F466970

General Info

Members Datasets Scaffolds Average Seq Length
590 257 551 192

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10068610|Ga0157376_100686104
Length 219
Sequence LAASVDAARVVDKGRGNAMKLFKPVYERALVWAAHPQAPWYLAILSFFEAIIFPIAPEIMLAPMVLAKPERWARYATISLVCSVLGALVGYALGHYAFDFVRPLLADLGWLPHIDEYVAMLSKDAQLHPWSAFWALVLAGFLPVPLKIFTWASGIVGVPLPAFIASMIVGRGKRVFLLSGLIRLGGKRAEEALHRWIEPIGWIAVGLLAAVFIYFKFLR

Samples

Sample ID Description Type Environment
1 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
2 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
3 2643221559 Lysobacter sp. Root559 Isolate Unclassified
4 2643221573 Lysobacter sp. Root604 Isolate Unclassified
5 2643221586 Lysobacter sp. Root667 Isolate Unclassified
6 2643221593 Lysobacter sp. Root690 Isolate Unclassified
7 2643221612 Lysobacter sp. Root76 Isolate Unclassified
8 2643221695 Lysobacter sp. Root494 Isolate Unclassified
9 2643221720 Lysobacter sp. Root916 Isolate Unclassified
10 2643221727 Lysobacter sp. Root96 Isolate Unclassified
11 2643221728 Lysobacter sp. Root983 Isolate Unclassified
12 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
13 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
14 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
15 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
16 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
17 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
18 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
19 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
20 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
21 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
22 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
23 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
24 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
25 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
26 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
27 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
28 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
29 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
30 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
31 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
32 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
33 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
34 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
35 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
36 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
37 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
38 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
39 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
40 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
41 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
42 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
43 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
44 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
45 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
46 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
57 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
184 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
185 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
186 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
187 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
188 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
189 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
190 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
193 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
249 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.05
Metatranscriptomes 0.34
Isolates 6.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 3.39
Nodule 0.17
Rhizoplane 1.86
Rhizosphere 84.24
Stem 0
Stem Tuber 0
Unclassified 10.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1018268 3300001904 Bacteria 1110
2 JGI24741J21665_1009554 3300001915 Bacteria 1776
3 JGI24740J21852_10003881 3300001979 Bacteria 6486
4 Ga0055526_1000011 3300003771 Bacteria 236316
5 Ga0055537_1000443 3300003773 Bacteria 26511
6 Ga0055537_1000588 3300003773 Bacteria 20263
7 Ga0055524_1000034 3300003775 Bacteria 180672
8 Ga0055534_1000013 3300003784 Bacteria 151209
9 Ga0055528_1000005 3300003790 Bacteria 236316
10 Ga0070658_10044659 3300005327 Bacteria 3581
11 Ga0070658_10096006 3300005327 Bacteria 2447
12 Ga0070658_10097790 3300005327 Bacteria 2424
13 Ga0070658_10338232 3300005327 Unclassified 1287
14 Ga0070658_10783099 3300005327 Bacteria 828
15 Ga0070676_10439947 3300005328 Bacteria 915
16 Ga0070683_100002771 3300005329 Bacteria 14016
17 Ga0070683_100041570 3300005329 Bacteria 4230
18 Ga0070690_100019979 3300005330 Bacteria 4077
19 Ga0070670_100127852 3300005331 Bacteria 2193
20 Ga0068869_100140603 3300005334 Bacteria 1864
21 Ga0068869_100253637 3300005334 Bacteria 1406
22 Ga0068869_100402022 3300005334 Bacteria 1127
23 Ga0070666_10025858 3300005335 Bacteria 3829
24 Ga0070666_10246751 3300005335 Bacteria 1263
25 Ga0070680_100127303 3300005336 Bacteria 2128
26 Ga0070682_100179534 3300005337 Bacteria 1477
27 Ga0068868_100215677 3300005338 Bacteria 1605
28 Ga0070660_100026814 3300005339 Bacteria 4293
29 Ga0070660_100734745 3300005339 Bacteria 828
30 Ga0070661_100005718 3300005344 Bacteria 8570
31 Ga0070661_100109934 3300005344 Bacteria 2057
32 Ga0070661_100436920 3300005344 Bacteria 1039
33 Ga0070692_10001616 3300005345 Bacteria 8292
34 Ga0070668_100038823 3300005347 Bacteria 3641
35 Ga0070671_101072813 3300005355 Bacteria 707
36 Ga0070688_100410343 3300005365 Bacteria 1004
37 Ga0070659_100598777 3300005366 Bacteria 947
38 Ga0070667_100000005 3300005367 Bacteria 347268
39 Ga0070667_100033096 3300005367 Bacteria 4316
40 Ga0070667_100043517 3300005367 Bacteria 3769
41 Ga0070667_100053111 3300005367 Bacteria 3420
42 Ga0070667_100058101 3300005367 Bacteria 3270
43 Ga0070667_100136551 3300005367 Bacteria 2144
44 Ga0070667_100247707 3300005367 Bacteria 1592
45 Ga0070667_100474018 3300005367 Bacteria 1145
46 Ga0070709_10077562 3300005434 Bacteria 2160
47 Ga0070711_100076603 3300005439 Bacteria 2372
48 Ga0070663_100006105 3300005455 Bacteria 7210
49 Ga0070663_100009056 3300005455 Bacteria 6150
50 Ga0070663_100040929 3300005455 Bacteria 3247
51 Ga0070663_100057050 3300005455 Bacteria 2800
52 Ga0070663_100122012 3300005455 Bacteria 1969
53 Ga0070663_100195119 3300005455 Bacteria 1578
54 Ga0070663_100248663 3300005455 Bacteria 1406
55 Ga0070663_100384492 3300005455 Bacteria 1144
56 Ga0070663_100887311 3300005455 Bacteria 769
57 Ga0070662_100021135 3300005457 Bacteria 4441
58 Ga0070681_10110836 3300005458 Bacteria 2684
59 Ga0070681_10166299 3300005458 Bacteria 2128
60 Ga0068867_100266789 3300005459 Unclassified 1398
61 Ga0070685_10007456 3300005466 Bacteria 5599
62 Ga0070699_100754394 3300005518 Bacteria 890
63 Ga0070679_100005021 3300005530 Bacteria 12212
64 Ga0070679_100235327 3300005530 Bacteria 1791
65 Ga0070684_100012322 3300005535 Bacteria 6848
66 Ga0070684_100425920 3300005535 Bacteria 1225
67 Ga0070684_100608669 3300005535 Bacteria 1016
68 Ga0068853_100003367 3300005539 Bacteria 12234
69 Ga0068853_100004939 3300005539 Bacteria 10386
70 Ga0068853_100009317 3300005539 Bacteria 7917
71 Ga0068853_100023295 3300005539 Bacteria 5181
72 Ga0068853_100073316 3300005539 Bacteria 2985
73 Ga0068853_100145407 3300005539 Bacteria 2130
74 Ga0068853_100266417 3300005539 Bacteria 1576
75 Ga0068853_100324629 3300005539 Bacteria 1427
76 Ga0070696_100188893 3300005546 Bacteria 1532
77 Ga0070693_100005909 3300005547 Bacteria 5916
78 Ga0070693_100082099 3300005547 Bacteria 1924
79 Ga0070693_100233489 3300005547 Unclassified 1211
80 Ga0070665_100000062 3300005548 Bacteria 220304
81 Ga0070665_100001267 3300005548 Bacteria 30338
82 Ga0070665_100013310 3300005548 Bacteria 8281
83 Ga0070665_100039150 3300005548 Bacteria 4768
84 Ga0070665_100059354 3300005548 Bacteria 3835
85 Ga0070665_100176464 3300005548 Bacteria 2137
86 Ga0070665_100191901 3300005548 Bacteria 2043
87 Ga0068855_100013206 3300005563 Bacteria 9963
88 Ga0068855_100024470 3300005563 Bacteria 7223
89 Ga0068855_100108560 3300005563 Bacteria 3187
90 Ga0068855_100261978 3300005563 Bacteria 1925
91 Ga0068855_100295291 3300005563 Bacteria 1795
92 Ga0068855_101161274 3300005563 Unclassified 804
93 Ga0070664_100601688 3300005564 Bacteria 1019
94 Ga0068857_100026469 3300005577 Bacteria 5113
95 Ga0068857_100104071 3300005577 Bacteria 2548
96 Ga0068854_100006601 3300005578 Bacteria 7390
97 Ga0068854_100195754 3300005578 Bacteria 1586
98 Ga0068854_100257698 3300005578 Bacteria 1395
99 Ga0068854_100334594 3300005578 Bacteria 1235
100 Ga0068856_100033308 3300005614 Bacteria 5044
101 Ga0068856_100039774 3300005614 Bacteria 4617
102 Ga0068856_100050715 3300005614 Bacteria 4091
103 Ga0068856_100172170 3300005614 Bacteria 2177
104 Ga0068856_100285486 3300005614 Unclassified 1667
105 Ga0068856_100357784 3300005614 Bacteria 1478
106 Ga0068856_100434213 3300005614 Bacteria 1333
107 Ga0068856_100826099 3300005614 Bacteria 946
108 Ga0068852_100012981 3300005616 Bacteria 6357
109 Ga0068852_100017034 3300005616 Bacteria 5690
110 Ga0068852_100040375 3300005616 Bacteria 3936
111 Ga0068852_100149129 3300005616 Bacteria 2173
112 Ga0068852_100149721 3300005616 Bacteria 2169
113 Ga0068852_100180323 3300005616 Bacteria 1986
114 Ga0068852_100959965 3300005616 Bacteria 873
115 Ga0068852_101544267 3300005616 Bacteria 686
116 Ga0068859_100000265 3300005617 Bacteria 52351
117 Ga0068859_100558340 3300005617 Bacteria 1239
118 Ga0068864_100145443 3300005618 Bacteria 2142
119 Ga0068861_100399547 3300005719 Bacteria 1219
120 Ga0068851_10002041 3300005834 Bacteria 8906
121 Ga0068851_10046898 3300005834 Bacteria 2186
122 Ga0068851_10125179 3300005834 Bacteria 1385
123 Ga0068863_100020907 3300005841 Bacteria 6250
124 Ga0068863_100068883 3300005841 Bacteria 3347
125 Ga0068863_100176214 3300005841 Bacteria 2052
126 Ga0068863_100488330 3300005841 Bacteria 1212
127 Ga0068863_100718645 3300005841 Bacteria 993
128 Ga0068858_100003531 3300005842 Bacteria 15485
129 Ga0068858_100115545 3300005842 Bacteria 2508
130 Ga0068858_100139632 3300005842 Bacteria 2274
131 Ga0068860_100171077 3300005843 Bacteria 2098
132 Ga0068862_100005271 3300005844 Bacteria 10842
133 Ga0097621_100046022 3300006237 Bacteria 3528
134 Ga0097621_100129782 3300006237 Bacteria 2144
135 Ga0097621_100274315 3300006237 Bacteria 1483
136 Ga0097621_100595963 3300006237 Unclassified 1010
137 Ga0068871_100112492 3300006358 Bacteria 2291
138 Ga0068871_100168206 3300006358 Bacteria 1878
139 Ga0068865_100091972 3300006881 Bacteria 2203
140 Ga0068865_100390483 3300006881 Bacteria 1137
141 Ga0068865_100628005 3300006881 Bacteria 911
142 Ga0097620_100000265 3300006931 Bacteria 52351
143 Ga0097620_100558286 3300006931 Bacteria 1239
144 Ga0105240_10002519 3300009093 Bacteria 29423
145 Ga0105240_10013886 3300009093 Bacteria 11033
146 Ga0105240_10121168 3300009093 Bacteria 3149
147 Ga0105240_10133360 3300009093 Bacteria 2976
148 Ga0105240_10176224 3300009093 Bacteria 2528
149 Ga0105240_10284227 3300009093 Bacteria 1899
150 Ga0105240_10836956 3300009093 Bacteria 994
151 Ga0105240_10892805 3300009093 Bacteria 957
152 Ga0105245_10770497 3300009098 Bacteria 999
153 Ga0105245_10918177 3300009098 Bacteria 918
154 Ga0105245_11000527 3300009098 Bacteria 880
155 Ga0105247_10194962 3300009101 Bacteria 1358
156 Ga0105243_10332491 3300009148 Bacteria 1388
157 Ga0105241_10009542 3300009174 Bacteria 7130
158 Ga0105241_10012626 3300009174 Bacteria 6199
159 Ga0105241_10100166 3300009174 Bacteria 2302
160 Ga0105241_10270023 3300009174 Bacteria 1449
161 Ga0105241_10322248 3300009174 Unclassified 1333
162 Ga0105241_10751397 3300009174 Bacteria 894
163 Ga0105242_10200045 3300009176 Unclassified 1774
164 Ga0105248_10002061 3300009177 Bacteria 22267
165 Ga0105248_10627696 3300009177 Bacteria 1212
166 Ga0105248_11298639 3300009177 Bacteria 823
167 Ga0105237_10004780 3300009545 Bacteria 15572
168 Ga0105237_10021360 3300009545 Bacteria 6656
169 Ga0105237_10030200 3300009545 Bacteria 5507
170 Ga0105237_10034671 3300009545 Bacteria 5108
171 Ga0105237_10074292 3300009545 Bacteria 3392
172 Ga0105237_10353458 3300009545 Unclassified 1474
173 Ga0105237_10557716 3300009545 Bacteria 1152
174 Ga0105237_10829833 3300009545 Bacteria 931
175 Ga0105238_10007377 3300009551 Bacteria 11015
176 Ga0105238_10015192 3300009551 Bacteria 7796
177 Ga0105238_10016212 3300009551 Bacteria 7540
178 Ga0105238_10223172 3300009551 Bacteria 1861
179 Ga0105238_10314669 3300009551 Bacteria 1551
180 Ga0105238_10554302 3300009551 Bacteria 1154
181 Ga0105238_10685765 3300009551 Bacteria 1036
182 Ga0105249_10002473 3300009553 Bacteria 16002
183 Ga0105249_10005661 3300009553 Bacteria 10808
184 Ga0105249_10020935 3300009553 Bacteria 5850
185 Ga0105249_10530166 3300009553 Bacteria 1226
186 Ga0105239_10010293 3300010375 Bacteria 10475
187 Ga0105239_10023401 3300010375 Bacteria 6803
188 Ga0105239_10038519 3300010375 Bacteria 5239
189 Ga0105239_10046624 3300010375 Bacteria 4749
190 Ga0105239_10079172 3300010375 Bacteria 3616
191 Ga0105239_10909056 3300010375 Bacteria 1010
192 Ga0105246_10179791 3300011119 Bacteria 1628
193 Ga0157373_10088365 3300013100 Bacteria 2183
194 Ga0157373_10526816 3300013100 Unclassified 855
195 Ga0157371_10405423 3300013102 Bacteria 998
196 Ga0157370_10006966 3300013104 Bacteria 12347
197 Ga0157370_10470064 3300013104 Bacteria 1156
198 Ga0157370_10535908 3300013104 Bacteria 1074
199 Ga0157370_10622354 3300013104 Bacteria 988
200 Ga0157370_10630467 3300013104 Bacteria 980
201 Ga0157369_10049428 3300013105 Bacteria 4559
202 Ga0157369_10063246 3300013105 Bacteria 3987
203 Ga0157369_10102646 3300013105 Bacteria 3047
204 Ga0157369_10306654 3300013105 Bacteria 1651
205 Ga0157369_10633116 3300013105 Bacteria 1103
206 Ga0157369_10818289 3300013105 Bacteria 957
207 Ga0157369_11122139 3300013105 Unclassified 803
208 Ga0157369_11304716 3300013105 Bacteria 740
209 Ga0157374_10030115 3300013296 Bacteria 4925
210 Ga0157374_10057130 3300013296 Bacteria 3644
211 Ga0157374_10392625 3300013296 Bacteria 1383
212 Ga0157374_11238361 3300013296 Bacteria 768
213 Ga0157378_10000043 3300013297 Bacteria 107750
214 Ga0163162_10000015 3300013306 Bacteria 261996
215 Ga0157372_10004512 3300013307 Bacteria 14851
216 Ga0157372_10007958 3300013307 Bacteria 11270
217 Ga0157372_10031403 3300013307 Bacteria 5816
218 Ga0157372_10182518 3300013307 Bacteria 2429
219 Ga0157372_10491005 3300013307 Bacteria 1432
220 Ga0157372_10963376 3300013307 Bacteria 989
221 Ga0163163_10051824 3300014325 Bacteria 4046
222 Ga0182008_10000116 3300014497 Bacteria 60097
223 Ga0182008_10029602 3300014497 Bacteria 2766
224 Ga0182008_10218456 3300014497 Bacteria 975
225 Ga0157379_10139624 3300014968 Bacteria 2184
226 Ga0157379_10355767 3300014968 Bacteria 1341
227 Ga0157376_10051604 3300014969 Bacteria 3417
228 Ga0157376_10062563 3300014969 Bacteria 3132
229 Ga0157376_10068610 3300014969 Bacteria 3003
230 Ga0157376_10987132 3300014969 Bacteria 864
231 Ga0183360_10001 3300015689 Bacteria 3943671
232 Ga0163161_10013088 3300017792 Bacteria 5766
233 Ga0206356_10279723 3300020070 Bacteria 2448
234 Ga0154015_1087219 3300020610 Bacteria 1905
235 Ga0209233_1012881 3300025261 Bacteria 2408
236 Ga0209565_1000005 3300025263 Bacteria 947317
237 Ga0209673_1000011 3300025273 Bacteria 586604
238 Ga0209675_1000004 3300025291 Bacteria 947166
239 Ga0209564_1000018 3300025295 Bacteria 586913
240 Ga0209256_1000021 3300025299 Bacteria 537097
241 Ga0207656_10000309 3300025321 Bacteria 16926
242 Ga0207656_10027103 3300025321 Bacteria 2341
243 Ga0207656_10032576 3300025321 Bacteria 2166
244 Ga0207656_10034874 3300025321 Bacteria 2103
245 Ga0207680_10340857 3300025903 Bacteria 1051
246 Ga0207647_10000155 3300025904 Bacteria 54186
247 Ga0207647_10001282 3300025904 Bacteria 19326
248 Ga0207647_10004843 3300025904 Bacteria 9954
249 Ga0207647_10274710 3300025904 Bacteria 963
250 Ga0207699_10766536 3300025906 Bacteria 708
251 Ga0207705_10000837 3300025909 Bacteria 25173
252 Ga0207705_10060809 3300025909 Bacteria 2729
253 Ga0207705_10109883 3300025909 Bacteria 2036
254 Ga0207705_10422183 3300025909 Bacteria 1032
255 Ga0207705_10437883 3300025909 Bacteria 1013
256 Ga0207654_10000597 3300025911 Bacteria 20343
257 Ga0207654_10033897 3300025911 Bacteria 2833
258 Ga0207654_10122740 3300025911 Bacteria 1634
259 Ga0207654_10152213 3300025911 Bacteria 1486
260 Ga0207654_10433815 3300025911 Bacteria 919
261 Ga0207707_10000414 3300025912 Bacteria 44770
262 Ga0207707_10008245 3300025912 Bacteria 9045
263 Ga0207707_10071212 3300025912 Bacteria 3029
264 Ga0207695_10000032 3300025913 Bacteria 521283
265 Ga0207695_10000182 3300025913 Bacteria 184125
266 Ga0207695_10005772 3300025913 Bacteria 16296
267 Ga0207695_10036075 3300025913 Bacteria 5350
268 Ga0207695_10055081 3300025913 Bacteria 4147
269 Ga0207695_10084274 3300025913 Bacteria 3210
270 Ga0207695_10206526 3300025913 Bacteria 1877
271 Ga0207671_10005975 3300025914 Bacteria 11019
272 Ga0207671_10028320 3300025914 Bacteria 4186
273 Ga0207671_10046119 3300025914 Bacteria 3224
274 Ga0207671_10146022 3300025914 Bacteria 1825
275 Ga0207671_10241451 3300025914 Bacteria 1419
276 Ga0207671_10280549 3300025914 Bacteria 1314
277 Ga0207671_10593359 3300025914 Bacteria 883
278 Ga0207663_10077521 3300025916 Bacteria 2163
279 Ga0207660_10006460 3300025917 Bacteria 7602
280 Ga0207657_10001316 3300025919 Bacteria 26382
281 Ga0207649_10001300 3300025920 Bacteria 14891
282 Ga0207649_10012555 3300025920 Bacteria 4705
283 Ga0207649_10084750 3300025920 Bacteria 2061
284 Ga0207652_10000398 3300025921 Bacteria 45285
285 Ga0207652_10005492 3300025921 Bacteria 10282
286 Ga0207652_10053325 3300025921 Bacteria 3474
287 Ga0207652_10623203 3300025921 Bacteria 966
288 Ga0207694_10008048 3300025924 Bacteria 7973
289 Ga0207694_10008628 3300025924 Bacteria 7695
290 Ga0207694_10352802 3300025924 Bacteria 1218
291 Ga0207694_10547163 3300025924 Bacteria 971
292 Ga0207650_10086706 3300025925 Bacteria 2384
293 Ga0207687_10181620 3300025927 Bacteria 1630
294 Ga0207687_10341029 3300025927 Bacteria 1218
295 Ga0207644_10209768 3300025931 Bacteria 1540
296 Ga0207690_10088241 3300025932 Bacteria 2184
297 Ga0207706_10007442 3300025933 Bacteria 10126
298 Ga0207706_10268303 3300025933 Bacteria 1490
299 Ga0207704_10009199 3300025938 Bacteria 4756
300 Ga0207704_10045149 3300025938 Bacteria 2616
301 Ga0207691_10456877 3300025940 Bacteria 1086
302 Ga0207711_10000470 3300025941 Bacteria 41566
303 Ga0207689_10191281 3300025942 Bacteria 1688
304 Ga0207689_10387409 3300025942 Bacteria 1164
305 Ga0207661_10021296 3300025944 Bacteria 4855
306 Ga0207661_10021754 3300025944 Bacteria 4811
307 Ga0207679_10060576 3300025945 Bacteria 2813
308 Ga0207679_10150222 3300025945 Bacteria 1895
309 Ga0207679_10379102 3300025945 Bacteria 1239
310 Ga0207667_10002731 3300025949 Bacteria 21813
311 Ga0207667_10018341 3300025949 Bacteria 7851
312 Ga0207667_10077615 3300025949 Bacteria 3444
313 Ga0207667_10516289 3300025949 Bacteria 1210
314 Ga0207667_10530301 3300025949 Bacteria 1192
315 Ga0207651_10160758 3300025960 Bacteria 1761
316 Ga0207712_10000771 3300025961 Bacteria 23954
317 Ga0207712_10002780 3300025961 Bacteria 11194
318 Ga0207712_10500971 3300025961 Bacteria 1038
319 Ga0207668_10141913 3300025972 Bacteria 1848
320 Ga0207640_10002921 3300025981 Bacteria 9182
321 Ga0207640_10003183 3300025981 Bacteria 8833
322 Ga0207640_10320024 3300025981 Bacteria 1235
323 Ga0207658_10000006 3300025986 Bacteria 392309
324 Ga0207658_10008000 3300025986 Bacteria 7200
325 Ga0207658_10022079 3300025986 Bacteria 4427
326 Ga0207658_10655445 3300025986 Bacteria 946
327 Ga0207677_10130747 3300026023 Bacteria 1905
328 Ga0207677_10212305 3300026023 Unclassified 1546
329 Ga0207703_10001094 3300026035 Bacteria 25767
330 Ga0207703_10083079 3300026035 Bacteria 2675
331 Ga0207703_10650003 3300026035 Bacteria 1000
332 Ga0207639_10002290 3300026041 Bacteria 12858
333 Ga0207639_10008722 3300026041 Bacteria 6960
334 Ga0207639_10011916 3300026041 Bacteria 6048
335 Ga0207639_10013430 3300026041 Bacteria 5733
336 Ga0207639_10028117 3300026041 Bacteria 4102
337 Ga0207639_10047047 3300026041 Bacteria 3258
338 Ga0207639_10102030 3300026041 Bacteria 2321
339 Ga0207639_10225136 3300026041 Bacteria 1622
340 Ga0207678_10001340 3300026067 Bacteria 22694
341 Ga0207678_10017061 3300026067 Bacteria 6375
342 Ga0207678_10030841 3300026067 Bacteria 4681
343 Ga0207678_10047635 3300026067 Bacteria 3706
344 Ga0207678_10167103 3300026067 Bacteria 1878
345 Ga0207678_10508321 3300026067 Bacteria 1051
346 Ga0207702_10002732 3300026078 Bacteria 16530
347 Ga0207702_10005747 3300026078 Bacteria 10805
348 Ga0207702_10028842 3300026078 Bacteria 4615
349 Ga0207702_10033104 3300026078 Bacteria 4315
350 Ga0207702_10041945 3300026078 Bacteria 3837
351 Ga0207702_10287930 3300026078 Bacteria 1555
352 Ga0207702_10777116 3300026078 Unclassified 946
353 Ga0207641_10081865 3300026088 Bacteria 2804
354 Ga0207641_10157420 3300026088 Bacteria 2062
355 Ga0207648_10054375 3300026089 Bacteria 3497
356 Ga0207674_10013004 3300026116 Bacteria 9275
357 Ga0207674_10017518 3300026116 Bacteria 7815
358 Ga0207674_10084724 3300026116 Bacteria 3167
359 Ga0207674_10264982 3300026116 Bacteria 1666
360 Ga0207675_100376189 3300026118 Bacteria 1396
361 Ga0207698_10003683 3300026142 Bacteria 9264
362 Ga0207698_10008023 3300026142 Bacteria 6656
363 Ga0207698_10022708 3300026142 Bacteria 4368
364 Ga0207698_10209325 3300026142 Bacteria 1753
365 Ga0207698_11676541 3300026142 Bacteria 651
366 Ga0268266_10000001 3300028379 Bacteria 4040580
367 Ga0268266_10000013 3300028379 Bacteria 649715
368 Ga0268266_10035083 3300028379 Bacteria 4266
369 Ga0268266_10459502 3300028379 Bacteria 1211
370 Ga0268265_10003764 3300028380 Bacteria 10765
371 Ga0268265_10446946 3300028380 Bacteria 1206
372 Ga0268264_10061387 3300028381 Bacteria 3153
373 Ga0316176_1202100 3300030732 Bacteria 2146
374 Ga0307408_100034350 3300031548 Bacteria 3552
375 Ga0307508_10010006 3300031616 Bacteria 8691
376 Ga0307413_10263471 3300031824 Bacteria 1286
377 Ga0307413_10498832 3300031824 Bacteria 977
378 Ga0307406_10003052 3300031901 Bacteria 9112
379 Ga0307414_10068734 3300032004 Bacteria 2543
380 Ga0307411_10175880 3300032005 Bacteria 1619
381 Ga0307507_10338174 3300033179 Bacteria 894
382 Ga0439436_0004028 3300041404 Bacteria 4502
383 Ga0439436_0017545 3300041404 Bacteria 2142
384 Ga0439439_0027830 3300041406 Bacteria 1429
385 Ga0439447_003391 3300041407 Bacteria 5664
386 Ga0451789_0310415 3300041443 Bacteria 963
387 Ga0451791_0013794 3300041451 Bacteria 2534
388 Ga0451791_0250013 3300041451 Bacteria 1575
389 Ga0451800_0983679 3300041459 Bacteria 1220
390 Ga0451802_0598371 3300041460 Bacteria 3526
391 Ga0451807_1606519 3300041486 Bacteria 1001
392 Ga0451837_1385472 3300041494 Bacteria 752
393 Ga0451841_1239236 3300041498 Bacteria 2450
394 Ga0451841_1262016 3300041498 Bacteria 1410
395 Ga0451853_1131241 3300041512 Bacteria 2205
396 Ga0451853_1363320 3300041512 Bacteria 1242
397 Ga0451853_1972459 3300041512 Bacteria 2999
398 Ga0439433_0033238 3300041999 Bacteria 1185
399 Ga0439449_0015453 3300042007 Bacteria 2868
400 Ga0439462_0003666 3300042015 Bacteria 3702
401 Ga0466972_0000993 3300044658 Bacteria 13644
402 Ga0466970_0001822 3300044765 Bacteria 10281
403 Ga0495638_0009055 3300046460 Bacteria 7015
404 Ga0495631_0004079 3300046518 Bacteria 7843
405 Ga0495663_0015309 3300046525 Bacteria 2159
406 Ga0495663_0020718 3300046525 Bacteria 1889
407 Ga0495622_0119116 3300046557 Bacteria 1206
408 Ga0495668_0001422 3300046616 Bacteria 23222
409 Ga0495674_0407958 3300047319 Bacteria 1096
410 Ga0495686_0007599 3300047472 Bacteria 8096
411 Ga0495593_0215093 3300047673 Bacteria 965
412 Ga0496100_0082187 3300048903 Bacteria 2178
413 Ga0496103_0211789 3300048906 Bacteria 1246
414 Ga0496114_0448035 3300048917 Bacteria 1143
415 Ga0496115_0000062 3300048918 Bacteria 100189
416 Ga0496115_0121157 3300048918 Bacteria 2153
417 Ga0496117_0008490 3300048920 Bacteria 9748
418 Ga0496117_0029620 3300048920 Bacteria 4217
419 Ga0496117_0049405 3300048920 Bacteria 2992
420 Ga0496117_0233481 3300048920 Bacteria 1015
421 Ga0496118_0000177 3300048921 Bacteria 114183
422 Ga0496118_0007069 3300048921 Bacteria 12057
423 Ga0496118_0027688 3300048921 Bacteria 4789
424 Ga0496118_0052607 3300048921 Bacteria 3103
425 Ga0496119_0000211 3300048922 Bacteria 83064
426 Ga0496119_0320585 3300048922 Bacteria 759
427 Ga0496120_0000432 3300048923 Bacteria 66285
428 Ga0496121_0017668 3300048924 Bacteria 7261
429 Ga0496121_0042072 3300048924 Bacteria 3981
430 Ga0496121_0043961 3300048924 Bacteria 3861
431 Ga0496121_0098342 3300048924 Bacteria 2265
432 Ga0496121_0343850 3300048924 Bacteria 996
433 Ga0496122_0000463 3300048925 Bacteria 84540
434 Ga0496122_0006129 3300048925 Bacteria 13994
435 Ga0496122_0144809 3300048925 Bacteria 1478
436 Ga0496123_0000151 3300048926 Bacteria 141062
437 Ga0496123_0000296 3300048926 Bacteria 97428
438 Ga0496123_0218932 3300048926 Bacteria 961
439 Ga0496124_0015478 3300048927 Bacteria 7309
440 Ga0496124_0083776 3300048927 Bacteria 2615
441 Ga0496125_0017369 3300048928 Bacteria 6863
442 Ga0496125_0029116 3300048928 Bacteria 4970
443 Ga0496125_0183282 3300048928 Bacteria 1392
444 Ga0496126_0000057 3300048929 Bacteria 276781
445 Ga0496126_0005495 3300048929 Bacteria 14446
446 Ga0496126_0131107 3300048929 Bacteria 2166
447 Ga0501032_0002234 3300049569 Bacteria 15250
448 Ga0501032_0010768 3300049569 Bacteria 6584
449 Ga0501032_0016320 3300049569 Bacteria 5225
450 Ga0501033_0000324 3300049570 Bacteria 45439
451 Ga0501033_0262203 3300049570 Bacteria 1223
452 Ga0501033_0436190 3300049570 Bacteria 911
453 Ga0501034_0002776 3300049571 Bacteria 20531
454 Ga0501034_0054659 3300049571 Bacteria 4019
455 Ga0501034_0174422 3300049571 Bacteria 2116
456 Ga0501036_0004120 3300049572 Bacteria 11698
457 Ga0501036_0112617 3300049572 Bacteria 2299
458 Ga0501036_0508099 3300049572 Bacteria 1003
459 Ga0501037_0000499 3300049573 Bacteria 31684
460 Ga0501037_0007006 3300049573 Bacteria 8231
461 Ga0501037_0014841 3300049573 Bacteria 5731
462 Ga0501037_0031216 3300049573 Bacteria 3934
463 Ga0501037_0378798 3300049573 Bacteria 973
464 Ga0501038_0003315 3300049574 Bacteria 15016
465 Ga0501038_0010510 3300049574 Bacteria 8465
466 Ga0501038_0026778 3300049574 Bacteria 5133
467 Ga0501038_0105851 3300049574 Bacteria 2336
468 Ga0501039_0002265 3300049575 Bacteria 14289
469 Ga0501039_0004305 3300049575 Bacteria 10732
470 Ga0501039_0366443 3300049575 Bacteria 1132
471 Ga0501040_0202156 3300049576 Bacteria 1411
472 Ga0501043_0014452 3300049579 Bacteria 6179
473 Ga0501043_0074174 3300049579 Bacteria 2672
474 Ga0501043_0287473 3300049579 Bacteria 1259
475 Ga0501046_0003027 3300049580 Bacteria 15530
476 Ga0501046_0005386 3300049580 Bacteria 11437
477 Ga0501046_0014037 3300049580 Bacteria 6765
478 Ga0501047_0001148 3300049581 Bacteria 26260
479 Ga0501047_0001523 3300049581 Bacteria 22634
480 Ga0501047_0048701 3300049581 Bacteria 4092
481 Ga0501047_0205590 3300049581 Bacteria 1828
482 Ga0501067_0000619 3300049583 Bacteria 19144
483 Ga0501067_0223484 3300049583 Bacteria 1049
484 Ga0501067_0389283 3300049583 Bacteria 777
485 Ga0501068_0005515 3300049584 Bacteria 6930
486 Ga0501068_0013627 3300049584 Bacteria 4629
487 Ga0501068_0252334 3300049584 Bacteria 1125
488 Ga0501069_0004748 3300049585 Bacteria 7030
489 Ga0501069_0040934 3300049585 Bacteria 2560
490 Ga0501069_0062749 3300049585 Bacteria 2075
491 Ga0501069_0062773 3300049585 Bacteria 2074
492 Ga0501069_0064119 3300049585 Bacteria 2053
493 Ga0501069_0411812 3300049585 Bacteria 801
494 Ga0501070_0002328 3300049586 Bacteria 16672
495 Ga0501070_0003167 3300049586 Bacteria 14312
496 Ga0501070_0014124 3300049586 Bacteria 6721
497 Ga0501070_0057508 3300049586 Bacteria 3223
498 Ga0501070_0589532 3300049586 Bacteria 887
499 Ga0501071_0003560 3300049587 Bacteria 9747
500 Ga0501071_0051941 3300049587 Bacteria 2955
501 Ga0501072_0188828 3300049588 Bacteria 1643
502 Ga0501073_0000130 3300049589 Bacteria 48171
503 Ga0501073_0001312 3300049589 Bacteria 18293
504 Ga0501073_0002117 3300049589 Bacteria 14877
505 Ga0501073_0006715 3300049589 Bacteria 8566
506 Ga0501073_0027891 3300049589 Bacteria 4035
507 Ga0501073_0071826 3300049589 Bacteria 2411
508 Ga0501073_0143446 3300049589 Bacteria 1655
509 Ga0501073_0275332 3300049589 Bacteria 1161
510 Ga0501073_0594356 3300049589 Bacteria 764
511 Ga0501074_0000732 3300049590 Bacteria 20611
512 Ga0501074_0015939 3300049590 Bacteria 5466
513 Ga0501074_0065748 3300049590 Bacteria 2609
514 Ga0501074_0092042 3300049590 Bacteria 2171
515 Ga0501079_0096701 3300049741 Bacteria 2289
516 Ga0501079_0096867 3300049741 Bacteria 2287
517 Ga0501080_0000685 3300049742 Bacteria 27092
518 Ga0501080_0024328 3300049742 Bacteria 5615
519 Ga0501080_0035297 3300049742 Bacteria 4667
520 Ga0501080_0995565 3300049742 Bacteria 727
521 Ga0501083_0085735 3300049744 Bacteria 2084
522 Ga0501083_0377948 3300049744 Bacteria 921
523 Ga0501266_029362 3300049763 Bacteria 779
524 Ga0501035_0004851 3300049822 Bacteria 12751
525 Ga0501035_0009865 3300049822 Bacteria 8863
526 Ga0501035_0011894 3300049822 Bacteria 8054
527 Ga0501035_0034005 3300049822 Bacteria 4633
528 Ga0501035_0103152 3300049822 Bacteria 2502
529 Ga0501035_0172721 3300049822 Bacteria 1866
530 Ga0501044_0008866 3300049823 Bacteria 10995
531 Ga0501044_0025157 3300049823 Bacteria 6312
532 Ga0501044_0029462 3300049823 Bacteria 5788
533 Ga0501044_0050779 3300049823 Bacteria 4278
534 Ga0501044_0068728 3300049823 Bacteria 3608
535 Ga0501044_0103565 3300049823 Bacteria 2860
536 Ga0501044_0105390 3300049823 Bacteria 2832
537 Ga0501044_0118208 3300049823 Bacteria 2654
538 Ga0501044_0403430 3300049823 Bacteria 1279
539 nmdc:mga0yw44_146431_c1 3300050492 Bacteria 1538
540 Ga0500610_0003430 3300053079 Bacteria 6086
541 Ga0500643_005173 3300053087 Bacteria 5690
542 Ga0500651_0043511 3300053093 Bacteria 2827
543 Ga0500597_000335 3300053120 Bacteria 9709
544 Ga0500568_0000952 3300053139 Bacteria 19915
545 Ga0500620_053618 3300053155 Bacteria 1358
546 Ga0501084_0093945 3300054114 Bacteria 2518
547 Ga0501084_0200644 3300054114 Bacteria 1683
548 Ga0501084_0307965 3300054114 Bacteria 1338
549 Ga0500661_001778 3300055283 Bacteria 4062
550 Ga0501082_0012969 3300060353 Bacteria 7164
551 Ga0501082_0087352 3300060353 Bacteria 2690

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005365 Ga0070688_100410343 Ga0070688_1004103432 162
2 3300005616 Ga0068852_100149721 Ga0068852_1001497212 162
3 3300026142 Ga0207698_10022708 Ga0207698_100227083 162
4 3300013296 Ga0157374_10392625 Ga0157374_103926252 165
5 3300005327 Ga0070658_10044659 Ga0070658_100446594 166
6 3300005330 Ga0070690_100019979 Ga0070690_1000199795 166
7 3300005334 Ga0068869_100253637 Ga0068869_1002536372 166
8 3300005367 Ga0070667_100033096 Ga0070667_1000330964 166
9 3300005458 Ga0070681_10110836 Ga0070681_101108362 166
10 3300005530 Ga0070679_100235327 Ga0070679_1002353273 166
11 3300005547 Ga0070693_100082099 Ga0070693_1000820993 166
12 3300005563 Ga0068855_101161274 Ga0068855_1011612742 166
13 3300005564 Ga0070664_100601688 Ga0070664_1006016882 166
14 3300005614 Ga0068856_100172170 Ga0068856_1001721702 166
15 3300005834 Ga0068851_10046898 Ga0068851_100468982 166
16 3300006881 Ga0068865_100628005 Ga0068865_1006280052 166
17 3300009093 Ga0105240_10121168 Ga0105240_101211685 166
18 3300009174 Ga0105241_10100166 Ga0105241_101001663 166
19 3300009551 Ga0105238_10314669 Ga0105238_103146691 166
20 3300013100 Ga0157373_10526816 Ga0157373_105268161 166
21 3300013105 Ga0157369_10306654 Ga0157369_103066542 166
22 3300013307 Ga0157372_10182518 Ga0157372_101825182 166
23 3300014497 Ga0182008_10218456 Ga0182008_102184562 166
24 3300025321 Ga0207656_10034874 Ga0207656_100348743 166
25 3300025909 Ga0207705_10437883 Ga0207705_104378831 166
26 3300025911 Ga0207654_10152213 Ga0207654_101522132 166
27 3300025919 Ga0207657_10001316 Ga0207657_1000131619 166
28 3300025921 Ga0207652_10623203 Ga0207652_106232031 166
29 3300025942 Ga0207689_10191281 Ga0207689_101912813 166
30 3300025945 Ga0207679_10060576 Ga0207679_100605764 166
31 3300025949 Ga0207667_10077615 Ga0207667_100776155 166
32 3300026041 Ga0207639_10102030 Ga0207639_101020302 166
33 3300026078 Ga0207702_10777116 Ga0207702_107771162 166
34 3300026116 Ga0207674_10013004 Ga0207674_1001300411 166
35 3300028381 Ga0268264_10061387 Ga0268264_100613873 166
36 3300049586 Ga0501070_0057508 Ga0501070_0057508_27_566 166
37 3300005719 Ga0068861_100399547 Ga0068861_1003995472 167
38 3300026118 Ga0207675_100376189 Ga0207675_1003761892 167
39 3300013297 Ga0157378_10000043 Ga0157378_1000004366 168
40 3300049585 Ga0501069_0411812 Ga0501069_0411812_72_677 168
41 3300049589 Ga0501073_0275332 Ga0501073_0275332_469_1074 168
42 3300005455 Ga0070663_100040929 Ga0070663_1000409293 171
43 3300005466 Ga0070685_10007456 Ga0070685_100074562 171
44 3300009093 Ga0105240_10002519 Ga0105240_100025196 171
45 3300009545 Ga0105237_10021360 Ga0105237_100213605 171
46 3300009551 Ga0105238_10007377 Ga0105238_100073774 171
47 3300010375 Ga0105239_10023401 Ga0105239_100234014 171
48 3300013307 Ga0157372_10963376 Ga0157372_109633762 171
49 3300025261 Ga0209233_1012881 Ga0209233_10128812 171
50 3300025913 Ga0207695_10000032 Ga0207695_1000003227 171
51 3300025914 Ga0207671_10241451 Ga0207671_102414512 171
52 3300025924 Ga0207694_10008048 Ga0207694_100080485 171
53 3300026067 Ga0207678_10047635 Ga0207678_100476354 171
54 3300048920 Ga0496117_0233481 Ga0496117_0233481_98_760 171
55 3300048921 Ga0496118_0027688 Ga0496118_0027688_1382_2044 171
56 3300049823 Ga0501044_0403430 Ga0501044_0403430_43_648 172
57 3300033179 Ga0307507_10338174 Ga0307507_103381741 173
58 3300046557 Ga0495622_0119116 Ga0495622_0119116_500_1105 173
59 3300047319 Ga0495674_0407958 Ga0495674_0407958_162_767 173
60 3300047673 Ga0495593_0215093 Ga0495593_0215093_171_776 173
61 3300005617 Ga0068859_100558340 Ga0068859_1005583402 174
62 3300005841 Ga0068863_100068883 Ga0068863_1000688833 174
63 3300006358 Ga0068871_100168206 Ga0068871_1001682062 174
64 3300006931 Ga0097620_100558286 Ga0097620_1005582862 174
65 3300009177 Ga0105248_10627696 Ga0105248_106276961 174
66 3300009551 Ga0105238_10685765 Ga0105238_106857651 174
67 3300013104 Ga0157370_10630467 Ga0157370_106304672 174
68 3300014969 Ga0157376_10051604 Ga0157376_100516043 174
69 3300025924 Ga0207694_10352802 Ga0207694_103528022 174
70 3300026088 Ga0207641_10157420 Ga0207641_101574201 174
71 3300031616 Ga0307508_10010006 Ga0307508_100100062 174
72 3300048906 Ga0496103_0211789 Ga0496103_0211789_453_1049 174
73 3300009545 Ga0105237_10557716 Ga0105237_105577162 175
74 3300010375 Ga0105239_10909056 Ga0105239_109090562 175
75 3300048903 Ga0496100_0082187 Ga0496100_0082187_15_635 175
76 3300005327 Ga0070658_10097790 Ga0070658_100977902 176
77 3300005327 Ga0070658_10338232 Ga0070658_103382321 176
78 3300005331 Ga0070670_100127852 Ga0070670_1001278522 176
79 3300005335 Ga0070666_10025858 Ga0070666_100258583 176
80 3300005335 Ga0070666_10246751 Ga0070666_102467512 176
81 3300005338 Ga0068868_100215677 Ga0068868_1002156772 176
82 3300005344 Ga0070661_100005718 Ga0070661_1000057182 176
83 3300005344 Ga0070661_100436920 Ga0070661_1004369202 176
84 3300005367 Ga0070667_100058101 Ga0070667_1000581013 176
85 3300005455 Ga0070663_100195119 Ga0070663_1001951192 176
86 3300005457 Ga0070662_100021135 Ga0070662_1000211354 176
87 3300005459 Ga0068867_100266789 Ga0068867_1002667892 176
88 3300005535 Ga0070684_100608669 Ga0070684_1006086691 176
89 3300005539 Ga0068853_100004939 Ga0068853_1000049394 176
90 3300005539 Ga0068853_100145407 Ga0068853_1001454072 176
91 3300005539 Ga0068853_100266417 Ga0068853_1002664172 176
92 3300005547 Ga0070693_100233489 Ga0070693_1002334891 176
93 3300005548 Ga0070665_100001267 Ga0070665_1000012679 176
94 3300005563 Ga0068855_100013206 Ga0068855_1000132062 176
95 3300005578 Ga0068854_100006601 Ga0068854_1000066012 176
96 3300005578 Ga0068854_100334594 Ga0068854_1003345941 176
97 3300005614 Ga0068856_100050715 Ga0068856_1000507155 176
98 3300005614 Ga0068856_100285486 Ga0068856_1002854862 176
99 3300005614 Ga0068856_100357784 Ga0068856_1003577842 176
100 3300005616 Ga0068852_100012981 Ga0068852_1000129812 176
101 3300005616 Ga0068852_100040375 Ga0068852_1000403754 176
102 3300005616 Ga0068852_100180323 Ga0068852_1001803232 176
103 3300005618 Ga0068864_100145443 Ga0068864_1001454433 176
104 3300005834 Ga0068851_10002041 Ga0068851_100020416 176
105 3300005842 Ga0068858_100003531 Ga0068858_1000035314 176
106 3300006237 Ga0097621_100129782 Ga0097621_1001297822 176
107 3300006237 Ga0097621_100595963 Ga0097621_1005959631 176
108 3300006358 Ga0068871_100112492 Ga0068871_1001124922 176
109 3300006881 Ga0068865_100091972 Ga0068865_1000919723 176
110 3300006881 Ga0068865_100390483 Ga0068865_1003904832 176
111 3300009093 Ga0105240_10013886 Ga0105240_100138864 176
112 3300009093 Ga0105240_10133360 Ga0105240_101333602 176
113 3300009098 Ga0105245_10770497 Ga0105245_107704971 176
114 3300009098 Ga0105245_10918177 Ga0105245_109181772 176
115 3300009101 Ga0105247_10194962 Ga0105247_101949622 176
116 3300009174 Ga0105241_10012626 Ga0105241_100126262 176
117 3300009174 Ga0105241_10270023 Ga0105241_102700231 176
118 3300009174 Ga0105241_10322248 Ga0105241_103222481 176
119 3300009176 Ga0105242_10200045 Ga0105242_102000452 176
120 3300009545 Ga0105237_10034671 Ga0105237_100346716 176
121 3300009545 Ga0105237_10074292 Ga0105237_100742922 176
122 3300009545 Ga0105237_10353458 Ga0105237_103534581 176
123 3300009551 Ga0105238_10015192 Ga0105238_100151924 176
124 3300009551 Ga0105238_10016212 Ga0105238_1001621210 176
125 3300009551 Ga0105238_10554302 Ga0105238_105543022 176
126 3300009553 Ga0105249_10005661 Ga0105249_100056614 176
127 3300010375 Ga0105239_10079172 Ga0105239_100791725 176
128 3300011119 Ga0105246_10179791 Ga0105246_101797912 176
129 3300013104 Ga0157370_10470064 Ga0157370_104700642 176
130 3300013105 Ga0157369_10063246 Ga0157369_100632462 176
131 3300013105 Ga0157369_10633116 Ga0157369_106331162 176
132 3300013296 Ga0157374_10030115 Ga0157374_100301156 176
133 3300013296 Ga0157374_10057130 Ga0157374_100571304 176
134 3300013296 Ga0157374_11238361 Ga0157374_112383611 176
135 3300013307 Ga0157372_10004512 Ga0157372_1000451210 176
136 3300013307 Ga0157372_10031403 Ga0157372_100314034 176
137 3300013307 Ga0157372_10491005 Ga0157372_104910052 176
138 3300014325 Ga0163163_10051824 Ga0163163_100518243 176
139 3300014968 Ga0157379_10139624 Ga0157379_101396243 176
140 3300014969 Ga0157376_10062563 Ga0157376_100625632 176
141 3300025321 Ga0207656_10000309 Ga0207656_100003092 176
142 3300025321 Ga0207656_10027103 Ga0207656_100271032 176
143 3300025904 Ga0207647_10000155 Ga0207647_1000015523 176
144 3300025904 Ga0207647_10004843 Ga0207647_100048437 176
145 3300025909 Ga0207705_10060809 Ga0207705_100608093 176
146 3300025909 Ga0207705_10109883 Ga0207705_101098832 176
147 3300025911 Ga0207654_10033897 Ga0207654_100338972 176
148 3300025911 Ga0207654_10122740 Ga0207654_101227401 176
149 3300025913 Ga0207695_10000182 Ga0207695_10000182174 176
150 3300025913 Ga0207695_10005772 Ga0207695_100057728 176
151 3300025913 Ga0207695_10206526 Ga0207695_102065261 176
152 3300025914 Ga0207671_10005975 Ga0207671_100059756 176
153 3300025914 Ga0207671_10028320 Ga0207671_100283204 176
154 3300025914 Ga0207671_10046119 Ga0207671_100461193 176
155 3300025914 Ga0207671_10280549 Ga0207671_102805492 176
156 3300025920 Ga0207649_10001300 Ga0207649_100013003 176
157 3300025924 Ga0207694_10008628 Ga0207694_100086284 176
158 3300025924 Ga0207694_10547163 Ga0207694_105471632 176
159 3300025927 Ga0207687_10181620 Ga0207687_101816202 176
160 3300025927 Ga0207687_10341029 Ga0207687_103410292 176
161 3300025931 Ga0207644_10209768 Ga0207644_102097682 176
162 3300025933 Ga0207706_10007442 Ga0207706_100074424 176
163 3300025938 Ga0207704_10009199 Ga0207704_100091992 176
164 3300025938 Ga0207704_10045149 Ga0207704_100451492 176
165 3300025945 Ga0207679_10150222 Ga0207679_101502223 176
166 3300025949 Ga0207667_10002731 Ga0207667_1000273115 176
167 3300025960 Ga0207651_10160758 Ga0207651_101607582 176
168 3300025961 Ga0207712_10002780 Ga0207712_100027805 176
169 3300025981 Ga0207640_10003183 Ga0207640_100031835 176
170 3300025986 Ga0207658_10008000 Ga0207658_100080005 176
171 3300025986 Ga0207658_10655445 Ga0207658_106554451 176
172 3300026023 Ga0207677_10130747 Ga0207677_101307473 176
173 3300026023 Ga0207677_10212305 Ga0207677_102123051 176
174 3300026035 Ga0207703_10001094 Ga0207703_1000109413 176
175 3300026041 Ga0207639_10002290 Ga0207639_100022905 176
176 3300026041 Ga0207639_10008722 Ga0207639_100087224 176
177 3300026041 Ga0207639_10011916 Ga0207639_100119162 176
178 3300026067 Ga0207678_10017061 Ga0207678_100170615 176
179 3300026078 Ga0207702_10033104 Ga0207702_100331043 176
180 3300026078 Ga0207702_10041945 Ga0207702_100419454 176
181 3300026078 Ga0207702_10287930 Ga0207702_102879302 176
182 3300026089 Ga0207648_10054375 Ga0207648_100543752 176
183 3300026116 Ga0207674_10084724 Ga0207674_100847244 176
184 3300026116 Ga0207674_10264982 Ga0207674_102649822 176
185 3300026142 Ga0207698_10008023 Ga0207698_100080232 176
186 3300026142 Ga0207698_10209325 Ga0207698_102093252 176
187 3300028379 Ga0268266_10000013 Ga0268266_10000013190 176
188 3300048918 Ga0496115_0000062 Ga0496115_0000062_62669_63265 176
189 3300048928 Ga0496125_0183282 Ga0496125_0183282_773_1378 176
190 3300048929 Ga0496126_0000057 Ga0496126_0000057_37702_38298 176
191 3300009148 Ga0105243_10332491 Ga0105243_103324912 177
192 3300026067 Ga0207678_10508321 Ga0207678_105083212 178
193 3300041498 Ga0451841_1262016 Ga0451841_1262016_183_788 178
194 3300005434 Ga0070709_10077562 Ga0070709_100775623 179
195 3300049569 Ga0501032_0002234 Ga0501032_0002234_4543_5232 179
196 3300049569 Ga0501032_0010768 Ga0501032_0010768_5036_5641 179
197 3300049571 Ga0501034_0002776 Ga0501034_0002776_15714_16319 179
198 3300049571 Ga0501034_0174422 Ga0501034_0174422_701_1390 179
199 3300049572 Ga0501036_0112617 Ga0501036_0112617_813_1502 179
200 3300049572 Ga0501036_0508099 Ga0501036_0508099_209_814 179
201 3300049573 Ga0501037_0000499 Ga0501037_0000499_17886_18575 179
202 3300049573 Ga0501037_0014841 Ga0501037_0014841_3744_4349 179
203 3300049574 Ga0501038_0003315 Ga0501038_0003315_2795_3484 179
204 3300049574 Ga0501038_0026778 Ga0501038_0026778_53_658 179
205 3300049575 Ga0501039_0002265 Ga0501039_0002265_9130_9819 179
206 3300049575 Ga0501039_0366443 Ga0501039_0366443_264_869 179
207 3300049576 Ga0501040_0202156 Ga0501040_0202156_322_1011 179
208 3300049579 Ga0501043_0014452 Ga0501043_0014452_3784_4473 179
209 3300049580 Ga0501046_0003027 Ga0501046_0003027_11819_12508 179
210 3300049581 Ga0501047_0001523 Ga0501047_0001523_6597_7202 179
211 3300049583 Ga0501067_0000619 Ga0501067_0000619_15910_16515 179
212 3300049583 Ga0501067_0223484 Ga0501067_0223484_211_816 179
213 3300049584 Ga0501068_0013627 Ga0501068_0013627_600_1205 179
214 3300049585 Ga0501069_0004748 Ga0501069_0004748_2449_3054 179
215 3300049586 Ga0501070_0003167 Ga0501070_0003167_7865_8470 179
216 3300049588 Ga0501072_0188828 Ga0501072_0188828_383_988 179
217 3300049589 Ga0501073_0001312 Ga0501073_0001312_4881_5486 179
218 3300049589 Ga0501073_0002117 Ga0501073_0002117_13970_14659 179
219 3300049590 Ga0501074_0015939 Ga0501074_0015939_2071_2676 179
220 3300049822 Ga0501035_0004851 Ga0501035_0004851_8124_8813 179
221 3300049823 Ga0501044_0029462 Ga0501044_0029462_3993_4598 179
222 3300049823 Ga0501044_0105390 Ga0501044_0105390_377_1066 179
223 3300054114 Ga0501084_0200644 Ga0501084_0200644_876_1481 179
224 3300055283 Ga0500661_001778 Ga0500661_001778_1553_2158 179
225 3300060353 Ga0501082_0087352 Ga0501082_0087352_136_741 179
226 3300005347 Ga0070668_100038823 Ga0070668_1000388235 180
227 3300005617 Ga0068859_100000265 Ga0068859_10000026518 180
228 3300005834 Ga0068851_10125179 Ga0068851_101251792 180
229 3300005841 Ga0068863_100020907 Ga0068863_1000209077 180
230 3300006931 Ga0097620_100000265 Ga0097620_10000026518 180
231 3300009545 Ga0105237_10030200 Ga0105237_100302003 180
232 3300010375 Ga0105239_10010293 Ga0105239_100102937 180
233 3300013105 Ga0157369_11304716 Ga0157369_113047162 180
234 3300025914 Ga0207671_10146022 Ga0207671_101460222 180
235 3300025972 Ga0207668_10141913 Ga0207668_101419132 180
236 3300026088 Ga0207641_10081865 Ga0207641_100818652 180
237 3300053093 Ga0500651_0043511 Ga0500651_0043511_1170_1775 180
238 3300009174 Ga0105241_10009542 Ga0105241_100095425 182
239 3300013104 Ga0157370_10535908 Ga0157370_105359082 182
240 3300025911 Ga0207654_10000597 Ga0207654_1000059723 182
241 3300049573 Ga0501037_0378798 Ga0501037_0378798_283_888 182
242 3300049589 Ga0501073_0027891 Ga0501073_0027891_1522_2127 182
243 3300049742 Ga0501080_0024328 Ga0501080_0024328_428_1033 182
244 3300005577 Ga0068857_100104071 Ga0068857_1001040712 183
245 3300048920 Ga0496117_0008490 Ga0496117_0008490_4980_5585 183
246 3300048921 Ga0496118_0007069 Ga0496118_0007069_58_663 183
247 iso_pu_bacteria 2571042365 2572256234 183
248 iso_pu_bacteria 2576861471 2578458835 183
249 iso_pu_bacteria 2643221559 2643815724 183
250 iso_pu_bacteria 2643221573 2643878162 183
251 iso_pu_bacteria 2643221586 2643940771 183
252 iso_pu_bacteria 2643221593 2643975591 183
253 iso_pu_bacteria 2643221612 2644080182 183
254 iso_pu_bacteria 2643221695 2644528554 183
255 iso_pu_bacteria 2643221720 2644659467 183
256 iso_pu_bacteria 2643221727 2644695778 183
257 iso_pu_bacteria 2643221728 2644700784 183
258 iso_pu_bacteria 2765235840 2765578551 183
259 iso_pu_bacteria 2816332141 2816516628 183
260 iso_pu_bacteria 2842391507 2842392720 183
261 iso_pu_bacteria 2852649853 2852651191 183
262 iso_pu_bacteria 2857442823 2857445338 183
263 iso_pu_bacteria 2874220319 2874221180 183
264 iso_pu_bacteria 2895498888 2895499340 183
265 iso_pu_bacteria 2895511927 2895512361 183
266 iso_pu_bacteria 2895522137 2895522373 183
267 iso_pu_bacteria 2895525241 2895527187 183
268 iso_pu_bacteria 2919089067 2919092565 183
269 iso_pu_bacteria 2919134579 2919136270 183
270 iso_pu_bacteria 2928496128 2928496149 183
271 iso_pu_bacteria 2931380184 2931381178 183
272 iso_pu_bacteria 2937610967 2937612000 183
273 iso_pu_bacteria 2939589442 2939590646 183
274 iso_pu_bacteria 2939622612 2939622823 183
275 iso_pu_bacteria 2939626828 2939629732 183
276 iso_pu_bacteria 2941475908 2941477866 183
277 iso_pu_bacteria 2961047084 2961047945 183
278 iso_pu_bacteria 2961064222 2961065661 183
279 iso_pu_bacteria 2974307012 2974309306 183
280 iso_pu_bacteria 2977247770 2977250027 183
281 iso_pu_bacteria 2984514374 2984515484 183
282 iso_pu_bacteria 2987605356 2987605917 183
283 iso_pu_bacteria 8002869464 8002871574 183
284 3300005616 Ga0068852_100149129 Ga0068852_1001491292 184
285 3300009093 Ga0105240_10836956 Ga0105240_108369561 184
286 3300013306 Ga0163162_10000015 Ga0163162_10000015138 184
287 3300041512 Ga0451853_1363320 Ga0451853_1363320_195_791 184
288 3300041494 Ga0451837_1385472 Ga0451837_1385472_36_635 185
289 iso_pu_bacteria 2941489479 2941491708 185
290 iso_pu_bacteria 2995948881 2995952670 185
291 3300001904 JGI24736J21556_1018268 JGI24736J21556_10182682 187
292 3300001915 JGI24741J21665_1009554 JGI24741J21665_10095542 187
293 3300001979 JGI24740J21852_10003881 JGI24740J21852_100038817 187
294 3300003771 Ga0055526_1000011 Ga0055526_1000011162 187
295 3300003773 Ga0055537_1000443 Ga0055537_100044319 187
296 3300003773 Ga0055537_1000588 Ga0055537_10005882 187
297 3300003775 Ga0055524_1000034 Ga0055524_1000034116 187
298 3300003784 Ga0055534_1000013 Ga0055534_100001387 187
299 3300003790 Ga0055528_1000005 Ga0055528_1000005162 187
300 3300005327 Ga0070658_10096006 Ga0070658_100960063 187
301 3300005327 Ga0070658_10783099 Ga0070658_107830991 187
302 3300005328 Ga0070676_10439947 Ga0070676_104399471 187
303 3300005329 Ga0070683_100002771 Ga0070683_1000027719 187
304 3300005329 Ga0070683_100041570 Ga0070683_1000415703 187
305 3300005334 Ga0068869_100140603 Ga0068869_1001406032 187
306 3300005334 Ga0068869_100402022 Ga0068869_1004020222 187
307 3300005336 Ga0070680_100127303 Ga0070680_1001273032 187
308 3300005337 Ga0070682_100179534 Ga0070682_1001795343 187
309 3300005339 Ga0070660_100026814 Ga0070660_1000268143 187
310 3300005339 Ga0070660_100734745 Ga0070660_1007347452 187
311 3300005344 Ga0070661_100109934 Ga0070661_1001099343 187
312 3300005345 Ga0070692_10001616 Ga0070692_100016169 187
313 3300005355 Ga0070671_101072813 Ga0070671_1010728131 187
314 3300005366 Ga0070659_100598777 Ga0070659_1005987772 187
315 3300005367 Ga0070667_100000005 Ga0070667_10000000594 187
316 3300005367 Ga0070667_100043517 Ga0070667_1000435174 187
317 3300005367 Ga0070667_100053111 Ga0070667_1000531112 187
318 3300005367 Ga0070667_100136551 Ga0070667_1001365512 187
319 3300005367 Ga0070667_100247707 Ga0070667_1002477072 187
320 3300005367 Ga0070667_100474018 Ga0070667_1004740182 187
321 3300005439 Ga0070711_100076603 Ga0070711_1000766033 187
322 3300005455 Ga0070663_100006105 Ga0070663_1000061055 187
323 3300005455 Ga0070663_100009056 Ga0070663_1000090568 187
324 3300005455 Ga0070663_100057050 Ga0070663_1000570503 187
325 3300005455 Ga0070663_100122012 Ga0070663_1001220122 187
326 3300005455 Ga0070663_100248663 Ga0070663_1002486632 187
327 3300005455 Ga0070663_100384492 Ga0070663_1003844922 187
328 3300005455 Ga0070663_100887311 Ga0070663_1008873111 187
329 3300005458 Ga0070681_10166299 Ga0070681_101662992 187
330 3300005518 Ga0070699_100754394 Ga0070699_1007543942 187
331 3300005530 Ga0070679_100005021 Ga0070679_1000050213 187
332 3300005535 Ga0070684_100012322 Ga0070684_1000123221 187
333 3300005535 Ga0070684_100425920 Ga0070684_1004259201 187
334 3300005539 Ga0068853_100003367 Ga0068853_1000033679 187
335 3300005539 Ga0068853_100009317 Ga0068853_10000931710 187
336 3300005539 Ga0068853_100023295 Ga0068853_1000232954 187
337 3300005539 Ga0068853_100073316 Ga0068853_1000733163 187
338 3300005539 Ga0068853_100324629 Ga0068853_1003246292 187
339 3300005546 Ga0070696_100188893 Ga0070696_1001888934 187
340 3300005547 Ga0070693_100005909 Ga0070693_1000059097 187
341 3300005548 Ga0070665_100000062 Ga0070665_10000006297 187
342 3300005548 Ga0070665_100013310 Ga0070665_10001331012 187
343 3300005548 Ga0070665_100039150 Ga0070665_1000391504 187
344 3300005548 Ga0070665_100059354 Ga0070665_1000593546 187
345 3300005548 Ga0070665_100176464 Ga0070665_1001764642 187
346 3300005548 Ga0070665_100191901 Ga0070665_1001919013 187
347 3300005563 Ga0068855_100024470 Ga0068855_1000244707 187
348 3300005563 Ga0068855_100108560 Ga0068855_1001085602 187
349 3300005563 Ga0068855_100261978 Ga0068855_1002619784 187
350 3300005563 Ga0068855_100295291 Ga0068855_1002952913 187
351 3300005577 Ga0068857_100026469 Ga0068857_1000264694 187
352 3300005578 Ga0068854_100195754 Ga0068854_1001957542 187
353 3300005578 Ga0068854_100257698 Ga0068854_1002576982 187
354 3300005614 Ga0068856_100033308 Ga0068856_1000333085 187
355 3300005614 Ga0068856_100039774 Ga0068856_1000397745 187
356 3300005614 Ga0068856_100434213 Ga0068856_1004342133 187
357 3300005614 Ga0068856_100826099 Ga0068856_1008260991 187
358 3300005616 Ga0068852_100017034 Ga0068852_1000170347 187
359 3300005616 Ga0068852_100959965 Ga0068852_1009599652 187
360 3300005616 Ga0068852_101544267 Ga0068852_1015442671 187
361 3300005841 Ga0068863_100176214 Ga0068863_1001762143 187
362 3300005841 Ga0068863_100488330 Ga0068863_1004883302 187
363 3300005841 Ga0068863_100718645 Ga0068863_1007186452 187
364 3300005842 Ga0068858_100115545 Ga0068858_1001155454 187
365 3300005842 Ga0068858_100139632 Ga0068858_1001396323 187
366 3300005843 Ga0068860_100171077 Ga0068860_1001710773 187
367 3300005844 Ga0068862_100005271 Ga0068862_10000527113 187
368 3300006237 Ga0097621_100046022 Ga0097621_1000460225 187
369 3300006237 Ga0097621_100274315 Ga0097621_1002743152 187
370 3300009093 Ga0105240_10176224 Ga0105240_101762242 187
371 3300009093 Ga0105240_10284227 Ga0105240_102842272 187
372 3300009093 Ga0105240_10892805 Ga0105240_108928052 187
373 3300009098 Ga0105245_11000527 Ga0105245_110005272 187
374 3300009174 Ga0105241_10751397 Ga0105241_107513972 187
375 3300009177 Ga0105248_10002061 Ga0105248_1000206116 187
376 3300009177 Ga0105248_11298639 Ga0105248_112986391 187
377 3300009545 Ga0105237_10004780 Ga0105237_1000478013 187
378 3300009545 Ga0105237_10829833 Ga0105237_108298331 187
379 3300009551 Ga0105238_10223172 Ga0105238_102231722 187
380 3300009553 Ga0105249_10002473 Ga0105249_1000247313 187
381 3300009553 Ga0105249_10020935 Ga0105249_100209356 187
382 3300009553 Ga0105249_10530166 Ga0105249_105301662 187
383 3300010375 Ga0105239_10038519 Ga0105239_100385195 187
384 3300010375 Ga0105239_10046624 Ga0105239_100466246 187
385 3300013100 Ga0157373_10088365 Ga0157373_100883653 187
386 3300013102 Ga0157371_10405423 Ga0157371_104054232 187
387 3300013104 Ga0157370_10006966 Ga0157370_100069669 187
388 3300013104 Ga0157370_10622354 Ga0157370_106223542 187
389 3300013105 Ga0157369_10049428 Ga0157369_100494283 187
390 3300013105 Ga0157369_10102646 Ga0157369_101026462 187
391 3300013105 Ga0157369_10818289 Ga0157369_108182892 187
392 3300013105 Ga0157369_11122139 Ga0157369_111221391 187
393 3300013307 Ga0157372_10007958 Ga0157372_1000795810 187
394 3300014497 Ga0182008_10000116 Ga0182008_1000011665 187
395 3300014497 Ga0182008_10029602 Ga0182008_100296024 187
396 3300014968 Ga0157379_10355767 Ga0157379_103557672 187
397 3300014969 Ga0157376_10068610 Ga0157376_100686104 187
398 3300014969 Ga0157376_10987132 Ga0157376_109871321 187
399 3300015689 Ga0183360_10001 Ga0183360_10001541 187
400 3300017792 Ga0163161_10013088 Ga0163161_100130885 187
401 3300020070 Ga0206356_10279723 Ga0206356_102797232 187
402 3300020610 Ga0154015_1087219 Ga0154015_10872192 187
403 3300025263 Ga0209565_1000005 Ga0209565_1000005569 187
404 3300025273 Ga0209673_1000011 Ga0209673_1000011224 187
405 3300025291 Ga0209675_1000004 Ga0209675_1000004569 187
406 3300025295 Ga0209564_1000018 Ga0209564_1000018224 187
407 3300025299 Ga0209256_1000021 Ga0209256_1000021172 187
408 3300025321 Ga0207656_10032576 Ga0207656_100325763 187
409 3300025903 Ga0207680_10340857 Ga0207680_103408571 187
410 3300025904 Ga0207647_10001282 Ga0207647_1000128213 187
411 3300025904 Ga0207647_10274710 Ga0207647_102747101 187
412 3300025906 Ga0207699_10766536 Ga0207699_107665361 187
413 3300025909 Ga0207705_10000837 Ga0207705_1000083719 187
414 3300025909 Ga0207705_10422183 Ga0207705_104221831 187
415 3300025911 Ga0207654_10433815 Ga0207654_104338152 187
416 3300025912 Ga0207707_10000414 Ga0207707_100004143 187
417 3300025912 Ga0207707_10008245 Ga0207707_100082459 187
418 3300025912 Ga0207707_10071212 Ga0207707_100712123 187
419 3300025913 Ga0207695_10036075 Ga0207695_100360753 187
420 3300025913 Ga0207695_10055081 Ga0207695_100550816 187
421 3300025913 Ga0207695_10084274 Ga0207695_100842744 187
422 3300025914 Ga0207671_10593359 Ga0207671_105933592 187
423 3300025916 Ga0207663_10077521 Ga0207663_100775212 187
424 3300025917 Ga0207660_10006460 Ga0207660_100064607 187
425 3300025920 Ga0207649_10012555 Ga0207649_100125553 187
426 3300025920 Ga0207649_10084750 Ga0207649_100847503 187
427 3300025921 Ga0207652_10000398 Ga0207652_1000039837 187
428 3300025921 Ga0207652_10005492 Ga0207652_100054929 187
429 3300025921 Ga0207652_10053325 Ga0207652_100533252 187
430 3300025925 Ga0207650_10086706 Ga0207650_100867063 187
431 3300025932 Ga0207690_10088241 Ga0207690_100882413 187
432 3300025933 Ga0207706_10268303 Ga0207706_102683032 187
433 3300025940 Ga0207691_10456877 Ga0207691_104568771 187
434 3300025941 Ga0207711_10000470 Ga0207711_1000047010 187
435 3300025942 Ga0207689_10387409 Ga0207689_103874092 187
436 3300025944 Ga0207661_10021296 Ga0207661_100212966 187
437 3300025944 Ga0207661_10021754 Ga0207661_100217546 187
438 3300025945 Ga0207679_10379102 Ga0207679_103791022 187
439 3300025949 Ga0207667_10018341 Ga0207667_100183416 187
440 3300025949 Ga0207667_10516289 Ga0207667_105162892 187
441 3300025949 Ga0207667_10530301 Ga0207667_105303011 187
442 3300025961 Ga0207712_10000771 Ga0207712_1000077119 187
443 3300025961 Ga0207712_10500971 Ga0207712_105009711 187
444 3300025981 Ga0207640_10002921 Ga0207640_1000292110 187
445 3300025981 Ga0207640_10320024 Ga0207640_103200241 187
446 3300025986 Ga0207658_10000006 Ga0207658_10000006278 187
447 3300025986 Ga0207658_10022079 Ga0207658_100220793 187
448 3300026035 Ga0207703_10083079 Ga0207703_100830794 187
449 3300026035 Ga0207703_10650003 Ga0207703_106500032 187
450 3300026041 Ga0207639_10013430 Ga0207639_100134303 187
451 3300026041 Ga0207639_10028117 Ga0207639_100281177 187
452 3300026041 Ga0207639_10047047 Ga0207639_100470474 187
453 3300026041 Ga0207639_10225136 Ga0207639_102251362 187
454 3300026067 Ga0207678_10001340 Ga0207678_1000134016 187
455 3300026067 Ga0207678_10030841 Ga0207678_100308412 187
456 3300026067 Ga0207678_10167103 Ga0207678_101671032 187
457 3300026078 Ga0207702_10002732 Ga0207702_1000273213 187
458 3300026078 Ga0207702_10005747 Ga0207702_1000574711 187
459 3300026078 Ga0207702_10028842 Ga0207702_100288423 187
460 3300026116 Ga0207674_10017518 Ga0207674_100175186 187
461 3300026142 Ga0207698_10003683 Ga0207698_100036839 187
462 3300026142 Ga0207698_11676541 Ga0207698_116765411 187
463 3300028379 Ga0268266_10000001 Ga0268266_100000011775 187
464 3300028379 Ga0268266_10035083 Ga0268266_100350832 187
465 3300028379 Ga0268266_10459502 Ga0268266_104595022 187
466 3300028380 Ga0268265_10003764 Ga0268265_1000376413 187
467 3300028380 Ga0268265_10446946 Ga0268265_104469462 187
468 3300030732 Ga0316176_1202100 Ga0316176_12021002 187
469 3300031548 Ga0307408_100034350 Ga0307408_1000343503 187
470 3300031824 Ga0307413_10263471 Ga0307413_102634712 187
471 3300031824 Ga0307413_10498832 Ga0307413_104988322 187
472 3300031901 Ga0307406_10003052 Ga0307406_100030521 187
473 3300032004 Ga0307414_10068734 Ga0307414_100687343 187
474 3300032005 Ga0307411_10175880 Ga0307411_101758802 187
475 3300041404 Ga0439436_0004028 Ga0439436_0004028_1370_1987 187
476 3300041404 Ga0439436_0017545 Ga0439436_0017545_1036_1650 187
477 3300041406 Ga0439439_0027830 Ga0439439_0027830_579_1196 187
478 3300041407 Ga0439447_003391 Ga0439447_003391_4572_5183 187
479 3300041443 Ga0451789_0310415 Ga0451789_0310415_153_758 187
480 3300041451 Ga0451791_0013794 Ga0451791_0013794_1359_1964 187
481 3300041451 Ga0451791_0250013 Ga0451791_0250013_900_1505 187
482 3300041459 Ga0451800_0983679 Ga0451800_0983679_74_679 187
483 3300041460 Ga0451802_0598371 Ga0451802_0598371_2394_2999 187
484 3300041486 Ga0451807_1606519 Ga0451807_1606519_335_940 187
485 3300041498 Ga0451841_1239236 Ga0451841_1239236_1270_1884 187
486 3300041512 Ga0451853_1131241 Ga0451853_1131241_1481_2086 187
487 3300041512 Ga0451853_1972459 Ga0451853_1972459_294_899 187
488 3300041999 Ga0439433_0033238 Ga0439433_0033238_399_1016 187
489 3300042007 Ga0439449_0015453 Ga0439449_0015453_815_1432 187
490 3300042015 Ga0439462_0003666 Ga0439462_0003666_231_848 187
491 3300044658 Ga0466972_0000993 Ga0466972_0000993_272_877 187
492 3300044765 Ga0466970_0001822 Ga0466970_0001822_154_759 187
493 3300046460 Ga0495638_0009055 Ga0495638_0009055_2696_3310 187
494 3300046518 Ga0495631_0004079 Ga0495631_0004079_5190_5804 187
495 3300046525 Ga0495663_0015309 Ga0495663_0015309_862_1476 187
496 3300046525 Ga0495663_0020718 Ga0495663_0020718_532_1143 187
497 3300046616 Ga0495668_0001422 Ga0495668_0001422_16144_16755 187
498 3300047472 Ga0495686_0007599 Ga0495686_0007599_4282_4887 187
499 3300048917 Ga0496114_0448035 Ga0496114_0448035_377_982 187
500 3300048918 Ga0496115_0121157 Ga0496115_0121157_1259_1864 187
501 3300048920 Ga0496117_0029620 Ga0496117_0029620_2250_2855 187
502 3300048920 Ga0496117_0049405 Ga0496117_0049405_1612_2226 187
503 3300048921 Ga0496118_0000177 Ga0496118_0000177_6911_7516 187
504 3300048921 Ga0496118_0052607 Ga0496118_0052607_2392_3006 187
505 3300048922 Ga0496119_0000211 Ga0496119_0000211_3622_4236 187
506 3300048922 Ga0496119_0320585 Ga0496119_0320585_69_674 187
507 3300048923 Ga0496120_0000432 Ga0496120_0000432_62925_63539 187
508 3300048924 Ga0496121_0017668 Ga0496121_0017668_5750_6367 187
509 3300048924 Ga0496121_0042072 Ga0496121_0042072_784_1398 187
510 3300048924 Ga0496121_0043961 Ga0496121_0043961_1668_2282 187
511 3300048924 Ga0496121_0098342 Ga0496121_0098342_99_704 187
512 3300048924 Ga0496121_0343850 Ga0496121_0343850_361_966 187
513 3300048925 Ga0496122_0000463 Ga0496122_0000463_1353_1958 187
514 3300048925 Ga0496122_0006129 Ga0496122_0006129_10493_11107 187
515 3300048925 Ga0496122_0144809 Ga0496122_0144809_305_919 187
516 3300048926 Ga0496123_0000151 Ga0496123_0000151_137554_138168 187
517 3300048926 Ga0496123_0000296 Ga0496123_0000296_57220_57825 187
518 3300048926 Ga0496123_0218932 Ga0496123_0218932_43_657 187
519 3300048927 Ga0496124_0015478 Ga0496124_0015478_5070_5684 187
520 3300048927 Ga0496124_0083776 Ga0496124_0083776_395_1009 187
521 3300048928 Ga0496125_0017369 Ga0496125_0017369_1261_1875 187
522 3300048928 Ga0496125_0029116 Ga0496125_0029116_3626_4240 187
523 3300048929 Ga0496126_0005495 Ga0496126_0005495_2736_3350 187
524 3300048929 Ga0496126_0131107 Ga0496126_0131107_478_1083 187
525 3300049569 Ga0501032_0016320 Ga0501032_0016320_2711_3316 187
526 3300049570 Ga0501033_0000324 Ga0501033_0000324_15636_16241 187
527 3300049570 Ga0501033_0262203 Ga0501033_0262203_30_632 187
528 3300049570 Ga0501033_0436190 Ga0501033_0436190_35_637 187
529 3300049571 Ga0501034_0054659 Ga0501034_0054659_840_1445 187
530 3300049572 Ga0501036_0004120 Ga0501036_0004120_6690_7295 187
531 3300049573 Ga0501037_0007006 Ga0501037_0007006_4935_5540 187
532 3300049573 Ga0501037_0031216 Ga0501037_0031216_1394_1996 187
533 3300049574 Ga0501038_0010510 Ga0501038_0010510_6690_7295 187
534 3300049574 Ga0501038_0105851 Ga0501038_0105851_695_1300 187
535 3300049575 Ga0501039_0004305 Ga0501039_0004305_1413_2018 187
536 3300049579 Ga0501043_0074174 Ga0501043_0074174_378_983 187
537 3300049579 Ga0501043_0287473 Ga0501043_0287473_218_820 187
538 3300049580 Ga0501046_0005386 Ga0501046_0005386_1999_2604 187
539 3300049580 Ga0501046_0014037 Ga0501046_0014037_4657_5262 187
540 3300049581 Ga0501047_0001148 Ga0501047_0001148_2130_2732 187
541 3300049581 Ga0501047_0048701 Ga0501047_0048701_913_1518 187
542 3300049581 Ga0501047_0205590 Ga0501047_0205590_1076_1681 187
543 3300049583 Ga0501067_0389283 Ga0501067_0389283_75_680 187
544 3300049584 Ga0501068_0005515 Ga0501068_0005515_951_1556 187
545 3300049584 Ga0501068_0252334 Ga0501068_0252334_433_1038 187
546 3300049585 Ga0501069_0040934 Ga0501069_0040934_1300_1902 187
547 3300049585 Ga0501069_0062749 Ga0501069_0062749_976_1581 187
548 3300049585 Ga0501069_0062773 Ga0501069_0062773_1177_1779 187
549 3300049585 Ga0501069_0064119 Ga0501069_0064119_270_872 187
550 3300049586 Ga0501070_0002328 Ga0501070_0002328_9865_10467 187
551 3300049586 Ga0501070_0014124 Ga0501070_0014124_343_945 187
552 3300049586 Ga0501070_0589532 Ga0501070_0589532_243_848 187
553 3300049587 Ga0501071_0003560 Ga0501071_0003560_8762_9364 187
554 3300049587 Ga0501071_0051941 Ga0501071_0051941_397_1002 187
555 3300049589 Ga0501073_0000130 Ga0501073_0000130_17981_18583 187
556 3300049589 Ga0501073_0006715 Ga0501073_0006715_2369_2974 187
557 3300049589 Ga0501073_0071826 Ga0501073_0071826_1483_2088 187
558 3300049589 Ga0501073_0143446 Ga0501073_0143446_779_1381 187
559 3300049589 Ga0501073_0594356 Ga0501073_0594356_15_620 187
560 3300049590 Ga0501074_0000732 Ga0501074_0000732_9572_10174 187
561 3300049590 Ga0501074_0065748 Ga0501074_0065748_1413_2018 187
562 3300049590 Ga0501074_0092042 Ga0501074_0092042_737_1339 187
563 3300049741 Ga0501079_0096701 Ga0501079_0096701_1385_1990 187
564 3300049741 Ga0501079_0096867 Ga0501079_0096867_62_664 187
565 3300049742 Ga0501080_0000685 Ga0501080_0000685_19358_19960 187
566 3300049742 Ga0501080_0035297 Ga0501080_0035297_3372_3977 187
567 3300049742 Ga0501080_0995565 Ga0501080_0995565_93_698 187
568 3300049744 Ga0501083_0085735 Ga0501083_0085735_1043_1648 187
569 3300049744 Ga0501083_0377948 Ga0501083_0377948_150_755 187
570 3300049763 Ga0501266_029362 Ga0501266_029362_100_717 187
571 3300049822 Ga0501035_0009865 Ga0501035_0009865_5896_6498 187
572 3300049822 Ga0501035_0011894 Ga0501035_0011894_1355_1957 187
573 3300049822 Ga0501035_0034005 Ga0501035_0034005_59_664 187
574 3300049822 Ga0501035_0103152 Ga0501035_0103152_1513_2118 187
575 3300049822 Ga0501035_0172721 Ga0501035_0172721_1121_1723 187
576 3300049823 Ga0501044_0008866 Ga0501044_0008866_4736_5338 187
577 3300049823 Ga0501044_0025157 Ga0501044_0025157_1496_2098 187
578 3300049823 Ga0501044_0050779 Ga0501044_0050779_3043_3648 187
579 3300049823 Ga0501044_0068728 Ga0501044_0068728_1996_2598 187
580 3300049823 Ga0501044_0103565 Ga0501044_0103565_59_664 187
581 3300049823 Ga0501044_0118208 Ga0501044_0118208_967_1572 187
582 3300050492 nmdc:mga0yw44_146431_c1 nmdc:mga0yw44_146431_c1_388_1002 187
583 3300053079 Ga0500610_0003430 Ga0500610_0003430_742_1347 187
584 3300053087 Ga0500643_005173 Ga0500643_005173_4584_5189 187
585 3300053120 Ga0500597_000335 Ga0500597_000335_4219_4824 187
586 3300053139 Ga0500568_0000952 Ga0500568_0000952_4357_4962 187
587 3300053155 Ga0500620_053618 Ga0500620_053618_623_1228 187
588 3300054114 Ga0501084_0093945 Ga0501084_0093945_1568_2173 187
589 3300054114 Ga0501084_0307965 Ga0501084_0307965_499_1104 187
590 3300060353 Ga0501082_0012969 Ga0501082_0012969_4977_5582 187

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xgh-assembly1.cif.gz_A x-ray crystal structure of citrate synthase from burkholderia thailandensis 0.4673 23 170
4xgh-assembly1.cif.gz_A x-ray crystal structure of citrate synthase from burkholderia thailandensis 0.3883 23 170
4ja4-assembly2.cif.gz_B inward open conformation of the xylose transporter xyle from e. coli 0.2504 8 182
4ja4-assembly3.cif.gz_C inward open conformation of the xylose transporter xyle from e. coli 0.2492 8 182
4ja4-assembly1.cif.gz_A inward open conformation of the xylose transporter xyle from e. coli 0.2481 21 182
ID Description Score Start End Superfamily
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7321 40 162 1.10.1760.20
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6793 40 162 1.10.1760.20
af_A0A1D6HIR6_348_453_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5625 5 68 1.25.40.10
af_Q4D393_285_540_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.477 4 67 1.25.10.10
af_A0A1D6LXJ5_560_883_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4747 6 74 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A149RXY7-F1-model_v4 Cytochrome B 0.9049 3 179 GO:0005886
AF-A0A1V5LDI8-F1-model_v4 SNARE associated Golgi protein 0.9014 2 186 GO:0005886
AF-A0A3A0E395-F1-model_v4 Cytochrome B 0.8982 3 186 GO:0005886
AF-A0A1I6GB26-F1-model_v4 Membrane protein YqaA, SNARE-associated domain 0.898 4 186 GO:0005886
AF-A0A1E3H8P4-F1-model_v4 SNARE associated Golgi protein 0.8972 3 186 GO:0005886

Feature Viewer

pLDDT pTM Quality
81.9 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map