F466962

General Info

Members Datasets Scaffolds Average Seq Length
590 252 1180 314

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10169715|Ga0105249_101697152
Length 327
Sequence MSSPVKNPTPAPATPKSRIVFDNTSKFYGQVLGVNRVSLSIPPGITGLVGPNGSGKTTLMNLLTGLLRPTRGTVDVLGIPTDRPEALFRVLGYATQYDAFPRGLTGYELIYSFLRIYGFEHAEAAARTGKALERVNLTEAAGRKVAAYSKGMRQRIKLAQAIAHEPRVLVLDEPLNGLDPMARSEVIGLFREFADAGRHVIVSSHILHEVDLISDQVVLLNGGYVVAEGAIAGVRDEMEEEHPVQVRIRCDRPSLLAARVFAEDGAVEARLDDDGQGILVRTRNADRFHLLLNKIVMEDGVAIDAVVPADSDVRSVYQYLIGGEGKS

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 0
Rhizoplane 0.51
Rhizosphere 97.29
Stem 0
Stem Tuber 0
Unclassified 9.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10169715 3300009553 Bacteria 2115
2 Ga0065704_10172793 3300005289 Bacteria 1281
3 Ga0065707_10129220 3300005295 Bacteria 1951
4 Ga0070683_100000944 3300005329 Bacteria 21627
5 Ga0070683_100001777 3300005329 Bacteria 16792
6 Ga0070683_100023325 3300005329 Bacteria 5534
7 Ga0070683_100055128 3300005329 Bacteria 3688
8 Ga0070670_100045892 3300005331 Bacteria 3756
9 Ga0070666_10019281 3300005335 Bacteria 4400
10 Ga0068868_100000476 3300005338 Bacteria 26629
11 Ga0070660_100121318 3300005339 Bacteria 2086
12 Ga0070689_100028952 3300005340 Bacteria 4189
13 Ga0070691_10002286 3300005341 Bacteria 8487
14 Ga0070661_100094147 3300005344 Bacteria 2220
15 Ga0070668_100220827 3300005347 Bacteria 1563
16 Ga0070669_100000006 3300005353 Bacteria 268982
17 Ga0070669_100023551 3300005353 Bacteria 4408
18 Ga0070669_100116165 3300005353 Bacteria 2036
19 Ga0070675_100000232 3300005354 Bacteria 35813
20 Ga0070675_100020829 3300005354 Bacteria 5233
21 Ga0070671_100021731 3300005355 Bacteria 5241
22 Ga0070671_100041998 3300005355 Bacteria 3801
23 Ga0070671_100306270 3300005355 Bacteria 1353
24 Ga0070674_100019822 3300005356 Bacteria 4281
25 Ga0070673_100003259 3300005364 Bacteria 10069
26 Ga0070673_100017408 3300005364 Bacteria 5109
27 Ga0070673_100044869 3300005364 Bacteria 3425
28 Ga0070673_100196175 3300005364 Bacteria 1737
29 Ga0070688_100022679 3300005365 Bacteria 3684
30 Ga0070667_100016966 3300005367 Bacteria 6028
31 Ga0070667_100021308 3300005367 Bacteria 5384
32 Ga0070667_100398714 3300005367 Bacteria 1252
33 Ga0070703_10000937 3300005406 Bacteria 9293
34 Ga0070709_10000029 3300005434 Bacteria 119772
35 Ga0070714_100126801 3300005435 Bacteria 2277
36 Ga0070714_100585867 3300005435 Bacteria 1070
37 Ga0070713_100000413 3300005436 Bacteria 27428
38 Ga0070713_100045250 3300005436 Bacteria 3605
39 Ga0070713_100046629 3300005436 Bacteria 3557
40 Ga0070710_10028073 3300005437 Unclassified 3007
41 Ga0070701_10107406 3300005438 Unclassified 1555
42 Ga0070711_100000027 3300005439 Bacteria 108952
43 Ga0070711_100088689 3300005439 Unclassified 2223
44 Ga0070711_100145102 3300005439 Bacteria 1784
45 Ga0070705_100000221 3300005440 Bacteria 33830
46 Ga0070694_100009684 3300005444 Bacteria 5917
47 Ga0070694_100090292 3300005444 Bacteria 2148
48 Ga0070694_100349029 3300005444 Bacteria 1146
49 Ga0070708_100022211 3300005445 Bacteria 5379
50 Ga0070708_100030146 3300005445 Bacteria 4687
51 Ga0070708_100106479 3300005445 Bacteria 2574
52 Ga0070678_100148909 3300005456 Unclassified 1883
53 Ga0070681_10001138 3300005458 Bacteria 22876
54 Ga0068867_100041415 3300005459 Bacteria 3366
55 Ga0068867_100053858 3300005459 Bacteria 2971
56 Ga0068867_100106341 3300005459 Unclassified 2149
57 Ga0068867_100281886 3300005459 Bacteria 1363
58 Ga0070685_10011334 3300005466 Bacteria 4669
59 Ga0070706_100000208 3300005467 Bacteria 72971
60 Ga0070706_100025236 3300005467 Bacteria 5471
61 Ga0070706_100148801 3300005467 Bacteria 2186
62 Ga0070707_100045880 3300005468 Bacteria 4182
63 Ga0070707_100541900 3300005468 Bacteria 1126
64 Ga0070699_100000029 3300005518 Bacteria 151185
65 Ga0070699_100296601 3300005518 Bacteria 1450
66 Ga0070679_100001167 3300005530 Bacteria 23012
67 Ga0070679_100319225 3300005530 Bacteria 1503
68 Ga0070684_100004866 3300005535 Bacteria 10258
69 Ga0070684_100036275 3300005535 Bacteria 4225
70 Ga0070684_100058093 3300005535 Bacteria 3380
71 Ga0070684_100072068 3300005535 Unclassified 3041
72 Ga0068853_100034323 3300005539 Bacteria 4306
73 Ga0068853_100433746 3300005539 Bacteria 1234
74 Ga0070672_100004478 3300005543 Bacteria 9152
75 Ga0070672_100032800 3300005543 Bacteria 3924
76 Ga0070672_100155943 3300005543 Unclassified 1891
77 Ga0070686_100007254 3300005544 Bacteria 6176
78 Ga0070686_100056532 3300005544 Bacteria 2517
79 Ga0070686_100090915 3300005544 Bacteria 2041
80 Ga0070695_100019093 3300005545 Bacteria 4170
81 Ga0070696_100000362 3300005546 Bacteria 27732
82 Ga0070696_100036675 3300005546 Bacteria 3381
83 Ga0070696_100217979 3300005546 Unclassified 1431
84 Ga0070693_100002949 3300005547 Bacteria 7870
85 Ga0070665_100000243 3300005548 Bacteria 90522
86 Ga0070704_100009781 3300005549 Bacteria 5812
87 Ga0070704_100092067 3300005549 Bacteria 2262
88 Ga0070704_100128133 3300005549 Bacteria 1962
89 Ga0070704_100170643 3300005549 Bacteria 1730
90 Ga0068855_100007475 3300005563 Bacteria 13230
91 Ga0068855_100013279 3300005563 Bacteria 9932
92 Ga0068855_100091750 3300005563 Unclassified 3503
93 Ga0068855_100165655 3300005563 Bacteria 2506
94 Ga0068855_100278951 3300005563 Unclassified 1856
95 Ga0070664_100000204 3300005564 Bacteria 42424
96 Ga0068857_100001209 3300005577 Bacteria 20133
97 Ga0068857_100091735 3300005577 Bacteria 2719
98 Ga0068857_100277809 3300005577 Bacteria 1540
99 Ga0068857_100297767 3300005577 Bacteria 1487
100 Ga0068854_100066640 3300005578 Unclassified 2621
101 Ga0068856_100001334 3300005614 Bacteria 25988
102 Ga0068852_100035625 3300005616 Bacteria 4154
103 Ga0068859_100013583 3300005617 Bacteria 8163
104 Ga0068859_100027194 3300005617 Bacteria 5738
105 Ga0068859_100049575 3300005617 Bacteria 4217
106 Ga0068859_100148694 3300005617 Unclassified 2418
107 Ga0068859_100193471 3300005617 Bacteria 2118
108 Ga0068859_100306994 3300005617 Bacteria 1680
109 Ga0068864_100000738 3300005618 Bacteria 27404
110 Ga0068864_100021616 3300005618 Bacteria 5388
111 Ga0068864_100186907 3300005618 Bacteria 1897
112 Ga0068864_100283606 3300005618 Bacteria 1547
113 Ga0068864_100351775 3300005618 Bacteria 1390
114 Ga0068861_100005078 3300005719 Bacteria 8877
115 Ga0068870_10030695 3300005840 Bacteria 2718
116 Ga0068863_100002245 3300005841 Bacteria 19182
117 Ga0068863_100010819 3300005841 Bacteria 8846
118 Ga0068863_100038929 3300005841 Bacteria 4524
119 Ga0068863_100184459 3300005841 Bacteria 2003
120 Ga0068858_100004232 3300005842 Bacteria 14127
121 Ga0068858_100076564 3300005842 Bacteria 3107
122 Ga0068858_100113081 3300005842 Bacteria 2535
123 Ga0068858_100165417 3300005842 Bacteria 2084
124 Ga0068860_100002569 3300005843 Bacteria 19000
125 Ga0068860_100007134 3300005843 Bacteria 11182
126 Ga0068860_100025653 3300005843 Bacteria 5685
127 Ga0068860_100129280 3300005843 Bacteria 2423
128 Ga0068860_100232199 3300005843 Bacteria 1793
129 Ga0068862_100008716 3300005844 Bacteria 8394
130 Ga0068862_100011595 3300005844 Bacteria 7272
131 Ga0068862_100025939 3300005844 Bacteria 4924
132 Ga0068862_100050568 3300005844 Bacteria 3553
133 Ga0070717_10003412 3300006028 Bacteria 11362
134 Ga0070717_10010368 3300006028 Bacteria 7033
135 Ga0075365_10016699 3300006038 Bacteria 4473
136 Ga0075368_10037287 3300006042 Bacteria 1901
137 Ga0075364_10019845 3300006051 Bacteria 4224
138 Ga0075364_10022064 3300006051 Bacteria 4017
139 Ga0070715_10000013 3300006163 Bacteria 155405
140 Ga0070716_100000018 3300006173 Bacteria 84686
141 Ga0070716_100003790 3300006173 Bacteria 7169
142 Ga0070716_100026042 3300006173 Unclassified 3128
143 Ga0070712_100000893 3300006175 Bacteria 17874
144 Ga0070712_100001442 3300006175 Bacteria 14518
145 Ga0070712_100091771 3300006175 Bacteria 2226
146 Ga0075362_10017713 3300006177 Bacteria 2938
147 Ga0075367_10002237 3300006178 Bacteria 8742
148 Ga0075366_10000973 3300006195 Bacteria 13996
149 Ga0097621_100018223 3300006237 Bacteria 5357
150 Ga0097621_100024703 3300006237 Bacteria 4695
151 Ga0097621_100066536 3300006237 Bacteria 2968
152 Ga0097621_100319934 3300006237 Bacteria 1374
153 Ga0097621_100359515 3300006237 Unclassified 1297
154 Ga0068871_100030839 3300006358 Unclassified 4226
155 Ga0068871_100076468 3300006358 Bacteria 2765
156 Ga0068871_100242745 3300006358 Bacteria 1567
157 Ga0075428_100001485 3300006844 Bacteria 25073
158 Ga0075428_100036814 3300006844 Bacteria 5388
159 Ga0075431_100015868 3300006847 Bacteria 7639
160 Ga0075431_100380951 3300006847 Bacteria 1415
161 Ga0075433_10003222 3300006852 Bacteria 12597
162 Ga0075433_10071431 3300006852 Bacteria 3051
163 Ga0075433_10171755 3300006852 Bacteria 1929
164 Ga0075434_100004737 3300006871 Bacteria 12304
165 Ga0075434_100048548 3300006871 Bacteria 4211
166 Ga0075434_100058799 3300006871 Bacteria 3821
167 Ga0075434_100249803 3300006871 Bacteria 1793
168 Ga0075434_100257020 3300006871 Bacteria 1765
169 Ga0075434_100358933 3300006871 Bacteria 1478
170 Ga0075434_100502717 3300006871 Bacteria 1233
171 Ga0068865_100042805 3300006881 Bacteria 3090
172 Ga0068865_100043585 3300006881 Bacteria 3067
173 Ga0068865_100095339 3300006881 Bacteria 2167
174 Ga0075436_100003047 3300006914 Bacteria 11487
175 Ga0075436_100071715 3300006914 Bacteria 2395
176 Ga0097620_100013583 3300006931 Bacteria 8163
177 Ga0097620_100027195 3300006931 Bacteria 5738
178 Ga0097620_100049573 3300006931 Bacteria 4217
179 Ga0097620_100148696 3300006931 Unclassified 2418
180 Ga0097620_100193472 3300006931 Bacteria 2118
181 Ga0097620_100306983 3300006931 Bacteria 1680
182 Ga0075435_100073906 3300007076 Bacteria 2787
183 Ga0075435_100095849 3300007076 Unclassified 2454
184 Ga0099794_10007949 3300007265 Bacteria 4384
185 Ga0105240_10011617 3300009093 Bacteria 12248
186 Ga0105240_10022682 3300009093 Bacteria 8317
187 Ga0105240_10062281 3300009093 Bacteria 4645
188 Ga0105240_10093738 3300009093 Bacteria 3664
189 Ga0111539_10003069 3300009094 Bacteria 22129
190 Ga0111539_10056627 3300009094 Bacteria 4658
191 Ga0111539_10152937 3300009094 Bacteria 2700
192 Ga0111539_10407522 3300009094 Unclassified 1583
193 Ga0105245_10002931 3300009098 Bacteria 15316
194 Ga0105245_10100446 3300009098 Bacteria 2676
195 Ga0105245_10119641 3300009098 Bacteria 2459
196 Ga0105245_10200331 3300009098 Unclassified 1917
197 Ga0105245_10204340 3300009098 Bacteria 1898
198 Ga0105245_10400432 3300009098 Unclassified 1371
199 Ga0114129_10000027 3300009147 Bacteria 112969
200 Ga0114129_10021567 3300009147 Bacteria 9144
201 Ga0114129_10093522 3300009147 Bacteria 4165
202 Ga0114129_10202857 3300009147 Bacteria 2685
203 Ga0105243_10039903 3300009148 Bacteria 3663
204 Ga0105243_10261947 3300009148 Bacteria 1548
205 Ga0105243_10321920 3300009148 Bacteria 1409
206 Ga0105243_10343787 3300009148 Bacteria 1368
207 Ga0105243_10503144 3300009148 Bacteria 1148
208 Ga0105241_10011888 3300009174 Bacteria 6397
209 Ga0105241_10087895 3300009174 Unclassified 2447
210 Ga0105241_10204423 3300009174 Unclassified 1651
211 Ga0105241_10303887 3300009174 Unclassified 1370
212 Ga0105241_10495924 3300009174 Unclassified 1088
213 Ga0105241_10534847 3300009174 Bacteria 1050
214 Ga0105242_10016280 3300009176 Bacteria 5781
215 Ga0105242_10035147 3300009176 Bacteria 4019
216 Ga0105242_10057251 3300009176 Bacteria 3191
217 Ga0105242_10416250 3300009176 Unclassified 1258
218 Ga0105248_10000562 3300009177 Bacteria 42094
219 Ga0105248_10001595 3300009177 Bacteria 25242
220 Ga0105248_10037993 3300009177 Bacteria 5386
221 Ga0105248_10051373 3300009177 Bacteria 4625
222 Ga0105248_10125138 3300009177 Unclassified 2900
223 Ga0105248_10202645 3300009177 Unclassified 2236
224 Ga0105248_10257940 3300009177 Bacteria 1963
225 Ga0105248_10360395 3300009177 Unclassified 1637
226 Ga0105237_10016662 3300009545 Bacteria 7632
227 Ga0105237_10024726 3300009545 Bacteria 6144
228 Ga0105237_10027240 3300009545 Bacteria 5836
229 Ga0105237_10079547 3300009545 Bacteria 3268
230 Ga0105237_10127964 3300009545 Bacteria 2534
231 Ga0105238_10002683 3300009551 Bacteria 17692
232 Ga0105238_10024681 3300009551 Bacteria 6128
233 Ga0105238_10038145 3300009551 Bacteria 4881
234 Ga0105238_10105987 3300009551 Unclassified 2793
235 Ga0105238_10133009 3300009551 Bacteria 2465
236 Ga0105249_10040144 3300009553 Bacteria 4250
237 Ga0105249_10275134 3300009553 Bacteria 1679
238 Ga0105239_10009479 3300010375 Bacteria 10971
239 Ga0105239_10039974 3300010375 Bacteria 5138
240 Ga0105246_10014199 3300011119 Bacteria 5006
241 Ga0105246_10106680 3300011119 Bacteria 2050
242 Ga0157370_10010552 3300013104 Bacteria 9729
243 Ga0157370_10018572 3300013104 Bacteria 6989
244 Ga0157370_10278684 3300013104 Bacteria 1545
245 Ga0157370_10811585 3300013104 Bacteria 851
246 Ga0157369_10012340 3300013105 Bacteria 9700
247 Ga0157369_10031304 3300013105 Bacteria 5859
248 Ga0157369_10066392 3300013105 Bacteria 3881
249 Ga0157369_10080625 3300013105 Bacteria 3484
250 Ga0157374_10006261 3300013296 Bacteria 10091
251 Ga0157374_10038933 3300013296 Bacteria 4372
252 Ga0157374_10076946 3300013296 Bacteria 3156
253 Ga0157374_10158377 3300013296 Bacteria 2205
254 Ga0157378_10072565 3300013297 Unclassified 3093
255 Ga0157378_10111951 3300013297 Bacteria 2503
256 Ga0157378_10267362 3300013297 Bacteria 1643
257 Ga0157378_10430742 3300013297 Bacteria 1305
258 Ga0163162_10000995 3300013306 Bacteria 26367
259 Ga0163162_10002444 3300013306 Bacteria 17523
260 Ga0163162_10340480 3300013306 Bacteria 1632
261 Ga0163162_10499210 3300013306 Bacteria 1347
262 Ga0163162_10764339 3300013306 Bacteria 1085
263 Ga0157372_10003092 3300013307 Bacteria 17925
264 Ga0157372_10179286 3300013307 Bacteria 2452
265 Ga0157375_10004297 3300013308 Bacteria 12361
266 Ga0157375_10057940 3300013308 Bacteria 3831
267 Ga0157375_10144400 3300013308 Bacteria 2509
268 Ga0157375_10157345 3300013308 Unclassified 2412
269 Ga0163163_10007949 3300014325 Bacteria 9380
270 Ga0163163_10012832 3300014325 Bacteria 7645
271 Ga0163163_10016359 3300014325 Bacteria 6889
272 Ga0163163_10030465 3300014325 Bacteria 5199
273 Ga0163163_10056418 3300014325 Bacteria 3882
274 Ga0163163_10147316 3300014325 Bacteria 2398
275 Ga0157380_10081812 3300014326 Bacteria 2642
276 Ga0157380_10382664 3300014326 Bacteria 1328
277 Ga0157379_10000277 3300014968 Bacteria 40463
278 Ga0157376_10036831 3300014969 Bacteria 3966
279 Ga0157376_10088729 3300014969 Bacteria 2672
280 Ga0157376_10343933 3300014969 Bacteria 1425
281 Ga0157376_10484256 3300014969 Bacteria 1213
282 Ga0163161_10066834 3300017792 Bacteria 2625
283 Ga0213873_10018202 3300021358 Unclassified 1613
284 Ga0207653_10000261 3300025885 Bacteria 32960
285 Ga0207680_10008748 3300025903 Bacteria 4987
286 Ga0207680_10021498 3300025903 Bacteria 3492
287 Ga0207685_10000013 3300025905 Bacteria 186374
288 Ga0207699_10000002 3300025906 Bacteria 662194
289 Ga0207699_10000715 3300025906 Bacteria 15863
290 Ga0207699_10006244 3300025906 Bacteria 5754
291 Ga0207643_10009998 3300025908 Bacteria 5100
292 Ga0207684_10000248 3300025910 Bacteria 80978
293 Ga0207684_10033080 3300025910 Bacteria 4398
294 Ga0207684_10229641 3300025910 Bacteria 1601
295 Ga0207654_10006021 3300025911 Bacteria 6097
296 Ga0207654_10207488 3300025911 Unclassified 1293
297 Ga0207654_10312280 3300025911 Bacteria 1072
298 Ga0207707_10002195 3300025912 Bacteria 17680
299 Ga0207695_10000768 3300025913 Bacteria 61199
300 Ga0207695_10000789 3300025913 Bacteria 59517
301 Ga0207695_10011181 3300025913 Bacteria 10891
302 Ga0207695_10034350 3300025913 Bacteria 5516
303 Ga0207695_10071430 3300025913 Bacteria 3545
304 Ga0207695_10073553 3300025913 Bacteria 3482
305 Ga0207695_10129621 3300025913 Bacteria 2481
306 Ga0207671_10037938 3300025914 Bacteria 3572
307 Ga0207671_10043137 3300025914 Bacteria 3335
308 Ga0207671_10165531 3300025914 Bacteria 1714
309 Ga0207693_10000108 3300025915 Bacteria 75296
310 Ga0207693_10015198 3300025915 Bacteria 6178
311 Ga0207693_10103107 3300025915 Bacteria 2237
312 Ga0207663_10000006 3300025916 Bacteria 253740
313 Ga0207663_10065313 3300025916 Bacteria 2326
314 Ga0207663_10084339 3300025916 Bacteria 2090
315 Ga0207660_10113703 3300025917 Bacteria 2041
316 Ga0207662_10010850 3300025918 Bacteria 5035
317 Ga0207657_10121916 3300025919 Bacteria 2145
318 Ga0207649_10036108 3300025920 Bacteria 2974
319 Ga0207649_10113732 3300025920 Unclassified 1813
320 Ga0207652_10001481 3300025921 Bacteria 20767
321 Ga0207646_10094543 3300025922 Bacteria 2677
322 Ga0207681_10000006 3300025923 Bacteria 496979
323 Ga0207681_10071782 3300025923 Bacteria 2416
324 Ga0207694_10002477 3300025924 Bacteria 15029
325 Ga0207694_10003769 3300025924 Bacteria 12005
326 Ga0207694_10016496 3300025924 Bacteria 5578
327 Ga0207694_10033293 3300025924 Bacteria 3948
328 Ga0207694_10082371 3300025924 Bacteria 2529
329 Ga0207694_10373494 3300025924 Bacteria 1183
330 Ga0207650_10001625 3300025925 Bacteria 16035
331 Ga0207650_10014064 3300025925 Bacteria 5557
332 Ga0207659_10001985 3300025926 Bacteria 12106
333 Ga0207659_10004565 3300025926 Bacteria 8374
334 Ga0207687_10010708 3300025927 Bacteria 5989
335 Ga0207687_10023066 3300025927 Bacteria 4145
336 Ga0207687_10068590 3300025927 Bacteria 2526
337 Ga0207687_10082323 3300025927 Bacteria 2328
338 Ga0207700_10004544 3300025928 Bacteria 8200
339 Ga0207700_10005144 3300025928 Bacteria 7780
340 Ga0207700_10027875 3300025928 Bacteria 3961
341 Ga0207664_10048768 3300025929 Bacteria 3332
342 Ga0207664_10135579 3300025929 Bacteria 2077
343 Ga0207644_10013348 3300025931 Bacteria 5476
344 Ga0207644_10013545 3300025931 Bacteria 5440
345 Ga0207706_10505370 3300025933 Bacteria 1043
346 Ga0207686_10189956 3300025934 Bacteria 1463
347 Ga0207709_10083180 3300025935 Bacteria 2069
348 Ga0207709_10086840 3300025935 Bacteria 2032
349 Ga0207709_10107526 3300025935 Bacteria 1858
350 Ga0207704_10067114 3300025938 Bacteria 2255
351 Ga0207704_10148410 3300025938 Bacteria 1651
352 Ga0207704_10224185 3300025938 Bacteria 1393
353 Ga0207704_10252890 3300025938 Bacteria 1324
354 Ga0207665_10000022 3300025939 Bacteria 109003
355 Ga0207665_10001840 3300025939 Bacteria 14276
356 Ga0207665_10016609 3300025939 Bacteria 4836
357 Ga0207665_10083472 3300025939 Unclassified 2203
358 Ga0207691_10009274 3300025940 Bacteria 9441
359 Ga0207691_10102531 3300025940 Bacteria 2552
360 Ga0207691_10182177 3300025940 Unclassified 1835
361 Ga0207691_10375972 3300025940 Unclassified 1213
362 Ga0207711_10001521 3300025941 Bacteria 21549
363 Ga0207711_10005417 3300025941 Bacteria 10791
364 Ga0207711_10089791 3300025941 Unclassified 2700
365 Ga0207711_10093531 3300025941 Unclassified 2648
366 Ga0207711_10498922 3300025941 Bacteria 1134
367 Ga0207689_10068240 3300025942 Bacteria 2922
368 Ga0207689_10123920 3300025942 Bacteria 2126
369 Ga0207661_10001936 3300025944 Bacteria 14239
370 Ga0207661_10011769 3300025944 Bacteria 6352
371 Ga0207661_10035478 3300025944 Bacteria 3886
372 Ga0207679_10007116 3300025945 Bacteria 7089
373 Ga0207667_10002519 3300025949 Bacteria 22814
374 Ga0207667_10020639 3300025949 Bacteria 7322
375 Ga0207667_10242856 3300025949 Unclassified 1843
376 Ga0207667_10330499 3300025949 Unclassified 1556
377 Ga0207651_10007268 3300025960 Bacteria 5887
378 Ga0207651_10008592 3300025960 Bacteria 5526
379 Ga0207651_10060666 3300025960 Bacteria 2627
380 Ga0207651_10170412 3300025960 Bacteria 1716
381 Ga0207712_10096161 3300025961 Bacteria 2192
382 Ga0207712_10117064 3300025961 Bacteria 2009
383 Ga0207640_10065668 3300025981 Bacteria 2422
384 Ga0207640_10348174 3300025981 Bacteria 1189
385 Ga0207658_10006343 3300025986 Bacteria 8073
386 Ga0207677_10001963 3300026023 Bacteria 10892
387 Ga0207677_10134880 3300026023 Bacteria 1880
388 Ga0207703_10023698 3300026035 Bacteria 4827
389 Ga0207703_10035135 3300026035 Bacteria 3982
390 Ga0207703_10221055 3300026035 Bacteria 1693
391 Ga0207703_10298129 3300026035 Bacteria 1469
392 Ga0207703_10419345 3300026035 Bacteria 1245
393 Ga0207639_10180038 3300026041 Unclassified 1797
394 Ga0207678_10036717 3300026067 Bacteria 4265
395 Ga0207708_10021580 3300026075 Bacteria 4857
396 Ga0207702_10008454 3300026078 Bacteria 8682
397 Ga0207702_10129825 3300026078 Unclassified 2266
398 Ga0207641_10015607 3300026088 Bacteria 6225
399 Ga0207641_10065204 3300026088 Bacteria 3115
400 Ga0207641_10109940 3300026088 Bacteria 2442
401 Ga0207648_10004080 3300026089 Bacteria 15136
402 Ga0207648_10084079 3300026089 Bacteria 2776
403 Ga0207648_10121295 3300026089 Bacteria 2299
404 Ga0207676_10008022 3300026095 Bacteria 7506
405 Ga0207676_10168185 3300026095 Unclassified 1907
406 Ga0207676_10255315 3300026095 Bacteria 1580
407 Ga0207676_10349132 3300026095 Bacteria 1368
408 Ga0207674_10000072 3300026116 Bacteria 105507
409 Ga0207674_10025920 3300026116 Bacteria 6240
410 Ga0207674_10050816 3300026116 Bacteria 4234
411 Ga0207674_10205869 3300026116 Bacteria 1917
412 Ga0207674_10288045 3300026116 Bacteria 1591
413 Ga0207675_100009987 3300026118 Bacteria 8890
414 Ga0207683_10026551 3300026121 Bacteria 4998
415 Ga0207698_10009064 3300026142 Bacteria 6321
416 Ga0207428_10000311 3300027907 Bacteria 64550
417 Ga0207428_10018382 3300027907 Bacteria 5973
418 Ga0265356_1009368 3300028017 Unclassified 1104
419 Ga0268266_10000427 3300028379 Bacteria 63335
420 Ga0268266_10058649 3300028379 Bacteria 3315
421 Ga0268265_10039013 3300028380 Bacteria 3497
422 Ga0268265_10055000 3300028380 Bacteria 3022
423 Ga0268265_10061035 3300028380 Bacteria 2892
424 Ga0268265_10155007 3300028380 Unclassified 1937
425 Ga0268265_10172897 3300028380 Bacteria 1848
426 Ga0268264_10003384 3300028381 Bacteria 13773
427 Ga0268264_10007069 3300028381 Bacteria 9407
428 Ga0268264_10028839 3300028381 Bacteria 4543
429 Ga0268264_10056279 3300028381 Bacteria 3288
430 Ga0268264_10409214 3300028381 Bacteria 1305
431 Ga0265337_1048679 3300028556 Bacteria 1199
432 Ga0265338_10003647 3300028800 Bacteria 21449
433 Ga0265338_10017405 3300028800 Bacteria 7747
434 Ga0265338_10043786 3300028800 Bacteria 4145
435 Ga0265338_10086478 3300028800 Bacteria 2609
436 Ga0265762_1000133 3300030760 Bacteria 11173
437 Ga0265760_10018651 3300031090 Bacteria 1999
438 Ga0265332_10035138 3300031238 Bacteria 2177
439 Ga0265340_10095903 3300031247 Bacteria 1382
440 Ga0265339_10147259 3300031249 Bacteria 1193
441 Ga0265316_10147125 3300031344 Bacteria 1766
442 Ga0265313_10009783 3300031595 Bacteria 6177
443 Ga0265314_10009360 3300031711 Bacteria 8286
444 Ga0373934_0004171 3300035086 Bacteria 5331
445 Ga0373954_0007913 3300035118 Bacteria 4655
446 Ga0373955_0013608 3300035172 Bacteria 3939
447 Ga0373955_0016763 3300035172 Bacteria 3611
448 Ga0373955_0124159 3300035172 Bacteria 1503
449 Ga0373961_0035683 3300035241 Bacteria 1412
450 Ga0373935_0015647 3300035692 Bacteria 4588
451 Ga0373927_0007055 3300035695 Bacteria 7621
452 Ga0373947_0105702 3300035725 Bacteria 1774
453 Ga0373947_0178958 3300035725 Bacteria 1380
454 Ga0373937_0001861 3300036401 Bacteria 17743
455 Ga0373937_0002150 3300036401 Bacteria 16502
456 Ga0373937_0003162 3300036401 Bacteria 13782
457 Ga0373937_0053373 3300036401 Bacteria 3708
458 Ga0373937_0106917 3300036401 Bacteria 2601
459 Ga0436362_0058380 3300039453 Unclassified 2300
460 Ga0451807_0480303 3300041486 Bacteria 1807
461 Ga0451849_1474294 3300041505 Bacteria 1841
462 Ga0451577_0004594 3300042876 Bacteria 14503
463 Ga0451577_0015547 3300042876 Bacteria 7076
464 Ga0451577_0090976 3300042876 Bacteria 2723
465 Ga0453683_0259289 3300044673 Bacteria 1109
466 Ga0466963_0190448 3300044694 Bacteria 1433
467 Ga0453684_0032892 3300044712 Bacteria 7242
468 Ga0453684_0221537 3300044712 Bacteria 2191
469 Ga0451576_0051507 3300045051 Bacteria 4317
470 Ga0451576_0499113 3300045051 Bacteria 1278
471 Ga0495592_0005305 3300046454 Bacteria 9503
472 Ga0495629_0000035 3300046459 Bacteria 118597
473 Ga0495629_0040001 3300046459 Unclassified 3299
474 Ga0495629_0111163 3300046459 Bacteria 1910
475 Ga0495629_0152578 3300046459 Bacteria 1606
476 Ga0495629_0319557 3300046459 Bacteria 1061
477 Ga0495651_0031116 3300046462 Bacteria 4162
478 Ga0495651_0092374 3300046462 Bacteria 2267
479 Ga0495651_0218315 3300046462 Unclassified 1322
480 Ga0495580_0002919 3300046472 Bacteria 14687
481 Ga0495582_0033029 3300046473 Bacteria 2844
482 Ga0495639_0082077 3300046475 Bacteria 1503
483 Ga0495662_0014396 3300046476 Bacteria 3848
484 Ga0495662_0028261 3300046476 Bacteria 2708
485 Ga0495662_0035473 3300046476 Bacteria 2406
486 Ga0495664_0185993 3300046477 Unclassified 1259
487 Ga0495594_0017343 3300046499 Bacteria 3803
488 Ga0495594_0046943 3300046499 Unclassified 2372
489 Ga0495594_0190067 3300046499 Bacteria 1170
490 Ga0495608_0053321 3300046511 Bacteria 2676
491 Ga0495618_0094981 3300046514 Bacteria 1906
492 Ga0495628_0090609 3300046516 Bacteria 2367
493 Ga0495652_0063979 3300046529 Bacteria 3096
494 Ga0495652_0065122 3300046529 Bacteria 3063
495 Ga0495652_0109323 3300046529 Bacteria 2226
496 Ga0495652_0152311 3300046529 Bacteria 1805
497 Ga0495665_0063480 3300046531 Bacteria 1950
498 Ga0495640_0134316 3300046533 Unclassified 1599
499 Ga0495587_0018019 3300046536 Bacteria 4378
500 Ga0495587_0029341 3300046536 Bacteria 3339
501 Ga0495587_0232956 3300046536 Bacteria 1038
502 Ga0495645_0008623 3300046543 Bacteria 7119
503 Ga0495645_0043479 3300046543 Bacteria 3277
504 Ga0495667_0001172 3300046559 Bacteria 17119
505 Ga0495667_0009119 3300046559 Bacteria 6737
506 Ga0495667_0081597 3300046559 Bacteria 2102
507 Ga0495667_0087264 3300046559 Bacteria 2023
508 Ga0495634_0027000 3300046642 Bacteria 4000
509 Ga0495634_0034461 3300046642 Bacteria 3474
510 Ga0495635_0001362 3300046663 Bacteria 16266
511 Ga0495657_0000805 3300046675 Bacteria 27819
512 Ga0495657_0144569 3300046675 Bacteria 1480
513 Ga0495599_0029754 3300046678 Bacteria 3425
514 Ga0495599_0037075 3300046678 Bacteria 3063
515 Ga0495599_0061610 3300046678 Bacteria 2344
516 Ga0495623_0009717 3300046679 Bacteria 6243
517 Ga0495623_0084200 3300046679 Bacteria 1963
518 Ga0495623_0174739 3300046679 Unclassified 1252
519 Ga0495647_0034330 3300046681 Unclassified 1900
520 Ga0495647_0064080 3300046681 Bacteria 1457
521 Ga0495658_0000289 3300046683 Bacteria 28435
522 Ga0495658_0064070 3300046683 Bacteria 2117
523 Ga0495658_0213526 3300046683 Unclassified 1206
524 Ga0495613_0005125 3300046689 Bacteria 9834
525 Ga0495613_0039834 3300046689 Bacteria 3482
526 Ga0495613_0040098 3300046689 Bacteria 3470
527 Ga0495613_0177567 3300046689 Bacteria 1509
528 Ga0495613_0307884 3300046689 Bacteria 1095
529 Ga0495624_0216487 3300046690 Bacteria 1162
530 Ga0495671_0118441 3300046692 Bacteria 1293
531 Ga0495600_0210663 3300046809 Bacteria 1245
532 Ga0495581_0000568 3300047315 Bacteria 19217
533 Ga0495604_0045331 3300047317 Bacteria 3432
534 Ga0495636_0058105 3300047318 Bacteria 1630
535 Ga0495674_0046953 3300047319 Bacteria 3831
536 Ga0495674_0050886 3300047319 Unclassified 3654
537 Ga0495674_0163574 3300047319 Bacteria 1861
538 Ga0495674_0197549 3300047319 Bacteria 1670
539 Ga0495674_0228058 3300047319 Bacteria 1538
540 Ga0495676_0019102 3300047321 Bacteria 6034
541 Ga0495680_0003049 3300047322 Bacteria 16691
542 Ga0495680_0042468 3300047322 Bacteria 3607
543 Ga0495680_0209344 3300047322 Bacteria 1396
544 Ga0495675_0103944 3300047444 Bacteria 1776
545 Ga0495675_0189455 3300047444 Bacteria 1256
546 Ga0495684_0001338 3300047471 Bacteria 19834
547 Ga0495684_0022155 3300047471 Bacteria 4892
548 Ga0495684_0037796 3300047471 Bacteria 3703
549 Ga0495684_0058611 3300047471 Bacteria 2933
550 Ga0495684_0160452 3300047471 Bacteria 1677
551 Ga0495684_0190973 3300047471 Bacteria 1514
552 Ga0495684_0292158 3300047471 Bacteria 1173
553 Ga0495602_0005196 3300048088 Bacteria 13639
554 Ga0495602_0021680 3300048088 Bacteria 6314
555 Ga0495602_0160439 3300048088 Bacteria 1756
556 Ga0496100_0236953 3300048903 Bacteria 1345
557 Ga0496114_0000011 3300048917 Bacteria 348290
558 Ga0501067_0019173 3300049583 Bacteria 3786
559 Ga0501068_0133030 3300049584 Bacteria 1556
560 Ga0501075_0007778 3300049591 Bacteria 7440
561 Ga0501077_0000356 3300049593 Bacteria 27114
562 Ga0501080_0047736 3300049742 Bacteria 3986
563 Ga0501081_0081951 3300049743 Bacteria 2260
564 nmdc:mga03683_13355_c1 3300050489 Bacteria 3020
565 nmdc:mga00v17_26006_c1 3300050491 Bacteria 3406
566 nmdc:mga0yw44_26684_c1 3300050492 Bacteria 3302
567 nmdc:mga0k408_10429_c1 3300050493 Bacteria 5024
568 nmdc:mga06z11_24119_c1 3300050494 Bacteria 2866
569 nmdc:mga05p37_313_c1 3300050507 Bacteria 51243
570 nmdc:mga05p37_3554_c1 3300050507 Bacteria 18203
571 nmdc:mga05p37_81636_c1 3300050507 Unclassified 3215
572 nmdc:mga09592_14555_c1 3300050508 Bacteria 6420
573 nmdc:mga09592_20661_c1 3300050508 Bacteria 5418
574 nmdc:mga06r32_271238_c1 3300050510 Bacteria 1684
575 nmdc:mga06r32_965_c1 3300050510 Bacteria 25699
576 nmdc:mga08y16_38214_c1 3300050511 Bacteria 5042
577 nmdc:mga08y16_39273_c1 3300050511 Bacteria 4966
578 nmdc:mga08y16_49736_c1 3300050511 Bacteria 4386
579 nmdc:mga0n895_47774_c1 3300050512 Bacteria 4186
580 nmdc:mga0n895_507315_c1 3300050512 Bacteria 1215
581 nmdc:mga0n895_587641_c1 3300050512 Bacteria 1117
582 nmdc:mga0n895_71627_c1 3300050512 Bacteria 3437
583 nmdc:mga0rr50_84810_c1 3300050513 Unclassified 2453
584 nmdc:mga08x19_39_c1 3300050514 Bacteria 158844
585 nmdc:mga08x19_4971_c1 3300050514 Bacteria 7858
586 nmdc:mga0a205_177158_c1 3300050515 Bacteria 2027
587 nmdc:mga0a205_3117_c2 3300050515 Bacteria 14077
588 nmdc:mga0a205_69319_c1 3300050515 Bacteria 3405
589 Ga0501084_0152269 3300054114 Bacteria 1950
590 Ga0501082_0018891 3300060353 Bacteria 5938
591 Ga0105249_10169715
592 Ga0065704_10172793
593 Ga0065707_10129220
594 Ga0070683_100000944
595 Ga0070683_100001777
596 Ga0070683_100023325
597 Ga0070683_100055128
598 Ga0070670_100045892
599 Ga0070666_10019281
600 Ga0068868_100000476
601 Ga0070660_100121318
602 Ga0070689_100028952
603 Ga0070691_10002286
604 Ga0070661_100094147
605 Ga0070668_100220827
606 Ga0070669_100000006
607 Ga0070669_100023551
608 Ga0070669_100116165
609 Ga0070675_100000232
610 Ga0070675_100020829
611 Ga0070671_100021731
612 Ga0070671_100041998
613 Ga0070671_100306270
614 Ga0070674_100019822
615 Ga0070673_100003259
616 Ga0070673_100017408
617 Ga0070673_100044869
618 Ga0070673_100196175
619 Ga0070688_100022679
620 Ga0070667_100016966
621 Ga0070667_100021308
622 Ga0070667_100398714
623 Ga0070703_10000937
624 Ga0070709_10000029
625 Ga0070714_100126801
626 Ga0070714_100585867
627 Ga0070713_100000413
628 Ga0070713_100045250
629 Ga0070713_100046629
630 Ga0070710_10028073
631 Ga0070701_10107406
632 Ga0070711_100000027
633 Ga0070711_100088689
634 Ga0070711_100145102
635 Ga0070705_100000221
636 Ga0070694_100009684
637 Ga0070694_100090292
638 Ga0070694_100349029
639 Ga0070708_100022211
640 Ga0070708_100030146
641 Ga0070708_100106479
642 Ga0070678_100148909
643 Ga0070681_10001138
644 Ga0068867_100041415
645 Ga0068867_100053858
646 Ga0068867_100106341
647 Ga0068867_100281886
648 Ga0070685_10011334
649 Ga0070706_100000208
650 Ga0070706_100025236
651 Ga0070706_100148801
652 Ga0070707_100045880
653 Ga0070707_100541900
654 Ga0070699_100000029
655 Ga0070699_100296601
656 Ga0070679_100001167
657 Ga0070679_100319225
658 Ga0070684_100004866
659 Ga0070684_100036275
660 Ga0070684_100058093
661 Ga0070684_100072068
662 Ga0068853_100034323
663 Ga0068853_100433746
664 Ga0070672_100004478
665 Ga0070672_100032800
666 Ga0070672_100155943
667 Ga0070686_100007254
668 Ga0070686_100056532
669 Ga0070686_100090915
670 Ga0070695_100019093
671 Ga0070696_100000362
672 Ga0070696_100036675
673 Ga0070696_100217979
674 Ga0070693_100002949
675 Ga0070665_100000243
676 Ga0070704_100009781
677 Ga0070704_100092067
678 Ga0070704_100128133
679 Ga0070704_100170643
680 Ga0068855_100007475
681 Ga0068855_100013279
682 Ga0068855_100091750
683 Ga0068855_100165655
684 Ga0068855_100278951
685 Ga0070664_100000204
686 Ga0068857_100001209
687 Ga0068857_100091735
688 Ga0068857_100277809
689 Ga0068857_100297767
690 Ga0068854_100066640
691 Ga0068856_100001334
692 Ga0068852_100035625
693 Ga0068859_100013583
694 Ga0068859_100027194
695 Ga0068859_100049575
696 Ga0068859_100148694
697 Ga0068859_100193471
698 Ga0068859_100306994
699 Ga0068864_100000738
700 Ga0068864_100021616
701 Ga0068864_100186907
702 Ga0068864_100283606
703 Ga0068864_100351775
704 Ga0068861_100005078
705 Ga0068870_10030695
706 Ga0068863_100002245
707 Ga0068863_100010819
708 Ga0068863_100038929
709 Ga0068863_100184459
710 Ga0068858_100004232
711 Ga0068858_100076564
712 Ga0068858_100113081
713 Ga0068858_100165417
714 Ga0068860_100002569
715 Ga0068860_100007134
716 Ga0068860_100025653
717 Ga0068860_100129280
718 Ga0068860_100232199
719 Ga0068862_100008716
720 Ga0068862_100011595
721 Ga0068862_100025939
722 Ga0068862_100050568
723 Ga0070717_10003412
724 Ga0070717_10010368
725 Ga0075365_10016699
726 Ga0075368_10037287
727 Ga0075364_10019845
728 Ga0075364_10022064
729 Ga0070715_10000013
730 Ga0070716_100000018
731 Ga0070716_100003790
732 Ga0070716_100026042
733 Ga0070712_100000893
734 Ga0070712_100001442
735 Ga0070712_100091771
736 Ga0075362_10017713
737 Ga0075367_10002237
738 Ga0075366_10000973
739 Ga0097621_100018223
740 Ga0097621_100024703
741 Ga0097621_100066536
742 Ga0097621_100319934
743 Ga0097621_100359515
744 Ga0068871_100030839
745 Ga0068871_100076468
746 Ga0068871_100242745
747 Ga0075428_100001485
748 Ga0075428_100036814
749 Ga0075431_100015868
750 Ga0075431_100380951
751 Ga0075433_10003222
752 Ga0075433_10071431
753 Ga0075433_10171755
754 Ga0075434_100004737
755 Ga0075434_100048548
756 Ga0075434_100058799
757 Ga0075434_100249803
758 Ga0075434_100257020
759 Ga0075434_100358933
760 Ga0075434_100502717
761 Ga0068865_100042805
762 Ga0068865_100043585
763 Ga0068865_100095339
764 Ga0075436_100003047
765 Ga0075436_100071715
766 Ga0097620_100013583
767 Ga0097620_100027195
768 Ga0097620_100049573
769 Ga0097620_100148696
770 Ga0097620_100193472
771 Ga0097620_100306983
772 Ga0075435_100073906
773 Ga0075435_100095849
774 Ga0099794_10007949
775 Ga0105240_10011617
776 Ga0105240_10022682
777 Ga0105240_10062281
778 Ga0105240_10093738
779 Ga0111539_10003069
780 Ga0111539_10056627
781 Ga0111539_10152937
782 Ga0111539_10407522
783 Ga0105245_10002931
784 Ga0105245_10100446
785 Ga0105245_10119641
786 Ga0105245_10200331
787 Ga0105245_10204340
788 Ga0105245_10400432
789 Ga0114129_10000027
790 Ga0114129_10021567
791 Ga0114129_10093522
792 Ga0114129_10202857
793 Ga0105243_10039903
794 Ga0105243_10261947
795 Ga0105243_10321920
796 Ga0105243_10343787
797 Ga0105243_10503144
798 Ga0105241_10011888
799 Ga0105241_10087895
800 Ga0105241_10204423
801 Ga0105241_10303887
802 Ga0105241_10495924
803 Ga0105241_10534847
804 Ga0105242_10016280
805 Ga0105242_10035147
806 Ga0105242_10057251
807 Ga0105242_10416250
808 Ga0105248_10000562
809 Ga0105248_10001595
810 Ga0105248_10037993
811 Ga0105248_10051373
812 Ga0105248_10125138
813 Ga0105248_10202645
814 Ga0105248_10257940
815 Ga0105248_10360395
816 Ga0105237_10016662
817 Ga0105237_10024726
818 Ga0105237_10027240
819 Ga0105237_10079547
820 Ga0105237_10127964
821 Ga0105238_10002683
822 Ga0105238_10024681
823 Ga0105238_10038145
824 Ga0105238_10105987
825 Ga0105238_10133009
826 Ga0105249_10040144
827 Ga0105249_10275134
828 Ga0105239_10009479
829 Ga0105239_10039974
830 Ga0105246_10014199
831 Ga0105246_10106680
832 Ga0157370_10010552
833 Ga0157370_10018572
834 Ga0157370_10278684
835 Ga0157370_10811585
836 Ga0157369_10012340
837 Ga0157369_10031304
838 Ga0157369_10066392
839 Ga0157369_10080625
840 Ga0157374_10006261
841 Ga0157374_10038933
842 Ga0157374_10076946
843 Ga0157374_10158377
844 Ga0157378_10072565
845 Ga0157378_10111951
846 Ga0157378_10267362
847 Ga0157378_10430742
848 Ga0163162_10000995
849 Ga0163162_10002444
850 Ga0163162_10340480
851 Ga0163162_10499210
852 Ga0163162_10764339
853 Ga0157372_10003092
854 Ga0157372_10179286
855 Ga0157375_10004297
856 Ga0157375_10057940
857 Ga0157375_10144400
858 Ga0157375_10157345
859 Ga0163163_10007949
860 Ga0163163_10012832
861 Ga0163163_10016359
862 Ga0163163_10030465
863 Ga0163163_10056418
864 Ga0163163_10147316
865 Ga0157380_10081812
866 Ga0157380_10382664
867 Ga0157379_10000277
868 Ga0157376_10036831
869 Ga0157376_10088729
870 Ga0157376_10343933
871 Ga0157376_10484256
872 Ga0163161_10066834
873 Ga0213873_10018202
874 Ga0207653_10000261
875 Ga0207680_10008748
876 Ga0207680_10021498
877 Ga0207685_10000013
878 Ga0207699_10000002
879 Ga0207699_10000715
880 Ga0207699_10006244
881 Ga0207643_10009998
882 Ga0207684_10000248
883 Ga0207684_10033080
884 Ga0207684_10229641
885 Ga0207654_10006021
886 Ga0207654_10207488
887 Ga0207654_10312280
888 Ga0207707_10002195
889 Ga0207695_10000768
890 Ga0207695_10000789
891 Ga0207695_10011181
892 Ga0207695_10034350
893 Ga0207695_10071430
894 Ga0207695_10073553
895 Ga0207695_10129621
896 Ga0207671_10037938
897 Ga0207671_10043137
898 Ga0207671_10165531
899 Ga0207693_10000108
900 Ga0207693_10015198
901 Ga0207693_10103107
902 Ga0207663_10000006
903 Ga0207663_10065313
904 Ga0207663_10084339
905 Ga0207660_10113703
906 Ga0207662_10010850
907 Ga0207657_10121916
908 Ga0207649_10036108
909 Ga0207649_10113732
910 Ga0207652_10001481
911 Ga0207646_10094543
912 Ga0207681_10000006
913 Ga0207681_10071782
914 Ga0207694_10002477
915 Ga0207694_10003769
916 Ga0207694_10016496
917 Ga0207694_10033293
918 Ga0207694_10082371
919 Ga0207694_10373494
920 Ga0207650_10001625
921 Ga0207650_10014064
922 Ga0207659_10001985
923 Ga0207659_10004565
924 Ga0207687_10010708
925 Ga0207687_10023066
926 Ga0207687_10068590
927 Ga0207687_10082323
928 Ga0207700_10004544
929 Ga0207700_10005144
930 Ga0207700_10027875
931 Ga0207664_10048768
932 Ga0207664_10135579
933 Ga0207644_10013348
934 Ga0207644_10013545
935 Ga0207706_10505370
936 Ga0207686_10189956
937 Ga0207709_10083180
938 Ga0207709_10086840
939 Ga0207709_10107526
940 Ga0207704_10067114
941 Ga0207704_10148410
942 Ga0207704_10224185
943 Ga0207704_10252890
944 Ga0207665_10000022
945 Ga0207665_10001840
946 Ga0207665_10016609
947 Ga0207665_10083472
948 Ga0207691_10009274
949 Ga0207691_10102531
950 Ga0207691_10182177
951 Ga0207691_10375972
952 Ga0207711_10001521
953 Ga0207711_10005417
954 Ga0207711_10089791
955 Ga0207711_10093531
956 Ga0207711_10498922
957 Ga0207689_10068240
958 Ga0207689_10123920
959 Ga0207661_10001936
960 Ga0207661_10011769
961 Ga0207661_10035478
962 Ga0207679_10007116
963 Ga0207667_10002519
964 Ga0207667_10020639
965 Ga0207667_10242856
966 Ga0207667_10330499
967 Ga0207651_10007268
968 Ga0207651_10008592
969 Ga0207651_10060666
970 Ga0207651_10170412
971 Ga0207712_10096161
972 Ga0207712_10117064
973 Ga0207640_10065668
974 Ga0207640_10348174
975 Ga0207658_10006343
976 Ga0207677_10001963
977 Ga0207677_10134880
978 Ga0207703_10023698
979 Ga0207703_10035135
980 Ga0207703_10221055
981 Ga0207703_10298129
982 Ga0207703_10419345
983 Ga0207639_10180038
984 Ga0207678_10036717
985 Ga0207708_10021580
986 Ga0207702_10008454
987 Ga0207702_10129825
988 Ga0207641_10015607
989 Ga0207641_10065204
990 Ga0207641_10109940
991 Ga0207648_10004080
992 Ga0207648_10084079
993 Ga0207648_10121295
994 Ga0207676_10008022
995 Ga0207676_10168185
996 Ga0207676_10255315
997 Ga0207676_10349132
998 Ga0207674_10000072
999 Ga0207674_10025920
1000 Ga0207674_10050816
1001 Ga0207674_10205869
1002 Ga0207674_10288045
1003 Ga0207675_100009987
1004 Ga0207683_10026551
1005 Ga0207698_10009064
1006 Ga0207428_10000311
1007 Ga0207428_10018382
1008 Ga0265356_1009368
1009 Ga0268266_10000427
1010 Ga0268266_10058649
1011 Ga0268265_10039013
1012 Ga0268265_10055000
1013 Ga0268265_10061035
1014 Ga0268265_10155007
1015 Ga0268265_10172897
1016 Ga0268264_10003384
1017 Ga0268264_10007069
1018 Ga0268264_10028839
1019 Ga0268264_10056279
1020 Ga0268264_10409214
1021 Ga0265337_1048679
1022 Ga0265338_10003647
1023 Ga0265338_10017405
1024 Ga0265338_10043786
1025 Ga0265338_10086478
1026 Ga0265762_1000133
1027 Ga0265760_10018651
1028 Ga0265332_10035138
1029 Ga0265340_10095903
1030 Ga0265339_10147259
1031 Ga0265316_10147125
1032 Ga0265313_10009783
1033 Ga0265314_10009360
1034 Ga0373934_0004171
1035 Ga0373954_0007913
1036 Ga0373955_0013608
1037 Ga0373955_0016763
1038 Ga0373955_0124159
1039 Ga0373961_0035683
1040 Ga0373935_0015647
1041 Ga0373927_0007055
1042 Ga0373947_0105702
1043 Ga0373947_0178958
1044 Ga0373937_0001861
1045 Ga0373937_0002150
1046 Ga0373937_0003162
1047 Ga0373937_0053373
1048 Ga0373937_0106917
1049 Ga0436362_0058380
1050 Ga0451807_0480303
1051 Ga0451849_1474294
1052 Ga0451577_0004594
1053 Ga0451577_0015547
1054 Ga0451577_0090976
1055 Ga0453683_0259289
1056 Ga0466963_0190448
1057 Ga0453684_0032892
1058 Ga0453684_0221537
1059 Ga0451576_0051507
1060 Ga0451576_0499113
1061 Ga0495592_0005305
1062 Ga0495629_0000035
1063 Ga0495629_0040001
1064 Ga0495629_0111163
1065 Ga0495629_0152578
1066 Ga0495629_0319557
1067 Ga0495651_0031116
1068 Ga0495651_0092374
1069 Ga0495651_0218315
1070 Ga0495580_0002919
1071 Ga0495582_0033029
1072 Ga0495639_0082077
1073 Ga0495662_0014396
1074 Ga0495662_0028261
1075 Ga0495662_0035473
1076 Ga0495664_0185993
1077 Ga0495594_0017343
1078 Ga0495594_0046943
1079 Ga0495594_0190067
1080 Ga0495608_0053321
1081 Ga0495618_0094981
1082 Ga0495628_0090609
1083 Ga0495652_0063979
1084 Ga0495652_0065122
1085 Ga0495652_0109323
1086 Ga0495652_0152311
1087 Ga0495665_0063480
1088 Ga0495640_0134316
1089 Ga0495587_0018019
1090 Ga0495587_0029341
1091 Ga0495587_0232956
1092 Ga0495645_0008623
1093 Ga0495645_0043479
1094 Ga0495667_0001172
1095 Ga0495667_0009119
1096 Ga0495667_0081597
1097 Ga0495667_0087264
1098 Ga0495634_0027000
1099 Ga0495634_0034461
1100 Ga0495635_0001362
1101 Ga0495657_0000805
1102 Ga0495657_0144569
1103 Ga0495599_0029754
1104 Ga0495599_0037075
1105 Ga0495599_0061610
1106 Ga0495623_0009717
1107 Ga0495623_0084200
1108 Ga0495623_0174739
1109 Ga0495647_0034330
1110 Ga0495647_0064080
1111 Ga0495658_0000289
1112 Ga0495658_0064070
1113 Ga0495658_0213526
1114 Ga0495613_0005125
1115 Ga0495613_0039834
1116 Ga0495613_0040098
1117 Ga0495613_0177567
1118 Ga0495613_0307884
1119 Ga0495624_0216487
1120 Ga0495671_0118441
1121 Ga0495600_0210663
1122 Ga0495581_0000568
1123 Ga0495604_0045331
1124 Ga0495636_0058105
1125 Ga0495674_0046953
1126 Ga0495674_0050886
1127 Ga0495674_0163574
1128 Ga0495674_0197549
1129 Ga0495674_0228058
1130 Ga0495676_0019102
1131 Ga0495680_0003049
1132 Ga0495680_0042468
1133 Ga0495680_0209344
1134 Ga0495675_0103944
1135 Ga0495675_0189455
1136 Ga0495684_0001338
1137 Ga0495684_0022155
1138 Ga0495684_0037796
1139 Ga0495684_0058611
1140 Ga0495684_0160452
1141 Ga0495684_0190973
1142 Ga0495684_0292158
1143 Ga0495602_0005196
1144 Ga0495602_0021680
1145 Ga0495602_0160439
1146 Ga0496100_0236953
1147 Ga0496114_0000011
1148 Ga0501067_0019173
1149 Ga0501068_0133030
1150 Ga0501075_0007778
1151 Ga0501077_0000356
1152 Ga0501080_0047736
1153 Ga0501081_0081951
1154 nmdc:mga03683_13355_c1
1155 nmdc:mga00v17_26006_c1
1156 nmdc:mga0yw44_26684_c1
1157 nmdc:mga0k408_10429_c1
1158 nmdc:mga06z11_24119_c1
1159 nmdc:mga05p37_313_c1
1160 nmdc:mga05p37_3554_c1
1161 nmdc:mga05p37_81636_c1
1162 nmdc:mga09592_14555_c1
1163 nmdc:mga09592_20661_c1
1164 nmdc:mga06r32_271238_c1
1165 nmdc:mga06r32_965_c1
1166 nmdc:mga08y16_38214_c1
1167 nmdc:mga08y16_39273_c1
1168 nmdc:mga08y16_49736_c1
1169 nmdc:mga0n895_47774_c1
1170 nmdc:mga0n895_507315_c1
1171 nmdc:mga0n895_587641_c1
1172 nmdc:mga0n895_71627_c1
1173 nmdc:mga0rr50_84810_c1
1174 nmdc:mga08x19_39_c1
1175 nmdc:mga08x19_4971_c1
1176 nmdc:mga0a205_177158_c1
1177 nmdc:mga0a205_3117_c2
1178 nmdc:mga0a205_69319_c1
1179 Ga0501084_0152269
1180 Ga0501082_0018891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

34

176

0.97

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

131

211

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x41-assembly1.cif.gz_B 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9379 6 223
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9366 6 223
5lil-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) 0.9338 8 219
5lj6-assembly1.cif.gz_A structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p6522) 0.9297 8 219
5lj7-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) 0.9276 8 219
ID Description Score Start End Superfamily
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9585 6 222 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9509 6 229 3.40.50.300
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9464 8 214 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9417 8 226 3.40.50.300
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9392 8 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0S9DLE0-F1-model_v4 ABC transporter domain-containing protein 0.9618 7 224 GO:0005524
GO:0016887
GO:0046677
AF-A0A7W7BQI4-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9585 8 224 GO:0005524
GO:0016887
GO:0046677
AF-A0A4Q7PN08-F1-model_v4 deleted 0.956 8 226
AF-A0A2R9UI31-F1-model_v4 ABC transporter 0.9556 8 226 GO:0005524
GO:0016887
GO:0046677
AF-A0A1V5YM67-F1-model_v4 Daunorubicin/doxorubicin resistance ATP-binding protein DrrA (EC 3.6.3.-) 0.953 8 222 GO:0005524
GO:0016887
GO:0017004
GO:0022857

Map