F466876

General Info

Members Datasets Scaffolds Average Seq Length
589 400 1178 432

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10045849|Ga0307406_100458492
Length 482
Sequence VSSTPSTSPAASGTARIYDFAGIGVGPFNLGLAALTEPVKGVHGVFLERRPSFDWHPGMMLEPAHLQVPFMADLVTLADPTSPYSFLNFLKQTGRLYRFYIRENFYPLRAEYNQYCQWVAGQLDSVRFGTDVTNITFDDGVYRLAVDGPDGPDVVLARRLVLGTGTSPYVPEACAGVVDAGGLVLHNAEYLPRKAELQQQRSITIVGSGQSAAEIYYELLQEIDVHGYQLNWVTRSGRFFPLEYTKLTLEMTSPDYVDYFHSLPQERRDGLIRSQKNLYKGINSELIDAIYDLLYTKSLTGLTDTRLLTHSALTGAAWDPATGTHTLQLRHEEQDSGYSIESDAVVLATGYTYREPAFLAGIHHRISRDNSGRFAVERNYSTGVVPGEIFVQNAELHTHGFVTPDLGMAAYRNSCILREITGREVYAVERTIAFQEFGAPAALRQPDDLPPLPEQMEFSMSQSHVPSASQASQPIDRIGETA

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
51 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
90 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
91 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
92 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
93 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
94 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
117 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
118 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
119 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
120 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
123 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
124 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
125 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
126 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
127 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
128 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
129 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
130 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
131 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
132 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
178 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
206 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
245 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
246 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
247 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
254 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
255 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
256 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
257 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
258 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
259 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
260 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
261 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
262 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
263 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
264 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
265 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
266 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
267 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
268 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
269 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
270 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
271 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
272 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
273 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
274 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
275 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
276 2643221647 Streptomyces sp. Root369 Isolate Unclassified
277 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
278 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
279 2643221714 Streptomyces sp. Root264 Isolate Unclassified
280 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
281 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
282 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
283 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
284 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
285 2738541302 Pedobacter sp. CF074 Isolate Unclassified
286 2739367651 Pedobacter sp. OK291 Isolate Unclassified
287 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
288 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
289 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
290 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
291 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
292 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
293 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
294 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
295 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
296 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
297 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
298 2808606448 Streptomyces sp. 193411 Isolate Unclassified
299 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
300 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
301 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
302 2818991437 Pedobacter terrae 518 Isolate Unclassified
303 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
304 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
305 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
306 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
307 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
308 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
309 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
310 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
311 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
312 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
313 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
314 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
315 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
316 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
317 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
318 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
319 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
320 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
321 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
322 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
323 2862574272 Streptomyces sp. AcE210 Isolate Nodule
324 2865014394 Pantoea sp. R-71966 Isolate Unclassified
325 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
326 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
327 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
328 2867428634 Streptomyces sp. RP5T Isolate Unclassified
329 2867475112 Streptomyces sp. TM32 Isolate Unclassified
330 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
331 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
332 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
333 2891562705 Microbispora tritici MT50 Isolate Unclassified
334 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
335 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
336 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
337 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
338 2904504865 Serratia marcescens 1822 Isolate Unclassified
339 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
340 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
341 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
342 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
343 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
344 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
345 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
346 2919150387 Rahnella aceris 1817 Isolate Unclassified
347 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
348 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
349 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
350 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
351 2927143783 Rahnella sp. 2050 Isolate Unclassified
352 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
353 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
354 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
355 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
356 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
357 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
358 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
359 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
360 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
361 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
362 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
363 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
364 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
365 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
366 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
367 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
368 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
369 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
370 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
371 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
372 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
373 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
374 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
375 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
376 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
377 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
378 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
379 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
380 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
381 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
382 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
383 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
384 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
385 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
386 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
387 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
388 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
389 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
390 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
391 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
392 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
393 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
394 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
395 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
396 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
397 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
398 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
399 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
400 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.74
Metatranscriptomes 0
Isolates 23.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.68
Bulb 0
Endosphere 10.19
Nodule 0.68
Rhizoplane 2.38
Rhizosphere 64.86
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10045849 3300031901 Bacteria 2747
2 JGI24739J22299_10000375 3300001989 Bacteria 15393
3 JGI25162J39368_1000009 3300002737 Bacteria 389795
4 JGI25162J39368_1000258 3300002737 Bacteria 50724
5 JGI25154J39366_1000021 3300002738 Bacteria 221559
6 JGI25163J39215_1000038 3300002771 Bacteria 60053
7 JGI25164J39214_1000002 3300002772 Bacteria 406570
8 JGI25152J39213_1000045 3300002773 Bacteria 86127
9 rootH2_10045220 3300003320 Bacteria 7529
10 rootL2_10027395 3300003322 Bacteria 15216
11 rootH1_10013607 3300003323 Bacteria 4584
12 rootH1_10051261 3300003323 Bacteria 5019
13 JGI25160J50197_1013124 3300003354 Bacteria 2839
14 JGI25160J50197_1016147 3300003354 Bacteria 2417
15 Ga0055538_1000015 3300003751 Bacteria 311166
16 Ga0055539_1000009 3300003752 Bacteria 406566
17 Ga0055533_1000012 3300003756 Bacteria 406566
18 Ga0055525_1000014 3300003759 Bacteria 406566
19 Ga0055535_1003778 3300003761 Bacteria 4046
20 Ga0055542_1003577 3300003762 Bacteria 4124
21 Ga0055536_1000001 3300003781 Bacteria 630663
22 Ga0055530_10005300 3300003791 Bacteria 6191
23 Ga0055531_10000138 3300003794 Bacteria 82997
24 Ga0055541_1000006 3300003841 Bacteria 406566
25 Ga0058692_1000038 3300003856 Bacteria 140136
26 Ga0058692_1000103 3300003856 Bacteria 56448
27 Ga0058692_1003971 3300003856 Bacteria 4468
28 Ga0065165_1001877 3300005262 Bacteria 20331
29 Ga0065165_1004984 3300005262 Bacteria 7787
30 Ga0065714_10006281 3300005288 Bacteria 3658
31 Ga0065714_10064459 3300005288 Bacteria 66711
32 Ga0065704_10000548 3300005289 Bacteria 25183
33 Ga0070668_100002334 3300005347 Bacteria 13953
34 Ga0070668_100031833 3300005347 Bacteria 4014
35 Ga0068860_100096725 3300005843 Bacteria 2814
36 Ga0068862_100150931 3300005844 Bacteria 2068
37 Ga0081455_10017897 3300005937 Bacteria 6772
38 Ga0081540_1018037 3300005983 Bacteria 4345
39 Ga0075367_10000578 3300006178 Bacteria 14009
40 Ga0105251_10003091 3300009011 Bacteria 12376
41 Ga0105251_10046776 3300009011 Bacteria 2081
42 Ga0105251_10079361 3300009011 Bacteria 1519
43 Ga0105244_10000047 3300009036 Bacteria 142097
44 Ga0105244_10000319 3300009036 Bacteria 46053
45 Ga0105244_10001080 3300009036 Bacteria 22687
46 Ga0105244_10014383 3300009036 Bacteria 4579
47 Ga0105250_10000007 3300009092 Bacteria 355249
48 Ga0105250_10022598 3300009092 Bacteria 2535
49 Ga0105243_10002478 3300009148 Bacteria 15406
50 Ga0105237_10004307 3300009545 Bacteria 16504
51 Ga0105237_10004581 3300009545 Bacteria 15959
52 Ga0105238_10172150 3300009551 Bacteria 2141
53 Ga0105239_10000478 3300010375 Bacteria 58328
54 Ga0105239_10276013 3300010375 Unclassified 1891
55 Ga0105246_10003995 3300011119 Bacteria 8946
56 Ga0105246_10016172 3300011119 Bacteria 4720
57 Ga0105246_10033667 3300011119 Bacteria 3408
58 Ga0105246_10129955 3300011119 Bacteria 1879
59 Ga0157373_10001546 3300013100 Bacteria 17563
60 Ga0157371_10000008 3300013102 Bacteria 393028
61 Ga0157371_10000021 3300013102 Bacteria 301017
62 Ga0157371_10000766 3300013102 Bacteria 37124
63 Ga0157370_10000075 3300013104 Bacteria 108060
64 Ga0157370_10000276 3300013104 Bacteria 65208
65 Ga0157370_10002996 3300013104 Bacteria 20062
66 Ga0157370_10023681 3300013104 Bacteria 6094
67 Ga0157369_10000008 3300013105 Bacteria 309315
68 Ga0157369_10023989 3300013105 Bacteria 6786
69 Ga0163162_10000502 3300013306 Bacteria 36447
70 Ga0163162_10213866 3300013306 Bacteria 2058
71 Ga0163162_10223642 3300013306 Bacteria 2012
72 Ga0157372_10003482 3300013307 Bacteria 16971
73 Ga0157372_10008915 3300013307 Bacteria 10658
74 Ga0157372_10017301 3300013307 Bacteria 7739
75 Ga0157372_10053107 3300013307 Bacteria 4515
76 Ga0182008_10001691 3300014497 Bacteria 14494
77 Ga0182006_1000408 3300015261 Bacteria 34758
78 Ga0182006_1001891 3300015261 Bacteria 11948
79 Ga0182006_1055550 3300015261 Bacteria 1511
80 Ga0182007_10000003 3300015262 Bacteria 548244
81 Ga0182005_1000153 3300015265 Bacteria 48357
82 Ga0183373_1001 3300015682 Bacteria 1410374
83 Ga0183367_1006 3300015688 Bacteria 648044
84 Ga0163161_10000164 3300017792 Bacteria 61295
85 Ga0163161_10000219 3300017792 Bacteria 52250
86 Ga0163161_10013759 3300017792 Bacteria 5636
87 Ga0163161_10128046 3300017792 Bacteria 1913
88 Ga0209760_100040 3300025207 Bacteria 118059
89 Ga0209784_100001 3300025224 Bacteria 3600592
90 Ga0209566_100001 3300025225 Bacteria 3600765
91 Ga0209674_100002 3300025226 Bacteria 3600592
92 Ga0209563_100002 3300025230 Bacteria 2045675
93 Ga0207427_100020 3300025231 Bacteria 507515
94 Ga0209437_100001 3300025233 Bacteria 2045675
95 Ga0209437_100032 3300025233 Bacteria 520075
96 Ga0209437_100361 3300025233 Bacteria 50797
97 Ga0209258_100145 3300025242 Bacteria 163672
98 Ga0209646_1000050 3300025246 Bacteria 296599
99 Ga0209026_1000240 3300025250 Bacteria 71671
100 Ga0209677_100002 3300025253 Bacteria 2045675
101 Ga0209148_1000177 3300025254 Bacteria 127365
102 Ga0209129_1000068 3300025258 Bacteria 217385
103 Ga0209233_1010218 3300025261 Bacteria 2823
104 Ga0209676_1000008 3300025292 Bacteria 991778
105 Ga0209025_1000045 3300025294 Bacteria 349118
106 Ga0209758_1004595 3300025297 Bacteria 11348
107 Ga0209758_1025897 3300025297 Bacteria 2558
108 Ga0209050_1000045 3300025298 Bacteria 388022
109 Ga0207426_1000073 3300025302 Bacteria 323756
110 Ga0207426_1000293 3300025302 Bacteria 98805
111 Ga0207426_1002867 3300025302 Bacteria 10229
112 Ga0207426_1016904 3300025302 Bacteria 2604
113 Ga0209051_1004119 3300025303 Bacteria 9105
114 Ga0209051_1009516 3300025303 Bacteria 5000
115 Ga0209257_1000001 3300025304 Bacteria 2274655
116 Ga0207697_10002451 3300025315 Bacteria 9607
117 Ga0207696_1000029 3300025711 Bacteria 398074
118 Ga0207696_1000498 3300025711 Bacteria 32915
119 Ga0207696_1001476 3300025711 Bacteria 12725
120 Ga0207655_1000030 3300025728 Bacteria 413221
121 Ga0207655_1001287 3300025728 Bacteria 23796
122 Ga0207655_1001970 3300025728 Bacteria 17529
123 Ga0207655_1016409 3300025728 Bacteria 4051
124 Ga0207713_1000011 3300025735 Bacteria 507224
125 Ga0207713_1004736 3300025735 Bacteria 8751
126 Ga0207713_1011079 3300025735 Bacteria 4935
127 Ga0207671_10005027 3300025914 Bacteria 12364
128 Ga0207671_10006628 3300025914 Bacteria 10272
129 Ga0207694_10198630 3300025924 Bacteria 1631
130 Ga0207709_10016870 3300025935 Bacteria 4068
131 Ga0207709_10064625 3300025935 Bacteria 2298
132 Ga0207691_10177831 3300025940 Bacteria 1860
133 Ga0207667_10071873 3300025949 Unclassified 3597
134 Ga0209371_1000034 3300027312 Bacteria 379021
135 Ga0209371_1000093 3300027312 Bacteria 171050
136 Ga0209371_1002919 3300027312 Bacteria 8922
137 Ga0209371_1002968 3300027312 Bacteria 8819
138 Ga0207428_10036427 3300027907 Bacteria 4013
139 Ga0268265_10083626 3300028380 Bacteria 2528
140 Ga0268264_10037949 3300028381 Bacteria 3974
141 Ga0307517_10012094 3300028786 Bacteria 11894
142 Ga0307515_10006210 3300028794 Bacteria 23997
143 Ga0268256_1000043 3300030500 Bacteria 331360
144 Ga0268256_1000081 3300030500 Bacteria 171742
145 Ga0268256_1000752 3300030500 Bacteria 23724
146 Ga0268256_1002629 3300030500 Bacteria 8922
147 Ga0268256_1027661 3300030500 Bacteria 1409
148 Ga0307511_10000477 3300030521 Bacteria 43424
149 Ga0307512_10002642 3300030522 Bacteria 22156
150 Ga0316177_1045554 3300030731 Bacteria 5881
151 Ga0316176_1220125 3300030732 Bacteria 12538
152 Ga0316181_1278021 3300030744 Bacteria 2338
153 Ga0307513_10029380 3300031456 Bacteria 6269
154 Ga0307513_10121885 3300031456 Bacteria 2572
155 Ga0307509_10008150 3300031507 Bacteria 13433
156 Ga0307509_10104489 3300031507 Bacteria 2857
157 Ga0307408_100003548 3300031548 Bacteria 10627
158 Ga0307408_100008343 3300031548 Bacteria 6842
159 Ga0307408_100025838 3300031548 Bacteria 4025
160 Ga0307408_100028204 3300031548 Bacteria 3877
161 Ga0307408_100068269 3300031548 Bacteria 2617
162 Ga0307408_100185848 3300031548 Bacteria 1670
163 Ga0307508_10006664 3300031616 Bacteria 10843
164 Ga0307508_10053295 3300031616 Bacteria 3590
165 Ga0307514_10001878 3300031649 Bacteria 23182
166 Ga0307514_10128783 3300031649 Bacteria 1747
167 Ga0307516_10004046 3300031730 Bacteria 18371
168 Ga0307516_10206490 3300031730 Bacteria 1681
169 Ga0307405_10000032 3300031731 Bacteria 98354
170 Ga0307405_10035535 3300031731 Bacteria 2977
171 Ga0307405_10107398 3300031731 Bacteria 1884
172 Ga0307413_10000107 3300031824 Bacteria 21411
173 Ga0307410_10002372 3300031852 Bacteria 9081
174 Ga0307410_10024906 3300031852 Bacteria 3745
175 Ga0307410_10075191 3300031852 Bacteria 2354
176 Ga0307410_10212405 3300031852 Bacteria 1483
177 Ga0307406_10000003 3300031901 Bacteria 251998
178 Ga0307406_10181130 3300031901 Bacteria 1534
179 Ga0307407_10008580 3300031903 Bacteria 4702
180 Ga0307407_10025963 3300031903 Bacteria 3096
181 Ga0307412_10004093 3300031911 Bacteria 8124
182 Ga0307412_10012753 3300031911 Bacteria 4905
183 Ga0307412_10063452 3300031911 Bacteria 2492
184 Ga0307412_10075047 3300031911 Bacteria 2318
185 Ga0307409_100014800 3300031995 Bacteria 5091
186 Ga0307409_100016645 3300031995 Bacteria 4872
187 Ga0307409_100206287 3300031995 Bacteria 1763
188 Ga0307416_100021725 3300032002 Bacteria 4614
189 Ga0307416_100048321 3300032002 Bacteria 3375
190 Ga0307416_100065107 3300032002 Bacteria 2993
191 Ga0307414_10000001 3300032004 Bacteria 1352954
192 Ga0307414_10034930 3300032004 Bacteria 3339
193 Ga0307414_10149835 3300032004 Bacteria 1839
194 Ga0307411_10000001 3300032005 Bacteria 931810
195 Ga0307415_100030434 3300032126 Bacteria 3465
196 Ga0307507_10031590 3300033179 Bacteria 5553
197 Ga0307507_10066512 3300033179 Bacteria 3303
198 Ga0307507_10157204 3300033179 Bacteria 1691
199 Ga0307510_10024274 3300033180 Bacteria 7008
200 Ga0395900_0068666 3300037418 Bacteria 3642
201 Ga0395900_0073730 3300037418 Bacteria 3510
202 Ga0395900_0264439 3300037418 Bacteria 1717
203 Ga0395898_0099194 3300037466 Bacteria 2797
204 Ga0395898_0099820 3300037466 Bacteria 2788
205 Ga0395901_0086921 3300038443 Bacteria 3269
206 Ga0439438_003563 3300041405 Bacteria 6248
207 Ga0439439_0008890 3300041406 Bacteria 2378
208 Ga0439447_003550 3300041407 Bacteria 5526
209 Ga0439447_017741 3300041407 Bacteria 1934
210 Ga0439466_0002667 3300041411 Bacteria 6974
211 Ga0451837_0044792 3300041494 Bacteria 3048
212 Ga0451853_0467392 3300041512 Bacteria 7839
213 Ga0451853_1828395 3300041512 Bacteria 2519
214 Ga0439433_0000053 3300041999 Bacteria 14113
215 Ga0439433_0002239 3300041999 Bacteria 4084
216 Ga0439433_0004488 3300041999 Bacteria 3005
217 Ga0439433_0006640 3300041999 Bacteria 2493
218 Ga0439442_000693 3300042002 Bacteria 7093
219 Ga0439442_011592 3300042002 Bacteria 1796
220 Ga0439432_005694 3300042006 Bacteria 4478
221 Ga0439432_025935 3300042006 Bacteria 1920
222 Ga0439449_0003710 3300042007 Bacteria 5924
223 Ga0439449_0010144 3300042007 Bacteria 3561
224 Ga0439449_0019001 3300042007 Bacteria 2576
225 Ga0439452_000004 3300042010 Bacteria 764268
226 Ga0439457_000197 3300042014 Bacteria 15955
227 Ga0439462_0006281 3300042015 Bacteria 2948
228 Ga0439463_012084 3300042016 Bacteria 2122
229 Ga0450898_003379 3300042134 Bacteria 2292
230 Ga0450907_000088 3300042146 Bacteria 36401
231 Ga0439434_0000246 3300042435 Bacteria 15180
232 Ga0466972_0004414 3300044658 Bacteria 7031
233 Ga0466965_0000319 3300044683 Bacteria 16121
234 Ga0466966_0003509 3300044684 Bacteria 10343
235 Ga0466961_0003370 3300044693 Bacteria 9978
236 Ga0466963_0000410 3300044694 Bacteria 19654
237 Ga0466963_0002165 3300044694 Bacteria 10853
238 Ga0466964_0002518 3300044706 Bacteria 6516
239 Ga0466971_0000916 3300044719 Bacteria 12093
240 Ga0466970_0001045 3300044765 Bacteria 13386
241 Ga0466957_0001204 3300044842 Bacteria 13488
242 Ga0466959_0005690 3300045049 Bacteria 8577
243 Ga0466958_0005059 3300045836 Bacteria 7044
244 Ga0466967_0002249 3300045976 Bacteria 11891
245 Ga0466967_0252189 3300045976 Bacteria 1686
246 Ga0466967_0300016 3300045976 Bacteria 1545
247 Ga0495627_016036 3300046453 Bacteria 2575
248 Ga0495592_0001976 3300046454 Bacteria 14475
249 Ga0495592_0026544 3300046454 Bacteria 4390
250 Ga0495603_0018588 3300046455 Bacteria 4205
251 Ga0495603_0025560 3300046455 Bacteria 3571
252 Ga0495603_0130224 3300046455 Bacteria 1465
253 Ga0495591_000318 3300046458 Bacteria 43617
254 Ga0495629_0009575 3300046459 Bacteria 7079
255 Ga0495629_0041470 3300046459 Bacteria 3239
256 Ga0495629_0043656 3300046459 Bacteria 3147
257 Ga0495629_0074193 3300046459 Bacteria 2376
258 Ga0495638_0026710 3300046460 Bacteria 3741
259 Ga0495651_0056599 3300046462 Bacteria 3011
260 Ga0495650_0000026 3300046471 Bacteria 476029
261 Ga0495650_0000148 3300046471 Bacteria 159533
262 Ga0495580_0027812 3300046472 Bacteria 4113
263 Ga0495582_0020680 3300046473 Bacteria 3603
264 Ga0495605_0040680 3300046474 Bacteria 2319
265 Ga0495639_0018843 3300046475 Bacteria 3008
266 Ga0495662_0000971 3300046476 Bacteria 14034
267 Ga0495662_0010134 3300046476 Bacteria 4620
268 Ga0495664_0000582 3300046477 Bacteria 18410
269 Ga0495584_0015385 3300046491 Bacteria 3897
270 Ga0495585_0029402 3300046492 Bacteria 3128
271 Ga0495594_0015368 3300046499 Bacteria 4021
272 Ga0495607_0012103 3300046501 Bacteria 5708
273 Ga0495607_0062225 3300046501 Bacteria 2117
274 Ga0495606_0001190 3300046507 Bacteria 36711
275 Ga0495606_0027669 3300046507 Bacteria 4014
276 Ga0495606_0048779 3300046507 Bacteria 2782
277 Ga0495610_0000066 3300046512 Bacteria 124205
278 Ga0495610_0000150 3300046512 Bacteria 76876
279 Ga0495610_0062455 3300046512 Bacteria 1767
280 Ga0495616_0036265 3300046513 Bacteria 2545
281 Ga0495618_0021816 3300046514 Bacteria 3950
282 Ga0495618_0049327 3300046514 Bacteria 2658
283 Ga0495620_0016985 3300046515 Bacteria 3638
284 Ga0495620_0028901 3300046515 Bacteria 2571
285 Ga0495628_0056421 3300046516 Bacteria 3091
286 Ga0495637_0018958 3300046520 Bacteria 3186
287 Ga0495643_0017202 3300046522 Bacteria 4231
288 Ga0495643_0017796 3300046522 Bacteria 4145
289 Ga0495644_0018923 3300046523 Bacteria 2628
290 Ga0495648_0004181 3300046524 Bacteria 12410
291 Ga0495648_0005979 3300046524 Bacteria 10002
292 Ga0495648_0043592 3300046524 Bacteria 2810
293 Ga0495652_0027359 3300046529 Bacteria 5024
294 Ga0495654_0000069 3300046530 Bacteria 120853
295 Ga0495654_0016590 3300046530 Bacteria 3889
296 Ga0495640_0102063 3300046533 Bacteria 1882
297 Ga0495587_0001380 3300046536 Bacteria 16149
298 Ga0495609_0010008 3300046538 Bacteria 4567
299 Ga0495609_0018516 3300046538 Bacteria 3226
300 Ga0495597_0023556 3300046542 Bacteria 2847
301 Ga0495633_0000017 3300046558 Bacteria 249973
302 Ga0495667_0165376 3300046559 Bacteria 1422
303 Ga0495668_0017862 3300046616 Bacteria 4109
304 Ga0495634_0000830 3300046642 Bacteria 29781
305 Ga0495634_0115747 3300046642 Bacteria 1720
306 Ga0495611_0068315 3300046648 Bacteria 1622
307 Ga0495625_0009187 3300046660 Bacteria 8304
308 Ga0495625_0057999 3300046660 Bacteria 2751
309 Ga0495625_0059382 3300046660 Bacteria 2714
310 Ga0495625_0158507 3300046660 Bacteria 1517
311 Ga0495635_0000558 3300046663 Bacteria 23721
312 Ga0495635_0057845 3300046663 Bacteria 2667
313 Ga0495635_0112200 3300046663 Bacteria 1862
314 Ga0495588_0009910 3300046674 Bacteria 4415
315 Ga0495657_0013733 3300046675 Bacteria 5962
316 Ga0495657_0014539 3300046675 Bacteria 5774
317 Ga0495599_0092798 3300046678 Bacteria 1884
318 Ga0495646_0000540 3300046680 Bacteria 20365
319 Ga0495658_0071995 3300046683 Bacteria 2009
320 Ga0495613_0001710 3300046689 Bacteria 16714
321 Ga0495624_0016482 3300046690 Bacteria 4973
322 Ga0495671_0002279 3300046692 Bacteria 12197
323 Ga0495671_0012573 3300046692 Bacteria 4617
324 Ga0495649_0025880 3300046694 Bacteria 3267
325 Ga0495649_0046936 3300046694 Bacteria 2350
326 Ga0495649_0067934 3300046694 Bacteria 1912
327 Ga0495660_0000016 3300046810 Bacteria 321859
328 Ga0495660_0000046 3300046810 Bacteria 150057
329 Ga0495581_0016468 3300047315 Bacteria 4297
330 Ga0495581_0080760 3300047315 Bacteria 1882
331 Ga0495604_0006812 3300047317 Bacteria 9054
332 Ga0495636_0000508 3300047318 Bacteria 14307
333 Ga0495672_0000001 3300047320 Bacteria 1458820
334 Ga0495672_0000096 3300047320 Bacteria 143686
335 Ga0495672_0092023 3300047320 Bacteria 1663
336 Ga0495676_0024438 3300047321 Bacteria 5230
337 Ga0495676_0048061 3300047321 Bacteria 3443
338 Ga0495676_0082625 3300047321 Bacteria 2430
339 Ga0495680_0006988 3300047322 Bacteria 10408
340 Ga0495683_0025686 3300047323 Bacteria 3017
341 Ga0495683_0051056 3300047323 Bacteria 2069
342 Ga0495687_002174 3300047443 Bacteria 16321
343 Ga0495687_002993 3300047443 Bacteria 12768
344 Ga0495675_0020782 3300047444 Bacteria 4178
345 Ga0495675_0024142 3300047444 Bacteria 3876
346 Ga0495673_0000352 3300047469 Bacteria 57266
347 Ga0495681_0007136 3300047470 Bacteria 7198
348 Ga0495681_0035398 3300047470 Bacteria 2479
349 Ga0495681_0052656 3300047470 Bacteria 1908
350 Ga0495684_0025460 3300047471 Bacteria 4547
351 Ga0495686_0095037 3300047472 Bacteria 1805
352 Ga0495593_0004506 3300047673 Bacteria 8274
353 Ga0495602_0005106 3300048088 Bacteria 13753
354 Ga0495614_0008313 3300048089 Bacteria 4619
355 Ga0496100_0010304 3300048903 Bacteria 5289
356 Ga0496102_0020408 3300048905 Bacteria 5855
357 Ga0496102_0023924 3300048905 Bacteria 5429
358 Ga0496103_0018526 3300048906 Bacteria 4177
359 Ga0496104_0000869 3300048907 Bacteria 26029
360 Ga0496105_0013974 3300048908 Bacteria 6385
361 Ga0496105_0103453 3300048908 Bacteria 2352
362 Ga0496108_0188897 3300048911 Bacteria 1785
363 Ga0496109_0198258 3300048912 Bacteria 1887
364 Ga0496110_0106922 3300048913 Bacteria 2511
365 Ga0496112_0034536 3300048915 Bacteria 4922
366 Ga0496116_0000086 3300048919 Bacteria 217597
367 Ga0496116_0000162 3300048919 Bacteria 135528
368 Ga0496116_0000715 3300048919 Bacteria 42503
369 Ga0496116_0014976 3300048919 Bacteria 6153
370 Ga0496117_0000017 3300048920 Bacteria 490421
371 Ga0496117_0002870 3300048920 Bacteria 20944
372 Ga0496117_0017601 3300048920 Bacteria 5962
373 Ga0496118_0000018 3300048921 Bacteria 490421
374 Ga0496118_0001909 3300048921 Bacteria 29643
375 Ga0496118_0003468 3300048921 Bacteria 19799
376 Ga0496118_0006090 3300048921 Bacteria 13409
377 Ga0496118_0008283 3300048921 Bacteria 10774
378 Ga0496119_0000005 3300048922 Bacteria 529799
379 Ga0496119_0001168 3300048922 Bacteria 32871
380 Ga0496119_0004892 3300048922 Bacteria 13106
381 Ga0496119_0084299 3300048922 Bacteria 1822
382 Ga0496120_0000005 3300048923 Bacteria 529797
383 Ga0496120_0000010 3300048923 Bacteria 385791
384 Ga0496120_0000028 3300048923 Bacteria 230249
385 Ga0496120_0000917 3300048923 Bacteria 41032
386 Ga0496120_0015134 3300048923 Bacteria 5102
387 Ga0496121_0000011 3300048924 Bacteria 792193
388 Ga0496121_0019814 3300048924 Bacteria 6701
389 Ga0496122_0000007 3300048925 Bacteria 606493
390 Ga0496122_0000779 3300048925 Bacteria 61202
391 Ga0496122_0001506 3300048925 Bacteria 37139
392 Ga0496123_0000004 3300048926 Bacteria 777230
393 Ga0496123_0000185 3300048926 Bacteria 126153
394 Ga0496123_0001997 3300048926 Bacteria 26369
395 Ga0496123_0021922 3300048926 Bacteria 4945
396 Ga0496124_0000627 3300048927 Bacteria 58705
397 Ga0496124_0000749 3300048927 Bacteria 53271
398 Ga0496124_0005227 3300048927 Bacteria 14726
399 Ga0496124_0110581 3300048927 Bacteria 2212
400 Ga0496125_0000013 3300048928 Bacteria 628761
401 Ga0496126_0001673 3300048929 Bacteria 33280
402 Ga0496126_0020820 3300048929 Bacteria 6419
403 Ga0495678_001115 3300049459 Bacteria 22363
404 Ga0495682_0000001 3300049460 Bacteria 1559116
405 Ga0501032_0001566 3300049569 Bacteria 18242
406 Ga0501032_0036987 3300049569 Bacteria 3330
407 Ga0501032_0117289 3300049569 Bacteria 1760
408 Ga0501033_0021816 3300049570 Bacteria 4832
409 Ga0501034_0000075 3300049571 Bacteria 175296
410 Ga0501034_0001007 3300049571 Bacteria 40401
411 Ga0501034_0062104 3300049571 Bacteria 3751
412 Ga0501034_0069253 3300049571 Bacteria 3539
413 Ga0501036_0001470 3300049572 Bacteria 18124
414 Ga0501036_0024253 3300049572 Bacteria 5113
415 Ga0501037_0109783 3300049573 Bacteria 1987
416 Ga0501038_0005410 3300049574 Bacteria 11870
417 Ga0501038_0026377 3300049574 Bacteria 5175
418 Ga0501043_0002005 3300049579 Bacteria 17378
419 Ga0501043_0017867 3300049579 Bacteria 5561
420 Ga0501043_0073885 3300049579 Bacteria 2678
421 Ga0501047_0005814 3300049581 Bacteria 11611
422 Ga0501047_0007876 3300049581 Bacteria 10044
423 Ga0501047_0093061 3300049581 Bacteria 2893
424 Ga0501070_0011531 3300049586 Bacteria 7462
425 Ga0501074_0000798 3300049590 Bacteria 19915
426 Ga0501235_031133 3300049669 Bacteria 1204
427 Ga0501238_000145 3300049671 Bacteria 10904
428 Ga0501241_000517 3300049758 Bacteria 8323
429 Ga0501280_000196 3300049776 Bacteria 15178
430 Ga0501035_0004496 3300049822 Bacteria 13231
431 Ga0501035_0029841 3300049822 Bacteria 4974
432 Ga0501044_0002168 3300049823 Bacteria 22515
433 Ga0501044_0007814 3300049823 Bacteria 11757
434 Ga0501044_0055641 3300049823 Bacteria 4062
435 Ga0501044_0072797 3300049823 Bacteria 3493
436 nmdc:mga00v17_2596_c1 3300050491 Bacteria 9262
437 nmdc:mga04h51_2012_c1 3300050495 Bacteria 4758
438 Ga0495619_0030831 3300053085 Bacteria 3472
439 Ga0500640_004894 3300053095 Bacteria 4920
440 Ga0500560_002698 3300053107 Bacteria 3450
441 Ga0500621_000002 3300053126 Bacteria 849473
442 Ga0500658_0000024 3300053134 Bacteria 117952
443 Ga0500658_0023596 3300053134 Bacteria 2350
444 Ga0500559_0012033 3300053136 Bacteria 3686
445 Ga0500564_038108 3300053138 Bacteria 2216
446 Ga0500568_0038161 3300053139 Bacteria 1945
447 Ga0500620_011558 3300053155 Bacteria 2372
448 Ga0500620_076056 3300053155 Bacteria 1159
449 Ga0500622_0000249 3300053156 Bacteria 54675
450 Ga0500661_004354 3300055283 Unclassified 2652
451 Ga0466962_0001800 3300061719 Bacteria 10079
452 Ga0466962_0028224 3300061719 Bacteria 2689
453 2537899477 2537561592 Bacteria 4348607
454 2547407001 2547132111 Bacteria 8013147
455 2554258417 2554235005 Bacteria 6457341
456 2585309261 2582581313 Bacteria 10042643
457 2585319756 2582581314 Bacteria 11452267
458 2585829683 2585427591 Bacteria 5482980
459 2585834230 2585427592 Bacteria 5370892
460 2599928124 2599185299 Bacteria 4854625
461 2616697641 2616644814 Bacteria 11555299
462 2643777263 2643221551 Bacteria 3750538
463 2643795711 2643221555 Bacteria 3749717
464 2644008391 2643221600 Bacteria 5530138
465 2644263273 2643221647 Bacteria 10741251
466 2644436578 2643221678 Bacteria 9540101
467 2644455716 2643221681 Bacteria 3707866
468 2644625586 2643221714 Bacteria 9015452
469 2644640168 2643221716 Bacteria 4986332
470 2650900220 2648501693 Bacteria 5069560
471 2671108938 2667528173 Bacteria 5375747
472 2686354459 2684622997 Bacteria 4624240
473 2691512400 2690315906 Bacteria 4517044
474 2738855696 2738541302 Bacteria 5944758
475 2739590587 2739367651 Bacteria 6359826
476 2740001002 2739367857 Bacteria 5433684
477 2740005818 2739367858 Bacteria 5432813
478 2753267976 2751185782 Bacteria 11227053
479 2784588035 2784132148 Bacteria 8627943
480 2785368806 2784746768 Bacteria 10036182
481 2804845035 2802429296 Bacteria 7227771
482 2808841471 2808606359 Bacteria 9866990
483 2808850828 2808606360 Bacteria 4404006
484 2808893906 2808606370 Bacteria 4942454
485 2808920036 2808606375 Bacteria 9466072
486 2809124253 2808606414 Bacteria 4917181
487 2809231635 2808606448 Bacteria 8656184
488 2811848421 2808606982 Bacteria 7791042
489 2812358776 2811994879 Bacteria 9313447
490 2812481070 2811994917 Bacteria 7761064
491 2819549986 2818991437 Bacteria 5805520
492 2819577502 2818991442 Bacteria 8318214
493 2819693499 2818991463 Bacteria 7948711
494 2842724892 2842722452 Bacteria 6263924
495 2842904697 2842903701 Bacteria 6986368
496 2842913087 2842909656 Bacteria 6185908
497 2844529947 2844528606 Bacteria 4733806
498 2844851136 2844849076 Bacteria 4091819
499 2846544567 2846540461 Bacteria 5471451
500 2847801312 2847797336 Bacteria 5176640
501 2849284629 2849281842 Bacteria 6065644
502 2852104518 2852103415 Bacteria 5193810
503 2852641935 2852635781 Bacteria 8251373
504 2856747676 2856741275 Bacteria 8096094
505 2857614660 2857613821 Bacteria 4917088
506 2857618266 2857618242 Bacteria 5635925
507 2857743087 2857740372 Bacteria 4782044
508 2862184737 2862178590 Bacteria 8583590
509 2862287907 2862281513 Bacteria 9621493
510 2862387544 2862382967 Bacteria 10317375
511 2862511533 2862507626 Bacteria 9425308
512 2862579818 2862574272 Bacteria 10567477
513 2865018786 2865014394 Bacteria 4764573
514 2867302533 2867302475 Bacteria 7087181
515 2867314567 2867312974 Bacteria 7058875
516 2867323393 2867319477 Bacteria 7069771
517 2867434895 2867428634 Bacteria 9590268
518 2867479098 2867475112 Bacteria 6909112
519 2877681706 2877676314 Bacteria 9512378
520 2881611197 2881609920 Bacteria 4405319
521 2884792540 2884791551 Bacteria 8511252
522 2891565219 2891562705 Bacteria 8039471
523 2904419953 2904419702 Bacteria 5166287
524 2904449366 2904445276 Bacteria 5310396
525 2904477365 2904474040 Bacteria 5504324
526 2904497352 2904497146 Bacteria 4731781
527 2904506389 2904504865 Bacteria 5152820
528 2904556748 2904555929 Bacteria 5218588
529 2904780003 2904776348 Bacteria 4658726
530 2910810399 2910809715 Bacteria 4982797
531 2912720671 2912715099 Bacteria 9460473
532 2912724832 2912723979 Bacteria 8557534
533 2919038446 2919034639 Bacteria 4763403
534 2919063581 2919059106 Bacteria 4991624
535 2919153533 2919150387 Bacteria 5500879
536 2919195475 2919191525 Bacteria 5765973
537 2919391995 2919391150 Bacteria 4884741
538 2919473524 2919468124 Bacteria 9133025
539 2919539990 2919538618 Bacteria 4677069
540 2927144159 2927143783 Bacteria 5504251
541 2929242594 2929239360 Bacteria 7745570
542 2929922511 2929921140 Bacteria 8649150
543 2932428850 2932426870 Bacteria 4547726
544 2933421787 2933418574 Bacteria 4476724
545 2939647763 2939647034 Bacteria 4681660
546 2939678198 2939674588 Bacteria 4844420
547 2945916408 2945916053 Bacteria 4555517
548 2945923455 2945920336 Bacteria 4501603
549 2945956151 2945951305 Bacteria 4918162
550 2945956754 2945956166 Bacteria 5110334
551 2946024471 2946024296 Bacteria 3508095
552 2946040821 2946037020 Bacteria 4900426
553 2946060208 2946059875 Bacteria 4386623
554 2946067101 2946064051 Bacteria 8957905
555 2946075393 2946072368 Bacteria 8999607
556 2947230141 2947224130 Bacteria 9938529
557 2954002064 2953998280 Bacteria 4812144
558 2954018717 2954016120 Bacteria 6446024
559 2954386854 2954380949 Bacteria 10050426
560 2954697674 2954691527 Bacteria 10720516
561 2954704542 2954701450 Bacteria 10834262
562 2954716809 2954711539 Bacteria 10867210
563 2954726757 2954721474 Bacteria 10456478
564 2954735039 2954731030 Bacteria 10243860
565 2954745679 2954740390 Bacteria 10229294
566 2954753910 2954749733 Bacteria 10366972
567 2954764653 2954759201 Bacteria 9358192
568 2974304372 2974302888 Bacteria 4369871
569 2978975181 2978975091 Bacteria 4704313
570 2984498143 2984494565 Bacteria 5000175
571 2984576681 2984576629 Bacteria 4248407
572 2990065585 2990059506 Bacteria 9321252
573 2990258445 2990256926 Bacteria 4252839
574 2990265159 2990261002 Bacteria 4919493
575 2997454001 2997451912 Bacteria 8492419
576 3006397814 3006393351 Bacteria 6615579
577 3006496333 3006493962 Bacteria 8825450
578 8003156388 8003151029 Bacteria 8187759
579 8003857624 8003856774 Bacteria 7675274
580 8008559765 8008558824 Bacteria 10610750
581 8008579381 8008574985 Bacteria 7815457
582 8023631041 8023623736 Bacteria 8593882
583 8025418999 8025413630 Bacteria 7014048
584 8033686913 8033684223 Bacteria 6906479
585 8054111320 8054107350 Bacteria 5022511
586 8054167223 8054160619 Bacteria 7783213
587 8055414110 8055412473 Bacteria 6257500
588 8055694573 8055693939 Bacteria 4772047
589 8056830242 8056829672 Bacteria 9045328
590 Ga0307406_10045849
591 JGI24739J22299_10000375
592 JGI25162J39368_1000009
593 JGI25162J39368_1000258
594 JGI25154J39366_1000021
595 JGI25163J39215_1000038
596 JGI25164J39214_1000002
597 JGI25152J39213_1000045
598 rootH2_10045220
599 rootL2_10027395
600 rootH1_10013607
601 rootH1_10051261
602 JGI25160J50197_1013124
603 JGI25160J50197_1016147
604 Ga0055538_1000015
605 Ga0055539_1000009
606 Ga0055533_1000012
607 Ga0055525_1000014
608 Ga0055535_1003778
609 Ga0055542_1003577
610 Ga0055536_1000001
611 Ga0055530_10005300
612 Ga0055531_10000138
613 Ga0055541_1000006
614 Ga0058692_1000038
615 Ga0058692_1000103
616 Ga0058692_1003971
617 Ga0065165_1001877
618 Ga0065165_1004984
619 Ga0065714_10006281
620 Ga0065714_10064459
621 Ga0065704_10000548
622 Ga0070668_100002334
623 Ga0070668_100031833
624 Ga0068860_100096725
625 Ga0068862_100150931
626 Ga0081455_10017897
627 Ga0081540_1018037
628 Ga0075367_10000578
629 Ga0105251_10003091
630 Ga0105251_10046776
631 Ga0105251_10079361
632 Ga0105244_10000047
633 Ga0105244_10000319
634 Ga0105244_10001080
635 Ga0105244_10014383
636 Ga0105250_10000007
637 Ga0105250_10022598
638 Ga0105243_10002478
639 Ga0105237_10004307
640 Ga0105237_10004581
641 Ga0105238_10172150
642 Ga0105239_10000478
643 Ga0105239_10276013
644 Ga0105246_10003995
645 Ga0105246_10016172
646 Ga0105246_10033667
647 Ga0105246_10129955
648 Ga0157373_10001546
649 Ga0157371_10000008
650 Ga0157371_10000021
651 Ga0157371_10000766
652 Ga0157370_10000075
653 Ga0157370_10000276
654 Ga0157370_10002996
655 Ga0157370_10023681
656 Ga0157369_10000008
657 Ga0157369_10023989
658 Ga0163162_10000502
659 Ga0163162_10213866
660 Ga0163162_10223642
661 Ga0157372_10003482
662 Ga0157372_10008915
663 Ga0157372_10017301
664 Ga0157372_10053107
665 Ga0182008_10001691
666 Ga0182006_1000408
667 Ga0182006_1001891
668 Ga0182006_1055550
669 Ga0182007_10000003
670 Ga0182005_1000153
671 Ga0183373_1001
672 Ga0183367_1006
673 Ga0163161_10000164
674 Ga0163161_10000219
675 Ga0163161_10013759
676 Ga0163161_10128046
677 Ga0209760_100040
678 Ga0209784_100001
679 Ga0209566_100001
680 Ga0209674_100002
681 Ga0209563_100002
682 Ga0207427_100020
683 Ga0209437_100001
684 Ga0209437_100032
685 Ga0209437_100361
686 Ga0209258_100145
687 Ga0209646_1000050
688 Ga0209026_1000240
689 Ga0209677_100002
690 Ga0209148_1000177
691 Ga0209129_1000068
692 Ga0209233_1010218
693 Ga0209676_1000008
694 Ga0209025_1000045
695 Ga0209758_1004595
696 Ga0209758_1025897
697 Ga0209050_1000045
698 Ga0207426_1000073
699 Ga0207426_1000293
700 Ga0207426_1002867
701 Ga0207426_1016904
702 Ga0209051_1004119
703 Ga0209051_1009516
704 Ga0209257_1000001
705 Ga0207697_10002451
706 Ga0207696_1000029
707 Ga0207696_1000498
708 Ga0207696_1001476
709 Ga0207655_1000030
710 Ga0207655_1001287
711 Ga0207655_1001970
712 Ga0207655_1016409
713 Ga0207713_1000011
714 Ga0207713_1004736
715 Ga0207713_1011079
716 Ga0207671_10005027
717 Ga0207671_10006628
718 Ga0207694_10198630
719 Ga0207709_10016870
720 Ga0207709_10064625
721 Ga0207691_10177831
722 Ga0207667_10071873
723 Ga0209371_1000034
724 Ga0209371_1000093
725 Ga0209371_1002919
726 Ga0209371_1002968
727 Ga0207428_10036427
728 Ga0268265_10083626
729 Ga0268264_10037949
730 Ga0307517_10012094
731 Ga0307515_10006210
732 Ga0268256_1000043
733 Ga0268256_1000081
734 Ga0268256_1000752
735 Ga0268256_1002629
736 Ga0268256_1027661
737 Ga0307511_10000477
738 Ga0307512_10002642
739 Ga0316177_1045554
740 Ga0316176_1220125
741 Ga0316181_1278021
742 Ga0307513_10029380
743 Ga0307513_10121885
744 Ga0307509_10008150
745 Ga0307509_10104489
746 Ga0307408_100003548
747 Ga0307408_100008343
748 Ga0307408_100025838
749 Ga0307408_100028204
750 Ga0307408_100068269
751 Ga0307408_100185848
752 Ga0307508_10006664
753 Ga0307508_10053295
754 Ga0307514_10001878
755 Ga0307514_10128783
756 Ga0307516_10004046
757 Ga0307516_10206490
758 Ga0307405_10000032
759 Ga0307405_10035535
760 Ga0307405_10107398
761 Ga0307413_10000107
762 Ga0307410_10002372
763 Ga0307410_10024906
764 Ga0307410_10075191
765 Ga0307410_10212405
766 Ga0307406_10000003
767 Ga0307406_10181130
768 Ga0307407_10008580
769 Ga0307407_10025963
770 Ga0307412_10004093
771 Ga0307412_10012753
772 Ga0307412_10063452
773 Ga0307412_10075047
774 Ga0307409_100014800
775 Ga0307409_100016645
776 Ga0307409_100206287
777 Ga0307416_100021725
778 Ga0307416_100048321
779 Ga0307416_100065107
780 Ga0307414_10000001
781 Ga0307414_10034930
782 Ga0307414_10149835
783 Ga0307411_10000001
784 Ga0307415_100030434
785 Ga0307507_10031590
786 Ga0307507_10066512
787 Ga0307507_10157204
788 Ga0307510_10024274
789 Ga0395900_0068666
790 Ga0395900_0073730
791 Ga0395900_0264439
792 Ga0395898_0099194
793 Ga0395898_0099820
794 Ga0395901_0086921
795 Ga0439438_003563
796 Ga0439439_0008890
797 Ga0439447_003550
798 Ga0439447_017741
799 Ga0439466_0002667
800 Ga0451837_0044792
801 Ga0451853_0467392
802 Ga0451853_1828395
803 Ga0439433_0000053
804 Ga0439433_0002239
805 Ga0439433_0004488
806 Ga0439433_0006640
807 Ga0439442_000693
808 Ga0439442_011592
809 Ga0439432_005694
810 Ga0439432_025935
811 Ga0439449_0003710
812 Ga0439449_0010144
813 Ga0439449_0019001
814 Ga0439452_000004
815 Ga0439457_000197
816 Ga0439462_0006281
817 Ga0439463_012084
818 Ga0450898_003379
819 Ga0450907_000088
820 Ga0439434_0000246
821 Ga0466972_0004414
822 Ga0466965_0000319
823 Ga0466966_0003509
824 Ga0466961_0003370
825 Ga0466963_0000410
826 Ga0466963_0002165
827 Ga0466964_0002518
828 Ga0466971_0000916
829 Ga0466970_0001045
830 Ga0466957_0001204
831 Ga0466959_0005690
832 Ga0466958_0005059
833 Ga0466967_0002249
834 Ga0466967_0252189
835 Ga0466967_0300016
836 Ga0495627_016036
837 Ga0495592_0001976
838 Ga0495592_0026544
839 Ga0495603_0018588
840 Ga0495603_0025560
841 Ga0495603_0130224
842 Ga0495591_000318
843 Ga0495629_0009575
844 Ga0495629_0041470
845 Ga0495629_0043656
846 Ga0495629_0074193
847 Ga0495638_0026710
848 Ga0495651_0056599
849 Ga0495650_0000026
850 Ga0495650_0000148
851 Ga0495580_0027812
852 Ga0495582_0020680
853 Ga0495605_0040680
854 Ga0495639_0018843
855 Ga0495662_0000971
856 Ga0495662_0010134
857 Ga0495664_0000582
858 Ga0495584_0015385
859 Ga0495585_0029402
860 Ga0495594_0015368
861 Ga0495607_0012103
862 Ga0495607_0062225
863 Ga0495606_0001190
864 Ga0495606_0027669
865 Ga0495606_0048779
866 Ga0495610_0000066
867 Ga0495610_0000150
868 Ga0495610_0062455
869 Ga0495616_0036265
870 Ga0495618_0021816
871 Ga0495618_0049327
872 Ga0495620_0016985
873 Ga0495620_0028901
874 Ga0495628_0056421
875 Ga0495637_0018958
876 Ga0495643_0017202
877 Ga0495643_0017796
878 Ga0495644_0018923
879 Ga0495648_0004181
880 Ga0495648_0005979
881 Ga0495648_0043592
882 Ga0495652_0027359
883 Ga0495654_0000069
884 Ga0495654_0016590
885 Ga0495640_0102063
886 Ga0495587_0001380
887 Ga0495609_0010008
888 Ga0495609_0018516
889 Ga0495597_0023556
890 Ga0495633_0000017
891 Ga0495667_0165376
892 Ga0495668_0017862
893 Ga0495634_0000830
894 Ga0495634_0115747
895 Ga0495611_0068315
896 Ga0495625_0009187
897 Ga0495625_0057999
898 Ga0495625_0059382
899 Ga0495625_0158507
900 Ga0495635_0000558
901 Ga0495635_0057845
902 Ga0495635_0112200
903 Ga0495588_0009910
904 Ga0495657_0013733
905 Ga0495657_0014539
906 Ga0495599_0092798
907 Ga0495646_0000540
908 Ga0495658_0071995
909 Ga0495613_0001710
910 Ga0495624_0016482
911 Ga0495671_0002279
912 Ga0495671_0012573
913 Ga0495649_0025880
914 Ga0495649_0046936
915 Ga0495649_0067934
916 Ga0495660_0000016
917 Ga0495660_0000046
918 Ga0495581_0016468
919 Ga0495581_0080760
920 Ga0495604_0006812
921 Ga0495636_0000508
922 Ga0495672_0000001
923 Ga0495672_0000096
924 Ga0495672_0092023
925 Ga0495676_0024438
926 Ga0495676_0048061
927 Ga0495676_0082625
928 Ga0495680_0006988
929 Ga0495683_0025686
930 Ga0495683_0051056
931 Ga0495687_002174
932 Ga0495687_002993
933 Ga0495675_0020782
934 Ga0495675_0024142
935 Ga0495673_0000352
936 Ga0495681_0007136
937 Ga0495681_0035398
938 Ga0495681_0052656
939 Ga0495684_0025460
940 Ga0495686_0095037
941 Ga0495593_0004506
942 Ga0495602_0005106
943 Ga0495614_0008313
944 Ga0496100_0010304
945 Ga0496102_0020408
946 Ga0496102_0023924
947 Ga0496103_0018526
948 Ga0496104_0000869
949 Ga0496105_0013974
950 Ga0496105_0103453
951 Ga0496108_0188897
952 Ga0496109_0198258
953 Ga0496110_0106922
954 Ga0496112_0034536
955 Ga0496116_0000086
956 Ga0496116_0000162
957 Ga0496116_0000715
958 Ga0496116_0014976
959 Ga0496117_0000017
960 Ga0496117_0002870
961 Ga0496117_0017601
962 Ga0496118_0000018
963 Ga0496118_0001909
964 Ga0496118_0003468
965 Ga0496118_0006090
966 Ga0496118_0008283
967 Ga0496119_0000005
968 Ga0496119_0001168
969 Ga0496119_0004892
970 Ga0496119_0084299
971 Ga0496120_0000005
972 Ga0496120_0000010
973 Ga0496120_0000028
974 Ga0496120_0000917
975 Ga0496120_0015134
976 Ga0496121_0000011
977 Ga0496121_0019814
978 Ga0496122_0000007
979 Ga0496122_0000779
980 Ga0496122_0001506
981 Ga0496123_0000004
982 Ga0496123_0000185
983 Ga0496123_0001997
984 Ga0496123_0021922
985 Ga0496124_0000627
986 Ga0496124_0000749
987 Ga0496124_0005227
988 Ga0496124_0110581
989 Ga0496125_0000013
990 Ga0496126_0001673
991 Ga0496126_0020820
992 Ga0495678_001115
993 Ga0495682_0000001
994 Ga0501032_0001566
995 Ga0501032_0036987
996 Ga0501032_0117289
997 Ga0501033_0021816
998 Ga0501034_0000075
999 Ga0501034_0001007
1000 Ga0501034_0062104
1001 Ga0501034_0069253
1002 Ga0501036_0001470
1003 Ga0501036_0024253
1004 Ga0501037_0109783
1005 Ga0501038_0005410
1006 Ga0501038_0026377
1007 Ga0501043_0002005
1008 Ga0501043_0017867
1009 Ga0501043_0073885
1010 Ga0501047_0005814
1011 Ga0501047_0007876
1012 Ga0501047_0093061
1013 Ga0501070_0011531
1014 Ga0501074_0000798
1015 Ga0501235_031133
1016 Ga0501238_000145
1017 Ga0501241_000517
1018 Ga0501280_000196
1019 Ga0501035_0004496
1020 Ga0501035_0029841
1021 Ga0501044_0002168
1022 Ga0501044_0007814
1023 Ga0501044_0055641
1024 Ga0501044_0072797
1025 nmdc:mga00v17_2596_c1
1026 nmdc:mga04h51_2012_c1
1027 Ga0495619_0030831
1028 Ga0500640_004894
1029 Ga0500560_002698
1030 Ga0500621_000002
1031 Ga0500658_0000024
1032 Ga0500658_0023596
1033 Ga0500559_0012033
1034 Ga0500564_038108
1035 Ga0500568_0038161
1036 Ga0500620_011558
1037 Ga0500620_076056
1038 Ga0500622_0000249
1039 Ga0500661_004354
1040 Ga0466962_0001800
1041 Ga0466962_0028224
1042 2537899477
1043 2547407001
1044 2554258417
1045 2585309261
1046 2585319756
1047 2585829683
1048 2585834230
1049 2599928124
1050 2616697641
1051 2643777263
1052 2643795711
1053 2644008391
1054 2644263273
1055 2644436578
1056 2644455716
1057 2644625586
1058 2644640168
1059 2650900220
1060 2671108938
1061 2686354459
1062 2691512400
1063 2738855696
1064 2739590587
1065 2740001002
1066 2740005818
1067 2753267976
1068 2784588035
1069 2785368806
1070 2804845035
1071 2808841471
1072 2808850828
1073 2808893906
1074 2808920036
1075 2809124253
1076 2809231635
1077 2811848421
1078 2812358776
1079 2812481070
1080 2819549986
1081 2819577502
1082 2819693499
1083 2842724892
1084 2842904697
1085 2842913087
1086 2844529947
1087 2844851136
1088 2846544567
1089 2847801312
1090 2849284629
1091 2852104518
1092 2852641935
1093 2856747676
1094 2857614660
1095 2857618266
1096 2857743087
1097 2862184737
1098 2862287907
1099 2862387544
1100 2862511533
1101 2862579818
1102 2865018786
1103 2867302533
1104 2867314567
1105 2867323393
1106 2867434895
1107 2867479098
1108 2877681706
1109 2881611197
1110 2884792540
1111 2891565219
1112 2904419953
1113 2904449366
1114 2904477365
1115 2904497352
1116 2904506389
1117 2904556748
1118 2904780003
1119 2910810399
1120 2912720671
1121 2912724832
1122 2919038446
1123 2919063581
1124 2919153533
1125 2919195475
1126 2919391995
1127 2919473524
1128 2919539990
1129 2927144159
1130 2929242594
1131 2929922511
1132 2932428850
1133 2933421787
1134 2939647763
1135 2939678198
1136 2945916408
1137 2945923455
1138 2945956151
1139 2945956754
1140 2946024471
1141 2946040821
1142 2946060208
1143 2946067101
1144 2946075393
1145 2947230141
1146 2954002064
1147 2954018717
1148 2954386854
1149 2954697674
1150 2954704542
1151 2954716809
1152 2954726757
1153 2954735039
1154 2954745679
1155 2954753910
1156 2954764653
1157 2974304372
1158 2978975181
1159 2984498143
1160 2984576681
1161 2990065585
1162 2990258445
1163 2990265159
1164 2997454001
1165 3006397814
1166 3006496333
1167 8003156388
1168 8003857624
1169 8008559765
1170 8008579381
1171 8023631041
1172 8025418999
1173 8033686913
1174 8054111320
1175 8054167223
1176 8055414110
1177 8055694573
1178 8056830242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13434

Lys_Orn_oxgnase

L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase

16

353

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o8p-assembly1.cif.gz_B the crystal structure of dfoa bound to fad, the desferrioxamine biosynthetic pathway cadaverine monooxygenase from the fire blight disease pathogen erwinia amylovora 0.9615 3 430
7us3-assembly1.cif.gz_B structure of putrescine n-hydroxylase involved complexed with nadp+ 0.9595 3 429
5o8p-assembly1.cif.gz_B the crystal structure of dfoa bound to fad, the desferrioxamine biosynthetic pathway cadaverine monooxygenase from the fire blight disease pathogen erwinia amylovora 0.9593 3 430
6xbb-assembly1.cif.gz_C crystal structure of streptomyces sviceus ssdesb in complex with nadp+ 0.9575 4 426
6xbb-assembly1.cif.gz_C crystal structure of streptomyces sviceus ssdesb in complex with nadp+ 0.9553 4 426
ID Description Score Start End Superfamily
4tlzA00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8896 4 410 3.50.50.60
af_A0A0G2K6D5_23_292_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.8802 117 151 3.30.830.10
4tlzA00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8714 4 410 3.50.50.60
3s61B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8627 4 409 3.50.50.60
5ckuA00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8615 1 409 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7X2SZ00-F1-model_v4 SidA/IucD/PvdA family monooxygenase 0.968 141 309 GO:0004497
AF-A0A7X9EMA0-F1-model_v4 deleted 0.9649 1 371
AF-A0A1W6B8H9-F1-model_v4 Alcaligin biosynthesis protein 0.9629 1 430 GO:0016491
AF-E5B9Q8-F1-model_v4 L-lysine 6-monooxygenase involved in desferrioxamine biosynthesis (EC 1.14.13.59) 0.9614 1 430 GO:0047091
AF-A0A1A9HXP3-F1-model_v4 Alcaligin biosynthesis protein 0.9612 2 428 GO:0016491

Map