706_10080803 | Ga0207706_100808032 | 290 |
| 338 | 3300025961 | Ga0207712_10006615 | Ga0207712_100066152 | 290 |
| 339 | 3300025961 | Ga0207712_10207150 | Ga0207712_102071502 | 290 |
| 340 | 3300026078 | Ga0207702_10164048 | Ga0207702_101640483 | 290 |
| 341 | 3300026116 | Ga0207674_10241809 | Ga0207674_102418092 | 290 |
| 342 | 3300026118 | Ga0207675_100242987 | Ga0207675_1002429872 | 290 |
| 343 | 3300027666 | Ga0209282_1000066 | Ga0209282_100006629 | 290 |
| 344 | 3300028380 | Ga0268265_10002803 | Ga0268265_1000280318 | 290 |
| 345 | 3300028381 | Ga0268264_10054199 | Ga0268264_100541991 | 290 |
| 346 | 3300028381 | Ga0268264_10266516 | Ga0268264_102665162 | 290 |
| 347 | 3300031712 | Ga0265342_10162677 | Ga0265342_101626771 | 290 |
| 348 | 3300031901 | Ga0307406_10187695 | Ga0307406_101876952 | 290 |
| 349 | 3300033180 | Ga0307510_10001131 | Ga0307510_100011315 | 290 |
| 350 | 3300046507 | Ga0495606_0000995 | Ga0495606_0000995_23052_23954 | 290 |
| 351 | 3300046512 | Ga0495610_0124947 | Ga0495610_0124947_175_1101 | 290 |
| 352 | 3300048905 | Ga0496102_0446903 | Ga0496102_0446903_232_1149 | 290 |
| 353 | 3300048910 | Ga0496107_0202432 | Ga0496107_0202432_323_1240 | 290 |
| 354 | 3300048918 | Ga0496115_0255408 | Ga0496115_0255408_406_1311 | 290 |
| 355 | 3300048924 | Ga0496121_0007858 | Ga0496121_0007858_2684_3586 | 290 |
| 356 | 3300048928 | Ga0496125_0187464 | Ga0496125_0187464_137_1039 | 290 |
| 357 | 3300048929 | Ga0496126_0027737 | Ga0496126_0027737_160_1092 | 290 |
| 358 | 3300050489 | nmdc:mga03683_111587_c1 | nmdc:mga03683_111587_c1_86_1003 | 290 |
| 359 | 3300050493 | nmdc:mga0k408_7113_c2 | nmdc:mga0k408_7113_c2_76_993 | 290 |
| 360 | 3300050514 | nmdc:mga08x19_159757_c1 | nmdc:mga08x19_159757_c1_348_1253 | 290 |
| 361 | 3300002741 | JGI25157J39369_1000275 | JGI25157J39369_100027521 | 291 |
| 362 | 3300005327 | Ga0070658_10084854 | Ga0070658_100848542 | 291 |
| 363 | 3300005331 | Ga0070670_100034914 | Ga0070670_1000349145 | 291 |
| 364 | 3300005355 | Ga0070671_100234860 | Ga0070671_1002348602 | 291 |
| 365 | 3300005434 | Ga0070709_10022102 | Ga0070709_100221024 | 291 |
| 366 | 3300005434 | Ga0070709_10150123 | Ga0070709_101501232 | 291 |
| 367 | 3300005435 | Ga0070714_100015299 | Ga0070714_1000152993 | 291 |
| 368 | 3300005435 | Ga0070714_100073584 | Ga0070714_1000735842 | 291 |
| 369 | 3300005435 | Ga0070714_100116701 | Ga0070714_1001167012 | 291 |
| 370 | 3300005436 | Ga0070713_100010807 | Ga0070713_1000108077 | 291 |
| 371 | 3300005436 | Ga0070713_100012954 | Ga0070713_1000129548 | 291 |
| 372 | 3300005437 | Ga0070710_10001502 | Ga0070710_100015027 | 291 |
| 373 | 3300005439 | Ga0070711_100057746 | Ga0070711_1000577464 | 291 |
| 374 | 3300005439 | Ga0070711_100112773 | Ga0070711_1001127732 | 291 |
| 375 | 3300005467 | Ga0070706_100048438 | Ga0070706_1000484383 | 291 |
| 376 | 3300005518 | Ga0070699_100107346 | Ga0070699_1001073463 | 291 |
| 377 | 3300005518 | Ga0070699_100322423 | Ga0070699_1003224232 | 291 |
| 378 | 3300005536 | Ga0070697_100139421 | Ga0070697_1001394212 | 291 |
| 379 | 3300005548 | Ga0070665_100008836 | Ga0070665_1000088363 | 291 |
| 380 | 3300005548 | Ga0070665_100009026 | Ga0070665_1000090267 | 291 |
| 381 | 3300005616 | Ga0068852_100001546 | Ga0068852_10000154610 | 291 |
| 382 | 3300005618 | Ga0068864_100022500 | Ga0068864_1000225003 | 291 |
| 383 | 3300005842 | Ga0068858_100450200 | Ga0068858_1004502002 | 291 |
| 384 | 3300006028 | Ga0070717_10077865 | Ga0070717_100778653 | 291 |
| 385 | 3300006028 | Ga0070717_10091649 | Ga0070717_100916492 | 291 |
| 386 | 3300006028 | Ga0070717_10094032 | Ga0070717_100940321 | 291 |
| 387 | 3300006038 | Ga0075365_10010329 | Ga0075365_100103296 | 291 |
| 388 | 3300006048 | Ga0075363_100027917 | Ga0075363_1000279173 | 291 |
| 389 | 3300006163 | Ga0070715_10001855 | Ga0070715_100018556 | 291 |
| 390 | 3300006163 | Ga0070715_10130025 | Ga0070715_101300251 | 291 |
| 391 | 3300006163 | Ga0070715_10130533 | Ga0070715_101305332 | 291 |
| 392 | 3300006173 | Ga0070716_100004571 | Ga0070716_1000045717 | 291 |
| 393 | 3300006173 | Ga0070716_100226841 | Ga0070716_1002268412 | 291 |
| 394 | 3300006175 | Ga0070712_100088730 | Ga0070712_1000887302 | 291 |
| 395 | 3300006178 | Ga0075367_10086038 | Ga0075367_100860383 | 291 |
| 396 | 3300006178 | Ga0075367_10141357 | Ga0075367_101413573 | 291 |
| 397 | 3300006237 | Ga0097621_100025734 | Ga0097621_1000257343 | 291 |
| 398 | 3300006358 | Ga0068871_100009415 | Ga0068871_1000094153 | 291 |
| 399 | 3300006358 | Ga0068871_100461046 | Ga0068871_1004610461 | 291 |
| 400 | 3300006844 | Ga0075428_100007608 | Ga0075428_10000760818 | 291 |
| 401 | 3300006914 | Ga0075436_100124029 | Ga0075436_1001240292 | 291 |
| 402 | 3300007076 | Ga0075435_100070375 | Ga0075435_1000703753 | 291 |
| 403 | 3300007788 | Ga0099795_10004364 | Ga0099795_100043642 | 291 |
| 404 | 3300009093 | Ga0105240_10000347 | Ga0105240_1000034773 | 291 |
| 405 | 3300009098 | Ga0105245_10293824 | Ga0105245_102938243 | 291 |
| 406 | 3300009551 | Ga0105238_10000652 | Ga0105238_1000065226 | 291 |
| 407 | 3300009551 | Ga0105238_10011631 | Ga0105238_100116314 | 291 |
| 408 | 3300009551 | Ga0105238_10259529 | Ga0105238_102595291 | 291 |
| 409 | 3300009553 | Ga0105249_10000147 | Ga0105249_1000014761 | 291 |
| 410 | 3300009553 | Ga0105249_10510270 | Ga0105249_105102701 | 291 |
| 411 | 3300010159 | Ga0099796_10004111 | Ga0099796_100041113 | 291 |
| 412 | 3300010375 | Ga0105239_10095975 | Ga0105239_100959753 | 291 |
| 413 | 3300011119 | Ga0105246_10158277 | Ga0105246_101582772 | 291 |
| 414 | 3300013100 | Ga0157373_10082420 | Ga0157373_100824202 | 291 |
| 415 | 3300013306 | Ga0163162_10328750 | Ga0163162_103287502 | 291 |
| 416 | 3300013308 | Ga0157375_10036930 | Ga0157375_100369303 | 291 |
| 417 | 3300013308 | Ga0157375_10428840 | Ga0157375_104288401 | 291 |
| 418 | 3300014497 | Ga0182008_10011898 | Ga0182008_100118983 | 291 |
| 419 | 3300014497 | Ga0182008_10070777 | Ga0182008_100707773 | 291 |
| 420 | 3300014497 | Ga0182008_10172750 | Ga0182008_101727501 | 291 |
| 421 | 3300014969 | Ga0157376_10016887 | Ga0157376_100168872 | 291 |
| 422 | 3300021361 | Ga0213872_10024857 | Ga0213872_100248573 | 291 |
| 423 | 3300025226 | Ga0209674_101160 | Ga0209674_1011602 | 291 |
| 424 | 3300025242 | Ga0209258_109151 | Ga0209258_1091512 | 291 |
| 425 | 3300025250 | Ga0209026_1000105 | Ga0209026_1000105120 | 291 |
| 426 | 3300025256 | Ga0209759_1008897 | Ga0209759_10088973 | 291 |
| 427 | 3300025898 | Ga0207692_10004784 | Ga0207692_100047845 | 291 |
| 428 | 3300025898 | Ga0207692_10052010 | Ga0207692_100520101 | 291 |
| 429 | 3300025905 | Ga0207685_10009539 | Ga0207685_100095393 | 291 |
| 430 | 3300025905 | Ga0207685_10025083 | Ga0207685_100250833 | 291 |
| 431 | 3300025906 | Ga0207699_10028721 | Ga0207699_100287213 | 291 |
| 432 | 3300025909 | Ga0207705_10066512 | Ga0207705_100665122 | 291 |
| 433 | 3300025913 | Ga0207695_10000670 | Ga0207695_1000067039 | 291 |
| 434 | 3300025913 | Ga0207695_10464140 | Ga0207695_104641401 | 291 |
| 435 | 3300025915 | Ga0207693_10007521 | Ga0207693_100075216 | 291 |
| 436 | 3300025915 | Ga0207693_10063659 | Ga0207693_100636592 | 291 |
| 437 | 3300025916 | Ga0207663_10001619 | Ga0207663_100016197 | 291 |
| 438 | 3300025924 | Ga0207694_10002179 | Ga0207694_100021792 | 291 |
| 439 | 3300025926 | Ga0207659_10118219 | Ga0207659_101182192 | 291 |
| 440 | 3300025927 | Ga0207687_10011700 | Ga0207687_100117003 | 291 |
| 441 | 3300025928 | Ga0207700_10013123 | Ga0207700_100131237 | 291 |
| 442 | 3300025928 | Ga0207700_10034594 | Ga0207700_100345942 | 291 |
| 443 | 3300025929 | Ga0207664_10244204 | Ga0207664_102442041 | 291 |
| 444 | 3300025931 | Ga0207644_10249285 | Ga0207644_102492852 | 291 |
| 445 | 3300025939 | Ga0207665_10003514 | Ga0207665_100035147 | 291 |
| 446 | 3300025939 | Ga0207665_10044662 | Ga0207665_100446622 | 291 |
| 447 | 3300025939 | Ga0207665_10130074 | Ga0207665_101300741 | 291 |
| 448 | 3300025942 | Ga0207689_10335965 | Ga0207689_103359651 | 291 |
| 449 | 3300025961 | Ga0207712_10000090 | Ga0207712_1000009071 | 291 |
| 450 | 3300025972 | Ga0207668_10221440 | Ga0207668_102214401 | 291 |
| 451 | 3300026078 | Ga0207702_10165390 | Ga0207702_101653902 | 291 |
| 452 | 3300026142 | Ga0207698_10001115 | Ga0207698_1000111510 | 291 |
| 453 | 3300027512 | Ga0209179_1012911 | Ga0209179_10129112 | 291 |
| 454 | 3300027671 | Ga0209588_1009522 | Ga0209588_10095222 | 291 |
| 455 | 3300027671 | Ga0209588_1019109 | Ga0209588_10191093 | 291 |
| 456 | 3300028379 | Ga0268266_10007036 | Ga0268266_100070363 | 291 |
| 457 | 3300028381 | Ga0268264_10091715 | Ga0268264_100917153 | 291 |
| 458 | 3300028556 | Ga0265337_1012122 | Ga0265337_10121223 | 291 |
| 459 | 3300028563 | Ga0265319_1006202 | Ga0265319_10062027 | 291 |
| 460 | 3300028573 | Ga0265334_10003965 | Ga0265334_100039658 | 291 |
| 461 | 3300028653 | Ga0265323_10000311 | Ga0265323_100003118 | 291 |
| 462 | 3300028666 | Ga0265336_10000074 | Ga0265336_1000007450 | 291 |
| 463 | 3300028794 | Ga0307515_10002583 | Ga0307515_100025837 | 291 |
| 464 | 3300028800 | Ga0265338_10000137 | Ga0265338_1000013791 | 291 |
| 465 | 3300029957 | Ga0265324_10003671 | Ga0265324_100036717 | 291 |
| 466 | 3300031616 | Ga0307508_10077347 | Ga0307508_100773471 | 291 |
| 467 | 3300031711 | Ga0265314_10019587 | Ga0265314_100195874 | 291 |
| 468 | 3300031712 | Ga0265342_10014254 | Ga0265342_100142545 | 291 |
| 469 | 3300031730 | Ga0307516_10005013 | Ga0307516_1000501311 | 291 |
| 470 | 3300035120 | Ga0373957_0094347 | Ga0373957_0094347_79_1014 | 291 |
| 471 | 3300035695 | Ga0373927_0066673 | Ga0373927_0066673_11_958 | 291 |
| 472 | 3300035724 | Ga0373933_0063072 | Ga0373933_0063072_274_1209 | 291 |
| 473 | 3300036401 | Ga0373937_0101725 | Ga0373937_0101725_1649_2584 | 291 |
| 474 | 3300041501 | Ga0451845_0637907 | Ga0451845_0637907_412_1341 | 291 |
| 475 | 3300046460 | Ga0495638_0000087 | Ga0495638_0000087_140499_141434 | 291 |
| 476 | 3300046471 | Ga0495650_0000502 | Ga0495650_0000502_38607_39542 | 291 |
| 477 | 3300046471 | Ga0495650_0000705 | Ga0495650_0000705_10786_11721 | 291 |
| 478 | 3300046522 | Ga0495643_0017028 | Ga0495643_0017028_985_1914 | 291 |
| 479 | 3300046524 | Ga0495648_0008727 | Ga0495648_0008727_3387_4322 | 291 |
| 480 | 3300046616 | Ga0495668_0005238 | Ga0495668_0005238_6747_7682 | 291 |
| 481 | 3300046660 | Ga0495625_0043826 | Ga0495625_0043826_299_1234 | 291 |
| 482 | 3300047320 | Ga0495672_0043070 | Ga0495672_0043070_1437_2378 | 291 |
| 483 | 3300048905 | Ga0496102_0142088 | Ga0496102_0142088_234_1208 | 291 |
| 484 | 3300048908 | Ga0496105_0052529 | Ga0496105_0052529_1726_2700 | 291 |
| 485 | 3300048912 | Ga0496109_0027213 | Ga0496109_0027213_2388_3362 | 291 |
| 486 | 3300048913 | Ga0496110_0034477 | Ga0496110_0034477_2917_3891 | 291 |
| 487 | 3300048914 | Ga0496111_0115048 | Ga0496111_0115048_285_1259 | 291 |
| 488 | 3300048915 | Ga0496112_0043866 | Ga0496112_0043866_1130_2104 | 291 |
| 489 | 3300048917 | Ga0496114_0058419 | Ga0496114_0058419_2218_3153 | 291 |
| 490 | 3300048917 | Ga0496114_0144114 | Ga0496114_0144114_1055_2029 | 291 |
| 491 | 3300048918 | Ga0496115_0104874 | Ga0496115_0104874_850_1785 | 291 |
| 492 | 3300048925 | Ga0496122_0000488 | Ga0496122_0000488_79138_80049 | 291 |
| 493 | 3300048926 | Ga0496123_0002461 | Ga0496123_0002461_2100_3011 | 291 |
| 494 | 3300048927 | Ga0496124_0055855 | Ga0496124_0055855_594_1502 | 291 |
| 495 | 3300048928 | Ga0496125_0111273 | Ga0496125_0111273_988_1896 | 291 |
| 496 | 3300048928 | Ga0496125_0123814 | Ga0496125_0123814_107_1015 | 291 |
| 497 | 3300048929 | Ga0496126_0033299 | Ga0496126_0033299_1566_2504 | 291 |
| 498 | 3300048929 | Ga0496126_0135369 | Ga0496126_0135369_1007_1942 | 291 |
| 499 | 3300050494 | nmdc:mga06z11_236968_c1 | nmdc:mga06z11_236968_c1_14_949 | 291 |
| 500 | 3300050510 | nmdc:mga06r32_201853_c1 | nmdc:mga06r32_201853_c1_426_1391 | 291 |
| 501 | 3300053092 | Ga0500583_0117430 | Ga0500583_0117430_28_963 | 291 |
| 502 | 3300053119 | Ga0500595_004871 | Ga0500595_004871_4826_5746 | 291 |
| 503 | 3300053735 | Ga0500596_007300 | Ga0500596_007300_442_1371 | 291 |
| 504 | 3300005617 | Ga0068859_100722165 | Ga0068859_1007221652 | 292 |
| 505 | 3300006931 | Ga0097620_100722120 | Ga0097620_1007221202 | 292 |
| 506 | 3300009101 | Ga0105247_10042421 | Ga0105247_100424213 | 292 |
| 507 | 3300025909 | Ga0207705_10145304 | Ga0207705_101453043 | 292 |
| 508 | 3300025942 | Ga0207689_10099054 | Ga0207689_100990543 | 292 |
| 509 | 3300041452 | Ga0451793_1635360 | Ga0451793_1635360_37_972 | 292 |
| 510 | 3300048907 | Ga0496104_0019935 | Ga0496104_0019935_2155_3123 | 292 |
| 511 | 3300046462 | Ga0495651_0077803 | Ga0495651_0077803_1110_2060 | 293 |
| 512 | 3300046679 | Ga0495623_0046096 | Ga0495623_0046096_704_1654 | 293 |
| 513 | 3300053119 | Ga0500595_042230 | Ga0500595_042230_120_1049 | 293 |
| 514 | iso_pu_bacteria | 2510461076 | 2510898199 | 296 |
| 515 | iso_pu_bacteria | 2510917028 | 2511181625 | 296 |
| 516 | iso_pu_bacteria | 2510917030 | 2511197419 | 296 |
| 517 | iso_pu_bacteria | 2513237084 | 2513573485 | 296 |
| 518 | iso_pu_bacteria | 2513237085 | 2513581006 | 296 |
| 519 | iso_pu_bacteria | 2513237088 | 2513596585 | 296 |
| 520 | iso_pu_bacteria | 2513237138 | 2513867330 | 296 |
| 521 | iso_pu_bacteria | 2515075009 | 2515110847 | 296 |
| 522 | iso_pu_bacteria | 2515154116 | 2515661816 | 296 |
| 523 | iso_pu_bacteria | 2515154134 | 2515743230 | 296 |
| 524 | iso_pu_bacteria | 2517287029 | 2517405449 | 296 |
| 525 | iso_pu_bacteria | 2582581298 | 2585226675 | 296 |
| 526 | iso_pu_bacteria | 2582581299 | 2585227606 | 296 |
| 527 | iso_pu_bacteria | 2585427526 | 2585525185 | 296 |
| 528 | iso_pu_bacteria | 2585427529 | 2585550090 | 296 |
| 529 | iso_pu_bacteria | 2585427590 | 2585820383 | 296 |
| 530 | iso_pu_bacteria | 2791355260 | 2793320196 | 296 |
| 531 | iso_pu_bacteria | 2896384573 | 2896390591 | 296 |
| 532 | iso_pu_bacteria | 2919100787 | 2919107141 | 296 |
| 533 | iso_pu_bacteria | 2923556063 | 2923560802 | 296 |
| 534 | iso_pu_bacteria | 2933016740 | 2933018837 | 296 |
| 535 | iso_pu_bacteria | 2935901341 | 2935906757 | 296 |
| 536 | iso_pu_bacteria | 8005301065 | 8005304240 | 296 |
| 537 | iso_pu_bacteria | 8005307578 | 8005310977 | 296 |
| 538 | iso_pu_bacteria | 8005376324 | 8005377049 | 296 |
| 539 | iso_pu_bacteria | 8005460587 | 8005461485 | 296 |
| 540 | iso_pu_bacteria | 8005484373 | 8005489628 | 296 |
| 541 | iso_pu_bacteria | 8005688590 | 8005690662 | 296 |
| 542 | iso_pu_bacteria | 8023680758 | 8023683546 | 296 |
| 543 | 3300002739 | JGI25158J39367_1000048 | JGI25158J39367_100004816 | 300 |
| 544 | 3300002773 | JGI25152J39213_1003470 | JGI25152J39213_10034704 | 300 |
| 545 | 3300002773 | JGI25152J39213_1008106 | JGI25152J39213_10081062 | 300 |
| 546 | 3300002987 | JGI25159J45721_1001278 | JGI25159J45721_10012787 | 300 |
| 547 | 3300003215 | JGI25153J46596_10002410 | JGI25153J46596_100024102 | 300 |
| 548 | 3300003215 | JGI25153J46596_10019046 | JGI25153J46596_100190462 | 300 |
| 549 | 3300003320 | rootH2_10024597 | rootH2_100245974 | 300 |
| 550 | 3300003354 | JGI25160J50197_1018991 | JGI25160J50197_10189912 | 300 |
| 551 | 3300003354 | JGI25160J50197_1027207 | JGI25160J50197_10272072 | 300 |
| 552 | 3300003374 | JGI25161J50226_1000267 | JGI25161J50226_100026719 | 300 |
| 553 | 3300003771 | Ga0055526_1003629 | Ga0055526_10036298 | 300 |
| 554 | 3300003771 | Ga0055526_1010616 | Ga0055526_10106164 | 300 |
| 555 | 3300003775 | Ga0055524_1018952 | Ga0055524_10189521 | 300 |
| 556 | 3300003775 | Ga0055524_1041739 | Ga0055524_10417391 | 300 |
| 557 | 3300003790 | Ga0055528_1003043 | Ga0055528_10030433 | 300 |
| 558 | 3300003790 | Ga0055528_1009119 | Ga0055528_10091193 | 300 |
| 559 | 3300004625 | Ga0055543_1000065 | Ga0055543_100006587 | 300 |
| 560 | 3300005262 | Ga0065165_1015708 | Ga0065165_10157083 | 300 |
| 561 | 3300006038 | Ga0075365_10027162 | Ga0075365_100271625 | 300 |
| 562 | 3300009551 | Ga0105238_10563623 | Ga0105238_105636232 | 300 |
| 563 | 3300025208 | Ga0209436_100014 | Ga0209436_100014110 | 300 |
| 564 | 3300025245 | Ga0207425_1000834 | Ga0207425_100083417 | 300 |
| 565 | 3300025258 | Ga0209129_1001143 | Ga0209129_10011433 | 300 |
| 566 | 3300025258 | Ga0209129_1001619 | Ga0209129_10016198 | 300 |
| 567 | 3300025273 | Ga0209673_1001862 | Ga0209673_100186210 | 300 |
| 568 | 3300025273 | Ga0209673_1010761 | Ga0209673_10107612 | 300 |
| 569 | 3300025284 | Ga0209130_1000004 | Ga0209130_1000004530 | 300 |
| 570 | 3300025295 | Ga0209564_1001123 | Ga0209564_100112324 | 300 |
| 571 | 3300025295 | Ga0209564_1001210 | Ga0209564_100121010 | 300 |
| 572 | 3300025297 | Ga0209758_1000829 | Ga0209758_100082944 | 300 |
| 573 | 3300025297 | Ga0209758_1010623 | Ga0209758_10106232 | 300 |
| 574 | 3300025297 | Ga0209758_1030014 | Ga0209758_10300142 | 300 |
| 575 | 3300025299 | Ga0209256_1004729 | Ga0209256_10047293 | 300 |
| 576 | 3300025299 | Ga0209256_1008836 | Ga0209256_10088362 | 300 |
| 577 | 3300025299 | Ga0209256_1012970 | Ga0209256_10129702 | 300 |
| 578 | 3300025302 | Ga0207426_1000003 | Ga0207426_1000003196 | 300 |
| 579 | 3300025302 | Ga0207426_1025964 | Ga0207426_10259642 | 300 |
| 580 | 3300025303 | Ga0209051_1008436 | Ga0209051_10084367 | 300 |
| 581 | 3300025304 | Ga0209257_1029054 | Ga0209257_10290542 | 300 |
| 582 | 3300041413 | Ga0439465_0005022 | Ga0439465_0005022_89_991 | 300 |
| 583 | 3300041496 | Ga0451839_0567018 | Ga0451839_0567018_103_1020 | 300 |
| 584 | 3300041501 | Ga0451845_0717355 | Ga0451845_0717355_2682_3599 | 300 |
| 585 | 3300041503 | Ga0451847_0263760 | Ga0451847_0263760_397_1314 | 300 |
| 586 | 3300041505 | Ga0451849_0301535 | Ga0451849_0301535_1937_2854 | 300 |
| 587 | 3300041509 | Ga0451843_1036654 | Ga0451843_1036654_2207_3124 | 300 |
| 588 | 3300041511 | Ga0451855_0164364 | Ga0451855_0164364_1978_2895 | 300 |
| 589 | 3300041512 | Ga0451853_3204310 | Ga0451853_3204310_380_1297 | 300 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5fgm-assembly1.cif.gz_A | streptomyces coelicolor sigr region 4 | 0.9873 | 125 | 175 |
| 1h3l-assembly1.cif.gz_A | n-terminal fragment of sigr from streptomyces coelicolor | 0.9041 | 16 | 83 |
| 6jhe-assembly1.cif.gz_A | crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna | 0.8969 | 129 | 177 |
| 2o8x-assembly1.cif.gz_A | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.8626 | 116 | 173 |
| 5f64-assembly2.cif.gz_C | putative positive transcription regulator (sensor evgs) from shigella flexneri | 0.8589 | 123 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4go1B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9263 | 132 | 170 | 1.10.10.10 |
| af_P06993_830_894_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9145 | 129 | 173 | 1.10.10.10 |
| 1h3lB00 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.905 | 16 | 83 | 1.10.1740.10 |
| 1h3lA00 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.9041 | 16 | 83 | 1.10.1740.10 |
| 3kloB02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8966 | 125 | 174 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A7M8E9-F1-model_v4 | Sigma-70 family RNA polymerase sigma factor | 0.9096 | 17 | 297 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A502RJE7-F1-model_v4 | deleted | 0.8736 | 1 | 300 |
|
| AF-A0A6A7M8E9-F1-model_v4 | Sigma-70 family RNA polymerase sigma factor | 0.8713 | 17 | 297 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A502RJE7-F1-model_v4 | deleted | 0.8709 | 1 | 300 |
|
| AF-A0A4R0YHQ0-F1-model_v4 | Sigma-70 family RNA polymerase sigma factor | 0.8666 | 20 | 300 |
GO:0003677
GO:0006352 GO:0016987 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar