F466970
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 590 | 257 | 551 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300014969|Ga0157376_10068610|Ga0157376_100686104 |
| Length | 219 |
| Sequence | LAASVDAARVVDKGRGNAMKLFKPVYERALVWAAHPQAPWYLAILSFFEAIIFPIAPEIMLAPMVLAKPERWARYATISLVCSVLGALVGYALGHYAFDFVRPLLADLGWLPHIDEYVAMLSKDAQLHPWSAFWALVLAGFLPVPLKIFTWASGIVGVPLPAFIASMIVGRGKRVFLLSGLIRLGGKRAEEALHRWIEPIGWIAVGLLAAVFIYFKFLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 2 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 3 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 4 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 5 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 6 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 7 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 8 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 9 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 10 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 11 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 12 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 13 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 14 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 15 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 16 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 17 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 18 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 19 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 20 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 21 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 22 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 23 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 24 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 25 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 26 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 27 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 28 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 29 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 30 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 31 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 32 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 33 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 34 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 35 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 36 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 37 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 38 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 39 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 40 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 41 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 42 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 53 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 57 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 179 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 182 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 183 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 184 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 185 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 186 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 187 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 193 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 194 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 195 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 196 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 197 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 198 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 199 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 200 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 210 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 211 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 212 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 213 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 214 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 215 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 216 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 217 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 218 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 219 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 220 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 221 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 222 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 245 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 248 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 249 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 250 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 251 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 252 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 253 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 254 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 256 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.05 |
| Metatranscriptomes | 0.34 |
| Isolates | 6.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.17 |
| Bulb | 0 |
| Endosphere | 3.39 |
| Nodule | 0.17 |
| Rhizoplane | 1.86 |
| Rhizosphere | 84.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1018268 | 3300001904 | Bacteria | 1110 |
| 2 | JGI24741J21665_1009554 | 3300001915 | Bacteria | 1776 |
| 3 | JGI24740J21852_10003881 | 3300001979 | Bacteria | 6486 |
| 4 | Ga0055526_1000011 | 3300003771 | Bacteria | 236316 |
| 5 | Ga0055537_1000443 | 3300003773 | Bacteria | 26511 |
| 6 | Ga0055537_1000588 | 3300003773 | Bacteria | 20263 |
| 7 | Ga0055524_1000034 | 3300003775 | Bacteria | 180672 |
| 8 | Ga0055534_1000013 | 3300003784 | Bacteria | 151209 |
| 9 | Ga0055528_1000005 | 3300003790 | Bacteria | 236316 |
| 10 | Ga0070658_10044659 | 3300005327 | Bacteria | 3581 |
| 11 | Ga0070658_10096006 | 3300005327 | Bacteria | 2447 |
| 12 | Ga0070658_10097790 | 3300005327 | Bacteria | 2424 |
| 13 | Ga0070658_10338232 | 3300005327 | Unclassified | 1287 |
| 14 | Ga0070658_10783099 | 3300005327 | Bacteria | 828 |
| 15 | Ga0070676_10439947 | 3300005328 | Bacteria | 915 |
| 16 | Ga0070683_100002771 | 3300005329 | Bacteria | 14016 |
| 17 | Ga0070683_100041570 | 3300005329 | Bacteria | 4230 |
| 18 | Ga0070690_100019979 | 3300005330 | Bacteria | 4077 |
| 19 | Ga0070670_100127852 | 3300005331 | Bacteria | 2193 |
| 20 | Ga0068869_100140603 | 3300005334 | Bacteria | 1864 |
| 21 | Ga0068869_100253637 | 3300005334 | Bacteria | 1406 |
| 22 | Ga0068869_100402022 | 3300005334 | Bacteria | 1127 |
| 23 | Ga0070666_10025858 | 3300005335 | Bacteria | 3829 |
| 24 | Ga0070666_10246751 | 3300005335 | Bacteria | 1263 |
| 25 | Ga0070680_100127303 | 3300005336 | Bacteria | 2128 |
| 26 | Ga0070682_100179534 | 3300005337 | Bacteria | 1477 |
| 27 | Ga0068868_100215677 | 3300005338 | Bacteria | 1605 |
| 28 | Ga0070660_100026814 | 3300005339 | Bacteria | 4293 |
| 29 | Ga0070660_100734745 | 3300005339 | Bacteria | 828 |
| 30 | Ga0070661_100005718 | 3300005344 | Bacteria | 8570 |
| 31 | Ga0070661_100109934 | 3300005344 | Bacteria | 2057 |
| 32 | Ga0070661_100436920 | 3300005344 | Bacteria | 1039 |
| 33 | Ga0070692_10001616 | 3300005345 | Bacteria | 8292 |
| 34 | Ga0070668_100038823 | 3300005347 | Bacteria | 3641 |
| 35 | Ga0070671_101072813 | 3300005355 | Bacteria | 707 |
| 36 | Ga0070688_100410343 | 3300005365 | Bacteria | 1004 |
| 37 | Ga0070659_100598777 | 3300005366 | Bacteria | 947 |
| 38 | Ga0070667_100000005 | 3300005367 | Bacteria | 347268 |
| 39 | Ga0070667_100033096 | 3300005367 | Bacteria | 4316 |
| 40 | Ga0070667_100043517 | 3300005367 | Bacteria | 3769 |
| 41 | Ga0070667_100053111 | 3300005367 | Bacteria | 3420 |
| 42 | Ga0070667_100058101 | 3300005367 | Bacteria | 3270 |
| 43 | Ga0070667_100136551 | 3300005367 | Bacteria | 2144 |
| 44 | Ga0070667_100247707 | 3300005367 | Bacteria | 1592 |
| 45 | Ga0070667_100474018 | 3300005367 | Bacteria | 1145 |
| 46 | Ga0070709_10077562 | 3300005434 | Bacteria | 2160 |
| 47 | Ga0070711_100076603 | 3300005439 | Bacteria | 2372 |
| 48 | Ga0070663_100006105 | 3300005455 | Bacteria | 7210 |
| 49 | Ga0070663_100009056 | 3300005455 | Bacteria | 6150 |
| 50 | Ga0070663_100040929 | 3300005455 | Bacteria | 3247 |
| 51 | Ga0070663_100057050 | 3300005455 | Bacteria | 2800 |
| 52 | Ga0070663_100122012 | 3300005455 | Bacteria | 1969 |
| 53 | Ga0070663_100195119 | 3300005455 | Bacteria | 1578 |
| 54 | Ga0070663_100248663 | 3300005455 | Bacteria | 1406 |
| 55 | Ga0070663_100384492 | 3300005455 | Bacteria | 1144 |
| 56 | Ga0070663_100887311 | 3300005455 | Bacteria | 769 |
| 57 | Ga0070662_100021135 | 3300005457 | Bacteria | 4441 |
| 58 | Ga0070681_10110836 | 3300005458 | Bacteria | 2684 |
| 59 | Ga0070681_10166299 | 3300005458 | Bacteria | 2128 |
| 60 | Ga0068867_100266789 | 3300005459 | Unclassified | 1398 |
| 61 | Ga0070685_10007456 | 3300005466 | Bacteria | 5599 |
| 62 | Ga0070699_100754394 | 3300005518 | Bacteria | 890 |
| 63 | Ga0070679_100005021 | 3300005530 | Bacteria | 12212 |
| 64 | Ga0070679_100235327 | 3300005530 | Bacteria | 1791 |
| 65 | Ga0070684_100012322 | 3300005535 | Bacteria | 6848 |
| 66 | Ga0070684_100425920 | 3300005535 | Bacteria | 1225 |
| 67 | Ga0070684_100608669 | 3300005535 | Bacteria | 1016 |
| 68 | Ga0068853_100003367 | 3300005539 | Bacteria | 12234 |
| 69 | Ga0068853_100004939 | 3300005539 | Bacteria | 10386 |
| 70 | Ga0068853_100009317 | 3300005539 | Bacteria | 7917 |
| 71 | Ga0068853_100023295 | 3300005539 | Bacteria | 5181 |
| 72 | Ga0068853_100073316 | 3300005539 | Bacteria | 2985 |
| 73 | Ga0068853_100145407 | 3300005539 | Bacteria | 2130 |
| 74 | Ga0068853_100266417 | 3300005539 | Bacteria | 1576 |
| 75 | Ga0068853_100324629 | 3300005539 | Bacteria | 1427 |
| 76 | Ga0070696_100188893 | 3300005546 | Bacteria | 1532 |
| 77 | Ga0070693_100005909 | 3300005547 | Bacteria | 5916 |
| 78 | Ga0070693_100082099 | 3300005547 | Bacteria | 1924 |
| 79 | Ga0070693_100233489 | 3300005547 | Unclassified | 1211 |
| 80 | Ga0070665_100000062 | 3300005548 | Bacteria | 220304 |
| 81 | Ga0070665_100001267 | 3300005548 | Bacteria | 30338 |
| 82 | Ga0070665_100013310 | 3300005548 | Bacteria | 8281 |
| 83 | Ga0070665_100039150 | 3300005548 | Bacteria | 4768 |
| 84 | Ga0070665_100059354 | 3300005548 | Bacteria | 3835 |
| 85 | Ga0070665_100176464 | 3300005548 | Bacteria | 2137 |
| 86 | Ga0070665_100191901 | 3300005548 | Bacteria | 2043 |
| 87 | Ga0068855_100013206 | 3300005563 | Bacteria | 9963 |
| 88 | Ga0068855_100024470 | 3300005563 | Bacteria | 7223 |
| 89 | Ga0068855_100108560 | 3300005563 | Bacteria | 3187 |
| 90 | Ga0068855_100261978 | 3300005563 | Bacteria | 1925 |
| 91 | Ga0068855_100295291 | 3300005563 | Bacteria | 1795 |
| 92 | Ga0068855_101161274 | 3300005563 | Unclassified | 804 |
| 93 | Ga0070664_100601688 | 3300005564 | Bacteria | 1019 |
| 94 | Ga0068857_100026469 | 3300005577 | Bacteria | 5113 |
| 95 | Ga0068857_100104071 | 3300005577 | Bacteria | 2548 |
| 96 | Ga0068854_100006601 | 3300005578 | Bacteria | 7390 |
| 97 | Ga0068854_100195754 | 3300005578 | Bacteria | 1586 |
| 98 | Ga0068854_100257698 | 3300005578 | Bacteria | 1395 |
| 99 | Ga0068854_100334594 | 3300005578 | Bacteria | 1235 |
| 100 | Ga0068856_100033308 | 3300005614 | Bacteria | 5044 |
| 101 | Ga0068856_100039774 | 3300005614 | Bacteria | 4617 |
| 102 | Ga0068856_100050715 | 3300005614 | Bacteria | 4091 |
| 103 | Ga0068856_100172170 | 3300005614 | Bacteria | 2177 |
| 104 | Ga0068856_100285486 | 3300005614 | Unclassified | 1667 |
| 105 | Ga0068856_100357784 | 3300005614 | Bacteria | 1478 |
| 106 | Ga0068856_100434213 | 3300005614 | Bacteria | 1333 |
| 107 | Ga0068856_100826099 | 3300005614 | Bacteria | 946 |
| 108 | Ga0068852_100012981 | 3300005616 | Bacteria | 6357 |
| 109 | Ga0068852_100017034 | 3300005616 | Bacteria | 5690 |
| 110 | Ga0068852_100040375 | 3300005616 | Bacteria | 3936 |
| 111 | Ga0068852_100149129 | 3300005616 | Bacteria | 2173 |
| 112 | Ga0068852_100149721 | 3300005616 | Bacteria | 2169 |
| 113 | Ga0068852_100180323 | 3300005616 | Bacteria | 1986 |
| 114 | Ga0068852_100959965 | 3300005616 | Bacteria | 873 |
| 115 | Ga0068852_101544267 | 3300005616 | Bacteria | 686 |
| 116 | Ga0068859_100000265 | 3300005617 | Bacteria | 52351 |
| 117 | Ga0068859_100558340 | 3300005617 | Bacteria | 1239 |
| 118 | Ga0068864_100145443 | 3300005618 | Bacteria | 2142 |
| 119 | Ga0068861_100399547 | 3300005719 | Bacteria | 1219 |
| 120 | Ga0068851_10002041 | 3300005834 | Bacteria | 8906 |
| 121 | Ga0068851_10046898 | 3300005834 | Bacteria | 2186 |
| 122 | Ga0068851_10125179 | 3300005834 | Bacteria | 1385 |
| 123 | Ga0068863_100020907 | 3300005841 | Bacteria | 6250 |
| 124 | Ga0068863_100068883 | 3300005841 | Bacteria | 3347 |
| 125 | Ga0068863_100176214 | 3300005841 | Bacteria | 2052 |
| 126 | Ga0068863_100488330 | 3300005841 | Bacteria | 1212 |
| 127 | Ga0068863_100718645 | 3300005841 | Bacteria | 993 |
| 128 | Ga0068858_100003531 | 3300005842 | Bacteria | 15485 |
| 129 | Ga0068858_100115545 | 3300005842 | Bacteria | 2508 |
| 130 | Ga0068858_100139632 | 3300005842 | Bacteria | 2274 |
| 131 | Ga0068860_100171077 | 3300005843 | Bacteria | 2098 |
| 132 | Ga0068862_100005271 | 3300005844 | Bacteria | 10842 |
| 133 | Ga0097621_100046022 | 3300006237 | Bacteria | 3528 |
| 134 | Ga0097621_100129782 | 3300006237 | Bacteria | 2144 |
| 135 | Ga0097621_100274315 | 3300006237 | Bacteria | 1483 |
| 136 | Ga0097621_100595963 | 3300006237 | Unclassified | 1010 |
| 137 | Ga0068871_100112492 | 3300006358 | Bacteria | 2291 |
| 138 | Ga0068871_100168206 | 3300006358 | Bacteria | 1878 |
| 139 | Ga0068865_100091972 | 3300006881 | Bacteria | 2203 |
| 140 | Ga0068865_100390483 | 3300006881 | Bacteria | 1137 |
| 141 | Ga0068865_100628005 | 3300006881 | Bacteria | 911 |
| 142 | Ga0097620_100000265 | 3300006931 | Bacteria | 52351 |
| 143 | Ga0097620_100558286 | 3300006931 | Bacteria | 1239 |
| 144 | Ga0105240_10002519 | 3300009093 | Bacteria | 29423 |
| 145 | Ga0105240_10013886 | 3300009093 | Bacteria | 11033 |
| 146 | Ga0105240_10121168 | 3300009093 | Bacteria | 3149 |
| 147 | Ga0105240_10133360 | 3300009093 | Bacteria | 2976 |
| 148 | Ga0105240_10176224 | 3300009093 | Bacteria | 2528 |
| 149 | Ga0105240_10284227 | 3300009093 | Bacteria | 1899 |
| 150 | Ga0105240_10836956 | 3300009093 | Bacteria | 994 |
| 151 | Ga0105240_10892805 | 3300009093 | Bacteria | 957 |
| 152 | Ga0105245_10770497 | 3300009098 | Bacteria | 999 |
| 153 | Ga0105245_10918177 | 3300009098 | Bacteria | 918 |
| 154 | Ga0105245_11000527 | 3300009098 | Bacteria | 880 |
| 155 | Ga0105247_10194962 | 3300009101 | Bacteria | 1358 |
| 156 | Ga0105243_10332491 | 3300009148 | Bacteria | 1388 |
| 157 | Ga0105241_10009542 | 3300009174 | Bacteria | 7130 |
| 158 | Ga0105241_10012626 | 3300009174 | Bacteria | 6199 |
| 159 | Ga0105241_10100166 | 3300009174 | Bacteria | 2302 |
| 160 | Ga0105241_10270023 | 3300009174 | Bacteria | 1449 |
| 161 | Ga0105241_10322248 | 3300009174 | Unclassified | 1333 |
| 162 | Ga0105241_10751397 | 3300009174 | Bacteria | 894 |
| 163 | Ga0105242_10200045 | 3300009176 | Unclassified | 1774 |
| 164 | Ga0105248_10002061 | 3300009177 | Bacteria | 22267 |
| 165 | Ga0105248_10627696 | 3300009177 | Bacteria | 1212 |
| 166 | Ga0105248_11298639 | 3300009177 | Bacteria | 823 |
| 167 | Ga0105237_10004780 | 3300009545 | Bacteria | 15572 |
| 168 | Ga0105237_10021360 | 3300009545 | Bacteria | 6656 |
| 169 | Ga0105237_10030200 | 3300009545 | Bacteria | 5507 |
| 170 | Ga0105237_10034671 | 3300009545 | Bacteria | 5108 |
| 171 | Ga0105237_10074292 | 3300009545 | Bacteria | 3392 |
| 172 | Ga0105237_10353458 | 3300009545 | Unclassified | 1474 |
| 173 | Ga0105237_10557716 | 3300009545 | Bacteria | 1152 |
| 174 | Ga0105237_10829833 | 3300009545 | Bacteria | 931 |
| 175 | Ga0105238_10007377 | 3300009551 | Bacteria | 11015 |
| 176 | Ga0105238_10015192 | 3300009551 | Bacteria | 7796 |
| 177 | Ga0105238_10016212 | 3300009551 | Bacteria | 7540 |
| 178 | Ga0105238_10223172 | 3300009551 | Bacteria | 1861 |
| 179 | Ga0105238_10314669 | 3300009551 | Bacteria | 1551 |
| 180 | Ga0105238_10554302 | 3300009551 | Bacteria | 1154 |
| 181 | Ga0105238_10685765 | 3300009551 | Bacteria | 1036 |
| 182 | Ga0105249_10002473 | 3300009553 | Bacteria | 16002 |
| 183 | Ga0105249_10005661 | 3300009553 | Bacteria | 10808 |
| 184 | Ga0105249_10020935 | 3300009553 | Bacteria | 5850 |
| 185 | Ga0105249_10530166 | 3300009553 | Bacteria | 1226 |
| 186 | Ga0105239_10010293 | 3300010375 | Bacteria | 10475 |
| 187 | Ga0105239_10023401 | 3300010375 | Bacteria | 6803 |
| 188 | Ga0105239_10038519 | 3300010375 | Bacteria | 5239 |
| 189 | Ga0105239_10046624 | 3300010375 | Bacteria | 4749 |
| 190 | Ga0105239_10079172 | 3300010375 | Bacteria | 3616 |
| 191 | Ga0105239_10909056 | 3300010375 | Bacteria | 1010 |
| 192 | Ga0105246_10179791 | 3300011119 | Bacteria | 1628 |
| 193 | Ga0157373_10088365 | 3300013100 | Bacteria | 2183 |
| 194 | Ga0157373_10526816 | 3300013100 | Unclassified | 855 |
| 195 | Ga0157371_10405423 | 3300013102 | Bacteria | 998 |
| 196 | Ga0157370_10006966 | 3300013104 | Bacteria | 12347 |
| 197 | Ga0157370_10470064 | 3300013104 | Bacteria | 1156 |
| 198 | Ga0157370_10535908 | 3300013104 | Bacteria | 1074 |
| 199 | Ga0157370_10622354 | 3300013104 | Bacteria | 988 |
| 200 | Ga0157370_10630467 | 3300013104 | Bacteria | 980 |
| 201 | Ga0157369_10049428 | 3300013105 | Bacteria | 4559 |
| 202 | Ga0157369_10063246 | 3300013105 | Bacteria | 3987 |
| 203 | Ga0157369_10102646 | 3300013105 | Bacteria | 3047 |
| 204 | Ga0157369_10306654 | 3300013105 | Bacteria | 1651 |
| 205 | Ga0157369_10633116 | 3300013105 | Bacteria | 1103 |
| 206 | Ga0157369_10818289 | 3300013105 | Bacteria | 957 |
| 207 | Ga0157369_11122139 | 3300013105 | Unclassified | 803 |
| 208 | Ga0157369_11304716 | 3300013105 | Bacteria | 740 |
| 209 | Ga0157374_10030115 | 3300013296 | Bacteria | 4925 |
| 210 | Ga0157374_10057130 | 3300013296 | Bacteria | 3644 |
| 211 | Ga0157374_10392625 | 3300013296 | Bacteria | 1383 |
| 212 | Ga0157374_11238361 | 3300013296 | Bacteria | 768 |
| 213 | Ga0157378_10000043 | 3300013297 | Bacteria | 107750 |
| 214 | Ga0163162_10000015 | 3300013306 | Bacteria | 261996 |
| 215 | Ga0157372_10004512 | 3300013307 | Bacteria | 14851 |
| 216 | Ga0157372_10007958 | 3300013307 | Bacteria | 11270 |
| 217 | Ga0157372_10031403 | 3300013307 | Bacteria | 5816 |
| 218 | Ga0157372_10182518 | 3300013307 | Bacteria | 2429 |
| 219 | Ga0157372_10491005 | 3300013307 | Bacteria | 1432 |
| 220 | Ga0157372_10963376 | 3300013307 | Bacteria | 989 |
| 221 | Ga0163163_10051824 | 3300014325 | Bacteria | 4046 |
| 222 | Ga0182008_10000116 | 3300014497 | Bacteria | 60097 |
| 223 | Ga0182008_10029602 | 3300014497 | Bacteria | 2766 |
| 224 | Ga0182008_10218456 | 3300014497 | Bacteria | 975 |
| 225 | Ga0157379_10139624 | 3300014968 | Bacteria | 2184 |
| 226 | Ga0157379_10355767 | 3300014968 | Bacteria | 1341 |
| 227 | Ga0157376_10051604 | 3300014969 | Bacteria | 3417 |
| 228 | Ga0157376_10062563 | 3300014969 | Bacteria | 3132 |
| 229 | Ga0157376_10068610 | 3300014969 | Bacteria | 3003 |
| 230 | Ga0157376_10987132 | 3300014969 | Bacteria | 864 |
| 231 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 232 | Ga0163161_10013088 | 3300017792 | Bacteria | 5766 |
| 233 | Ga0206356_10279723 | 3300020070 | Bacteria | 2448 |
| 234 | Ga0154015_1087219 | 3300020610 | Bacteria | 1905 |
| 235 | Ga0209233_1012881 | 3300025261 | Bacteria | 2408 |
| 236 | Ga0209565_1000005 | 3300025263 | Bacteria | 947317 |
| 237 | Ga0209673_1000011 | 3300025273 | Bacteria | 586604 |
| 238 | Ga0209675_1000004 | 3300025291 | Bacteria | 947166 |
| 239 | Ga0209564_1000018 | 3300025295 | Bacteria | 586913 |
| 240 | Ga0209256_1000021 | 3300025299 | Bacteria | 537097 |
| 241 | Ga0207656_10000309 | 3300025321 | Bacteria | 16926 |
| 242 | Ga0207656_10027103 | 3300025321 | Bacteria | 2341 |
| 243 | Ga0207656_10032576 | 3300025321 | Bacteria | 2166 |
| 244 | Ga0207656_10034874 | 3300025321 | Bacteria | 2103 |
| 245 | Ga0207680_10340857 | 3300025903 | Bacteria | 1051 |
| 246 | Ga0207647_10000155 | 3300025904 | Bacteria | 54186 |
| 247 | Ga0207647_10001282 | 3300025904 | Bacteria | 19326 |
| 248 | Ga0207647_10004843 | 3300025904 | Bacteria | 9954 |
| 249 | Ga0207647_10274710 | 3300025904 | Bacteria | 963 |
| 250 | Ga0207699_10766536 | 3300025906 | Bacteria | 708 |
| 251 | Ga0207705_10000837 | 3300025909 | Bacteria | 25173 |
| 252 | Ga0207705_10060809 | 3300025909 | Bacteria | 2729 |
| 253 | Ga0207705_10109883 | 3300025909 | Bacteria | 2036 |
| 254 | Ga0207705_10422183 | 3300025909 | Bacteria | 1032 |
| 255 | Ga0207705_10437883 | 3300025909 | Bacteria | 1013 |
| 256 | Ga0207654_10000597 | 3300025911 | Bacteria | 20343 |
| 257 | Ga0207654_10033897 | 3300025911 | Bacteria | 2833 |
| 258 | Ga0207654_10122740 | 3300025911 | Bacteria | 1634 |
| 259 | Ga0207654_10152213 | 3300025911 | Bacteria | 1486 |
| 260 | Ga0207654_10433815 | 3300025911 | Bacteria | 919 |
| 261 | Ga0207707_10000414 | 3300025912 | Bacteria | 44770 |
| 262 | Ga0207707_10008245 | 3300025912 | Bacteria | 9045 |
| 263 | Ga0207707_10071212 | 3300025912 | Bacteria | 3029 |
| 264 | Ga0207695_10000032 | 3300025913 | Bacteria | 521283 |
| 265 | Ga0207695_10000182 | 3300025913 | Bacteria | 184125 |
| 266 | Ga0207695_10005772 | 3300025913 | Bacteria | 16296 |
| 267 | Ga0207695_10036075 | 3300025913 | Bacteria | 5350 |
| 268 | Ga0207695_10055081 | 3300025913 | Bacteria | 4147 |
| 269 | Ga0207695_10084274 | 3300025913 | Bacteria | 3210 |
| 270 | Ga0207695_10206526 | 3300025913 | Bacteria | 1877 |
| 271 | Ga0207671_10005975 | 3300025914 | Bacteria | 11019 |
| 272 | Ga0207671_10028320 | 3300025914 | Bacteria | 4186 |
| 273 | Ga0207671_10046119 | 3300025914 | Bacteria | 3224 |
| 274 | Ga0207671_10146022 | 3300025914 | Bacteria | 1825 |
| 275 | Ga0207671_10241451 | 3300025914 | Bacteria | 1419 |
| 276 | Ga0207671_10280549 | 3300025914 | Bacteria | 1314 |
| 277 | Ga0207671_10593359 | 3300025914 | Bacteria | 883 |
| 278 | Ga0207663_10077521 | 3300025916 | Bacteria | 2163 |
| 279 | Ga0207660_10006460 | 3300025917 | Bacteria | 7602 |
| 280 | Ga0207657_10001316 | 3300025919 | Bacteria | 26382 |
| 281 | Ga0207649_10001300 | 3300025920 | Bacteria | 14891 |
| 282 | Ga0207649_10012555 | 3300025920 | Bacteria | 4705 |
| 283 | Ga0207649_10084750 | 3300025920 | Bacteria | 2061 |
| 284 | Ga0207652_10000398 | 3300025921 | Bacteria | 45285 |
| 285 | Ga0207652_10005492 | 3300025921 | Bacteria | 10282 |
| 286 | Ga0207652_10053325 | 3300025921 | Bacteria | 3474 |
| 287 | Ga0207652_10623203 | 3300025921 | Bacteria | 966 |
| 288 | Ga0207694_10008048 | 3300025924 | Bacteria | 7973 |
| 289 | Ga0207694_10008628 | 3300025924 | Bacteria | 7695 |
| 290 | Ga0207694_10352802 | 3300025924 | Bacteria | 1218 |
| 291 | Ga0207694_10547163 | 3300025924 | Bacteria | 971 |
| 292 | Ga0207650_10086706 | 3300025925 | Bacteria | 2384 |
| 293 | Ga0207687_10181620 | 3300025927 | Bacteria | 1630 |
| 294 | Ga0207687_10341029 | 3300025927 | Bacteria | 1218 |
| 295 | Ga0207644_10209768 | 3300025931 | Bacteria | 1540 |
| 296 | Ga0207690_10088241 | 3300025932 | Bacteria | 2184 |
| 297 | Ga0207706_10007442 | 3300025933 | Bacteria | 10126 |
| 298 | Ga0207706_10268303 | 3300025933 | Bacteria | 1490 |
| 299 | Ga0207704_10009199 | 3300025938 | Bacteria | 4756 |
| 300 | Ga0207704_10045149 | 3300025938 | Bacteria | 2616 |
| 301 | Ga0207691_10456877 | 3300025940 | Bacteria | 1086 |
| 302 | Ga0207711_10000470 | 3300025941 | Bacteria | 41566 |
| 303 | Ga0207689_10191281 | 3300025942 | Bacteria | 1688 |
| 304 | Ga0207689_10387409 | 3300025942 | Bacteria | 1164 |
| 305 | Ga0207661_10021296 | 3300025944 | Bacteria | 4855 |
| 306 | Ga0207661_10021754 | 3300025944 | Bacteria | 4811 |
| 307 | Ga0207679_10060576 | 3300025945 | Bacteria | 2813 |
| 308 | Ga0207679_10150222 | 3300025945 | Bacteria | 1895 |
| 309 | Ga0207679_10379102 | 3300025945 | Bacteria | 1239 |
| 310 | Ga0207667_10002731 | 3300025949 | Bacteria | 21813 |
| 311 | Ga0207667_10018341 | 3300025949 | Bacteria | 7851 |
| 312 | Ga0207667_10077615 | 3300025949 | Bacteria | 3444 |
| 313 | Ga0207667_10516289 | 3300025949 | Bacteria | 1210 |
| 314 | Ga0207667_10530301 | 3300025949 | Bacteria | 1192 |
| 315 | Ga0207651_10160758 | 3300025960 | Bacteria | 1761 |
| 316 | Ga0207712_10000771 | 3300025961 | Bacteria | 23954 |
| 317 | Ga0207712_10002780 | 3300025961 | Bacteria | 11194 |
| 318 | Ga0207712_10500971 | 3300025961 | Bacteria | 1038 |
| 319 | Ga0207668_10141913 | 3300025972 | Bacteria | 1848 |
| 320 | Ga0207640_10002921 | 3300025981 | Bacteria | 9182 |
| 321 | Ga0207640_10003183 | 3300025981 | Bacteria | 8833 |
| 322 | Ga0207640_10320024 | 3300025981 | Bacteria | 1235 |
| 323 | Ga0207658_10000006 | 3300025986 | Bacteria | 392309 |
| 324 | Ga0207658_10008000 | 3300025986 | Bacteria | 7200 |
| 325 | Ga0207658_10022079 | 3300025986 | Bacteria | 4427 |
| 326 | Ga0207658_10655445 | 3300025986 | Bacteria | 946 |
| 327 | Ga0207677_10130747 | 3300026023 | Bacteria | 1905 |
| 328 | Ga0207677_10212305 | 3300026023 | Unclassified | 1546 |
| 329 | Ga0207703_10001094 | 3300026035 | Bacteria | 25767 |
| 330 | Ga0207703_10083079 | 3300026035 | Bacteria | 2675 |
| 331 | Ga0207703_10650003 | 3300026035 | Bacteria | 1000 |
| 332 | Ga0207639_10002290 | 3300026041 | Bacteria | 12858 |
| 333 | Ga0207639_10008722 | 3300026041 | Bacteria | 6960 |
| 334 | Ga0207639_10011916 | 3300026041 | Bacteria | 6048 |
| 335 | Ga0207639_10013430 | 3300026041 | Bacteria | 5733 |
| 336 | Ga0207639_10028117 | 3300026041 | Bacteria | 4102 |
| 337 | Ga0207639_10047047 | 3300026041 | Bacteria | 3258 |
| 338 | Ga0207639_10102030 | 3300026041 | Bacteria | 2321 |
| 339 | Ga0207639_10225136 | 3300026041 | Bacteria | 1622 |
| 340 | Ga0207678_10001340 | 3300026067 | Bacteria | 22694 |
| 341 | Ga0207678_10017061 | 3300026067 | Bacteria | 6375 |
| 342 | Ga0207678_10030841 | 3300026067 | Bacteria | 4681 |
| 343 | Ga0207678_10047635 | 3300026067 | Bacteria | 3706 |
| 344 | Ga0207678_10167103 | 3300026067 | Bacteria | 1878 |
| 345 | Ga0207678_10508321 | 3300026067 | Bacteria | 1051 |
| 346 | Ga0207702_10002732 | 3300026078 | Bacteria | 16530 |
| 347 | Ga0207702_10005747 | 3300026078 | Bacteria | 10805 |
| 348 | Ga0207702_10028842 | 3300026078 | Bacteria | 4615 |
| 349 | Ga0207702_10033104 | 3300026078 | Bacteria | 4315 |
| 350 | Ga0207702_10041945 | 3300026078 | Bacteria | 3837 |
| 351 | Ga0207702_10287930 | 3300026078 | Bacteria | 1555 |
| 352 | Ga0207702_10777116 | 3300026078 | Unclassified | 946 |
| 353 | Ga0207641_10081865 | 3300026088 | Bacteria | 2804 |
| 354 | Ga0207641_10157420 | 3300026088 | Bacteria | 2062 |
| 355 | Ga0207648_10054375 | 3300026089 | Bacteria | 3497 |
| 356 | Ga0207674_10013004 | 3300026116 | Bacteria | 9275 |
| 357 | Ga0207674_10017518 | 3300026116 | Bacteria | 7815 |
| 358 | Ga0207674_10084724 | 3300026116 | Bacteria | 3167 |
| 359 | Ga0207674_10264982 | 3300026116 | Bacteria | 1666 |
| 360 | Ga0207675_100376189 | 3300026118 | Bacteria | 1396 |
| 361 | Ga0207698_10003683 | 3300026142 | Bacteria | 9264 |
| 362 | Ga0207698_10008023 | 3300026142 | Bacteria | 6656 |
| 363 | Ga0207698_10022708 | 3300026142 | Bacteria | 4368 |
| 364 | Ga0207698_10209325 | 3300026142 | Bacteria | 1753 |
| 365 | Ga0207698_11676541 | 3300026142 | Bacteria | 651 |
| 366 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 367 | Ga0268266_10000013 | 3300028379 | Bacteria | 649715 |
| 368 | Ga0268266_10035083 | 3300028379 | Bacteria | 4266 |
| 369 | Ga0268266_10459502 | 3300028379 | Bacteria | 1211 |
| 370 | Ga0268265_10003764 | 3300028380 | Bacteria | 10765 |
| 371 | Ga0268265_10446946 | 3300028380 | Bacteria | 1206 |
| 372 | Ga0268264_10061387 | 3300028381 | Bacteria | 3153 |
| 373 | Ga0316176_1202100 | 3300030732 | Bacteria | 2146 |
| 374 | Ga0307408_100034350 | 3300031548 | Bacteria | 3552 |
| 375 | Ga0307508_10010006 | 3300031616 | Bacteria | 8691 |
| 376 | Ga0307413_10263471 | 3300031824 | Bacteria | 1286 |
| 377 | Ga0307413_10498832 | 3300031824 | Bacteria | 977 |
| 378 | Ga0307406_10003052 | 3300031901 | Bacteria | 9112 |
| 379 | Ga0307414_10068734 | 3300032004 | Bacteria | 2543 |
| 380 | Ga0307411_10175880 | 3300032005 | Bacteria | 1619 |
| 381 | Ga0307507_10338174 | 3300033179 | Bacteria | 894 |
| 382 | Ga0439436_0004028 | 3300041404 | Bacteria | 4502 |
| 383 | Ga0439436_0017545 | 3300041404 | Bacteria | 2142 |
| 384 | Ga0439439_0027830 | 3300041406 | Bacteria | 1429 |
| 385 | Ga0439447_003391 | 3300041407 | Bacteria | 5664 |
| 386 | Ga0451789_0310415 | 3300041443 | Bacteria | 963 |
| 387 | Ga0451791_0013794 | 3300041451 | Bacteria | 2534 |
| 388 | Ga0451791_0250013 | 3300041451 | Bacteria | 1575 |
| 389 | Ga0451800_0983679 | 3300041459 | Bacteria | 1220 |
| 390 | Ga0451802_0598371 | 3300041460 | Bacteria | 3526 |
| 391 | Ga0451807_1606519 | 3300041486 | Bacteria | 1001 |
| 392 | Ga0451837_1385472 | 3300041494 | Bacteria | 752 |
| 393 | Ga0451841_1239236 | 3300041498 | Bacteria | 2450 |
| 394 | Ga0451841_1262016 | 3300041498 | Bacteria | 1410 |
| 395 | Ga0451853_1131241 | 3300041512 | Bacteria | 2205 |
| 396 | Ga0451853_1363320 | 3300041512 | Bacteria | 1242 |
| 397 | Ga0451853_1972459 | 3300041512 | Bacteria | 2999 |
| 398 | Ga0439433_0033238 | 3300041999 | Bacteria | 1185 |
| 399 | Ga0439449_0015453 | 3300042007 | Bacteria | 2868 |
| 400 | Ga0439462_0003666 | 3300042015 | Bacteria | 3702 |
| 401 | Ga0466972_0000993 | 3300044658 | Bacteria | 13644 |
| 402 | Ga0466970_0001822 | 3300044765 | Bacteria | 10281 |
| 403 | Ga0495638_0009055 | 3300046460 | Bacteria | 7015 |
| 404 | Ga0495631_0004079 | 3300046518 | Bacteria | 7843 |
| 405 | Ga0495663_0015309 | 3300046525 | Bacteria | 2159 |
| 406 | Ga0495663_0020718 | 3300046525 | Bacteria | 1889 |
| 407 | Ga0495622_0119116 | 3300046557 | Bacteria | 1206 |
| 408 | Ga0495668_0001422 | 3300046616 | Bacteria | 23222 |
| 409 | Ga0495674_0407958 | 3300047319 | Bacteria | 1096 |
| 410 | Ga0495686_0007599 | 3300047472 | Bacteria | 8096 |
| 411 | Ga0495593_0215093 | 3300047673 | Bacteria | 965 |
| 412 | Ga0496100_0082187 | 3300048903 | Bacteria | 2178 |
| 413 | Ga0496103_0211789 | 3300048906 | Bacteria | 1246 |
| 414 | Ga0496114_0448035 | 3300048917 | Bacteria | 1143 |
| 415 | Ga0496115_0000062 | 3300048918 | Bacteria | 100189 |
| 416 | Ga0496115_0121157 | 3300048918 | Bacteria | 2153 |
| 417 | Ga0496117_0008490 | 3300048920 | Bacteria | 9748 |
| 418 | Ga0496117_0029620 | 3300048920 | Bacteria | 4217 |
| 419 | Ga0496117_0049405 | 3300048920 | Bacteria | 2992 |
| 420 | Ga0496117_0233481 | 3300048920 | Bacteria | 1015 |
| 421 | Ga0496118_0000177 | 3300048921 | Bacteria | 114183 |
| 422 | Ga0496118_0007069 | 3300048921 | Bacteria | 12057 |
| 423 | Ga0496118_0027688 | 3300048921 | Bacteria | 4789 |
| 424 | Ga0496118_0052607 | 3300048921 | Bacteria | 3103 |
| 425 | Ga0496119_0000211 | 3300048922 | Bacteria | 83064 |
| 426 | Ga0496119_0320585 | 3300048922 | Bacteria | 759 |
| 427 | Ga0496120_0000432 | 3300048923 | Bacteria | 66285 |
| 428 | Ga0496121_0017668 | 3300048924 | Bacteria | 7261 |
| 429 | Ga0496121_0042072 | 3300048924 | Bacteria | 3981 |
| 430 | Ga0496121_0043961 | 3300048924 | Bacteria | 3861 |
| 431 | Ga0496121_0098342 | 3300048924 | Bacteria | 2265 |
| 432 | Ga0496121_0343850 | 3300048924 | Bacteria | 996 |
| 433 | Ga0496122_0000463 | 3300048925 | Bacteria | 84540 |
| 434 | Ga0496122_0006129 | 3300048925 | Bacteria | 13994 |
| 435 | Ga0496122_0144809 | 3300048925 | Bacteria | 1478 |
| 436 | Ga0496123_0000151 | 3300048926 | Bacteria | 141062 |
| 437 | Ga0496123_0000296 | 3300048926 | Bacteria | 97428 |
| 438 | Ga0496123_0218932 | 3300048926 | Bacteria | 961 |
| 439 | Ga0496124_0015478 | 3300048927 | Bacteria | 7309 |
| 440 | Ga0496124_0083776 | 3300048927 | Bacteria | 2615 |
| 441 | Ga0496125_0017369 | 3300048928 | Bacteria | 6863 |
| 442 | Ga0496125_0029116 | 3300048928 | Bacteria | 4970 |
| 443 | Ga0496125_0183282 | 3300048928 | Bacteria | 1392 |
| 444 | Ga0496126_0000057 | 3300048929 | Bacteria | 276781 |
| 445 | Ga0496126_0005495 | 3300048929 | Bacteria | 14446 |
| 446 | Ga0496126_0131107 | 3300048929 | Bacteria | 2166 |
| 447 | Ga0501032_0002234 | 3300049569 | Bacteria | 15250 |
| 448 | Ga0501032_0010768 | 3300049569 | Bacteria | 6584 |
| 449 | Ga0501032_0016320 | 3300049569 | Bacteria | 5225 |
| 450 | Ga0501033_0000324 | 3300049570 | Bacteria | 45439 |
| 451 | Ga0501033_0262203 | 3300049570 | Bacteria | 1223 |
| 452 | Ga0501033_0436190 | 3300049570 | Bacteria | 911 |
| 453 | Ga0501034_0002776 | 3300049571 | Bacteria | 20531 |
| 454 | Ga0501034_0054659 | 3300049571 | Bacteria | 4019 |
| 455 | Ga0501034_0174422 | 3300049571 | Bacteria | 2116 |
| 456 | Ga0501036_0004120 | 3300049572 | Bacteria | 11698 |
| 457 | Ga0501036_0112617 | 3300049572 | Bacteria | 2299 |
| 458 | Ga0501036_0508099 | 3300049572 | Bacteria | 1003 |
| 459 | Ga0501037_0000499 | 3300049573 | Bacteria | 31684 |
| 460 | Ga0501037_0007006 | 3300049573 | Bacteria | 8231 |
| 461 | Ga0501037_0014841 | 3300049573 | Bacteria | 5731 |
| 462 | Ga0501037_0031216 | 3300049573 | Bacteria | 3934 |
| 463 | Ga0501037_0378798 | 3300049573 | Bacteria | 973 |
| 464 | Ga0501038_0003315 | 3300049574 | Bacteria | 15016 |
| 465 | Ga0501038_0010510 | 3300049574 | Bacteria | 8465 |
| 466 | Ga0501038_0026778 | 3300049574 | Bacteria | 5133 |
| 467 | Ga0501038_0105851 | 3300049574 | Bacteria | 2336 |
| 468 | Ga0501039_0002265 | 3300049575 | Bacteria | 14289 |
| 469 | Ga0501039_0004305 | 3300049575 | Bacteria | 10732 |
| 470 | Ga0501039_0366443 | 3300049575 | Bacteria | 1132 |
| 471 | Ga0501040_0202156 | 3300049576 | Bacteria | 1411 |
| 472 | Ga0501043_0014452 | 3300049579 | Bacteria | 6179 |
| 473 | Ga0501043_0074174 | 3300049579 | Bacteria | 2672 |
| 474 | Ga0501043_0287473 | 3300049579 | Bacteria | 1259 |
| 475 | Ga0501046_0003027 | 3300049580 | Bacteria | 15530 |
| 476 | Ga0501046_0005386 | 3300049580 | Bacteria | 11437 |
| 477 | Ga0501046_0014037 | 3300049580 | Bacteria | 6765 |
| 478 | Ga0501047_0001148 | 3300049581 | Bacteria | 26260 |
| 479 | Ga0501047_0001523 | 3300049581 | Bacteria | 22634 |
| 480 | Ga0501047_0048701 | 3300049581 | Bacteria | 4092 |
| 481 | Ga0501047_0205590 | 3300049581 | Bacteria | 1828 |
| 482 | Ga0501067_0000619 | 3300049583 | Bacteria | 19144 |
| 483 | Ga0501067_0223484 | 3300049583 | Bacteria | 1049 |
| 484 | Ga0501067_0389283 | 3300049583 | Bacteria | 777 |
| 485 | Ga0501068_0005515 | 3300049584 | Bacteria | 6930 |
| 486 | Ga0501068_0013627 | 3300049584 | Bacteria | 4629 |
| 487 | Ga0501068_0252334 | 3300049584 | Bacteria | 1125 |
| 488 | Ga0501069_0004748 | 3300049585 | Bacteria | 7030 |
| 489 | Ga0501069_0040934 | 3300049585 | Bacteria | 2560 |
| 490 | Ga0501069_0062749 | 3300049585 | Bacteria | 2075 |
| 491 | Ga0501069_0062773 | 3300049585 | Bacteria | 2074 |
| 492 | Ga0501069_0064119 | 3300049585 | Bacteria | 2053 |
| 493 | Ga0501069_0411812 | 3300049585 | Bacteria | 801 |
| 494 | Ga0501070_0002328 | 3300049586 | Bacteria | 16672 |
| 495 | Ga0501070_0003167 | 3300049586 | Bacteria | 14312 |
| 496 | Ga0501070_0014124 | 3300049586 | Bacteria | 6721 |
| 497 | Ga0501070_0057508 | 3300049586 | Bacteria | 3223 |
| 498 | Ga0501070_0589532 | 3300049586 | Bacteria | 887 |
| 499 | Ga0501071_0003560 | 3300049587 | Bacteria | 9747 |
| 500 | Ga0501071_0051941 | 3300049587 | Bacteria | 2955 |
| 501 | Ga0501072_0188828 | 3300049588 | Bacteria | 1643 |
| 502 | Ga0501073_0000130 | 3300049589 | Bacteria | 48171 |
| 503 | Ga0501073_0001312 | 3300049589 | Bacteria | 18293 |
| 504 | Ga0501073_0002117 | 3300049589 | Bacteria | 14877 |
| 505 | Ga0501073_0006715 | 3300049589 | Bacteria | 8566 |
| 506 | Ga0501073_0027891 | 3300049589 | Bacteria | 4035 |
| 507 | Ga0501073_0071826 | 3300049589 | Bacteria | 2411 |
| 508 | Ga0501073_0143446 | 3300049589 | Bacteria | 1655 |
| 509 | Ga0501073_0275332 | 3300049589 | Bacteria | 1161 |
| 510 | Ga0501073_0594356 | 3300049589 | Bacteria | 764 |
| 511 | Ga0501074_0000732 | 3300049590 | Bacteria | 20611 |
| 512 | Ga0501074_0015939 | 3300049590 | Bacteria | 5466 |
| 513 | Ga0501074_0065748 | 3300049590 | Bacteria | 2609 |
| 514 | Ga0501074_0092042 | 3300049590 | Bacteria | 2171 |
| 515 | Ga0501079_0096701 | 3300049741 | Bacteria | 2289 |
| 516 | Ga0501079_0096867 | 3300049741 | Bacteria | 2287 |
| 517 | Ga0501080_0000685 | 3300049742 | Bacteria | 27092 |
| 518 | Ga0501080_0024328 | 3300049742 | Bacteria | 5615 |
| 519 | Ga0501080_0035297 | 3300049742 | Bacteria | 4667 |
| 520 | Ga0501080_0995565 | 3300049742 | Bacteria | 727 |
| 521 | Ga0501083_0085735 | 3300049744 | Bacteria | 2084 |
| 522 | Ga0501083_0377948 | 3300049744 | Bacteria | 921 |
| 523 | Ga0501266_029362 | 3300049763 | Bacteria | 779 |
| 524 | Ga0501035_0004851 | 3300049822 | Bacteria | 12751 |
| 525 | Ga0501035_0009865 | 3300049822 | Bacteria | 8863 |
| 526 | Ga0501035_0011894 | 3300049822 | Bacteria | 8054 |
| 527 | Ga0501035_0034005 | 3300049822 | Bacteria | 4633 |
| 528 | Ga0501035_0103152 | 3300049822 | Bacteria | 2502 |
| 529 | Ga0501035_0172721 | 3300049822 | Bacteria | 1866 |
| 530 | Ga0501044_0008866 | 3300049823 | Bacteria | 10995 |
| 531 | Ga0501044_0025157 | 3300049823 | Bacteria | 6312 |
| 532 | Ga0501044_0029462 | 3300049823 | Bacteria | 5788 |
| 533 | Ga0501044_0050779 | 3300049823 | Bacteria | 4278 |
| 534 | Ga0501044_0068728 | 3300049823 | Bacteria | 3608 |
| 535 | Ga0501044_0103565 | 3300049823 | Bacteria | 2860 |
| 536 | Ga0501044_0105390 | 3300049823 | Bacteria | 2832 |
| 537 | Ga0501044_0118208 | 3300049823 | Bacteria | 2654 |
| 538 | Ga0501044_0403430 | 3300049823 | Bacteria | 1279 |
| 539 | nmdc:mga0yw44_146431_c1 | 3300050492 | Bacteria | 1538 |
| 540 | Ga0500610_0003430 | 3300053079 | Bacteria | 6086 |
| 541 | Ga0500643_005173 | 3300053087 | Bacteria | 5690 |
| 542 | Ga0500651_0043511 | 3300053093 | Bacteria | 2827 |
| 543 | Ga0500597_000335 | 3300053120 | Bacteria | 9709 |
| 544 | Ga0500568_0000952 | 3300053139 | Bacteria | 19915 |
| 545 | Ga0500620_053618 | 3300053155 | Bacteria | 1358 |
| 546 | Ga0501084_0093945 | 3300054114 | Bacteria | 2518 |
| 547 | Ga0501084_0200644 | 3300054114 | Bacteria | 1683 |
| 548 | Ga0501084_0307965 | 3300054114 | Bacteria | 1338 |
| 549 | Ga0500661_001778 | 3300055283 | Bacteria | 4062 |
| 550 | Ga0501082_0012969 | 3300060353 | Bacteria | 7164 |
| 551 | Ga0501082_0087352 | 3300060353 | Bacteria | 2690 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005365 | Ga0070688_100410343 | Ga0070688_1004103432 | 162 |
| 2 | 3300005616 | Ga0068852_100149721 | Ga0068852_1001497212 | 162 |
| 3 | 3300026142 | Ga0207698_10022708 | Ga0207698_100227083 | 162 |
| 4 | 3300013296 | Ga0157374_10392625 | Ga0157374_103926252 | 165 |
| 5 | 3300005327 | Ga0070658_10044659 | Ga0070658_100446594 | 166 |
| 6 | 3300005330 | Ga0070690_100019979 | Ga0070690_1000199795 | 166 |
| 7 | 3300005334 | Ga0068869_100253637 | Ga0068869_1002536372 | 166 |
| 8 | 3300005367 | Ga0070667_100033096 | Ga0070667_1000330964 | 166 |
| 9 | 3300005458 | Ga0070681_10110836 | Ga0070681_101108362 | 166 |
| 10 | 3300005530 | Ga0070679_100235327 | Ga0070679_1002353273 | 166 |
| 11 | 3300005547 | Ga0070693_100082099 | Ga0070693_1000820993 | 166 |
| 12 | 3300005563 | Ga0068855_101161274 | Ga0068855_1011612742 | 166 |
| 13 | 3300005564 | Ga0070664_100601688 | Ga0070664_1006016882 | 166 |
| 14 | 3300005614 | Ga0068856_100172170 | Ga0068856_1001721702 | 166 |
| 15 | 3300005834 | Ga0068851_10046898 | Ga0068851_100468982 | 166 |
| 16 | 3300006881 | Ga0068865_100628005 | Ga0068865_1006280052 | 166 |
| 17 | 3300009093 | Ga0105240_10121168 | Ga0105240_101211685 | 166 |
| 18 | 3300009174 | Ga0105241_10100166 | Ga0105241_101001663 | 166 |
| 19 | 3300009551 | Ga0105238_10314669 | Ga0105238_103146691 | 166 |
| 20 | 3300013100 | Ga0157373_10526816 | Ga0157373_105268161 | 166 |
| 21 | 3300013105 | Ga0157369_10306654 | Ga0157369_103066542 | 166 |
| 22 | 3300013307 | Ga0157372_10182518 | Ga0157372_101825182 | 166 |
| 23 | 3300014497 | Ga0182008_10218456 | Ga0182008_102184562 | 166 |
| 24 | 3300025321 | Ga0207656_10034874 | Ga0207656_100348743 | 166 |
| 25 | 3300025909 | Ga0207705_10437883 | Ga0207705_104378831 | 166 |
| 26 | 3300025911 | Ga0207654_10152213 | Ga0207654_101522132 | 166 |
| 27 | 3300025919 | Ga0207657_10001316 | Ga0207657_1000131619 | 166 |
| 28 | 3300025921 | Ga0207652_10623203 | Ga0207652_106232031 | 166 |
| 29 | 3300025942 | Ga0207689_10191281 | Ga0207689_101912813 | 166 |
| 30 | 3300025945 | Ga0207679_10060576 | Ga0207679_100605764 | 166 |
| 31 | 3300025949 | Ga0207667_10077615 | Ga0207667_100776155 | 166 |
| 32 | 3300026041 | Ga0207639_10102030 | Ga0207639_101020302 | 166 |
| 33 | 3300026078 | Ga0207702_10777116 | Ga0207702_107771162 | 166 |
| 34 | 3300026116 | Ga0207674_10013004 | Ga0207674_1001300411 | 166 |
| 35 | 3300028381 | Ga0268264_10061387 | Ga0268264_100613873 | 166 |
| 36 | 3300049586 | Ga0501070_0057508 | Ga0501070_0057508_27_566 | 166 |
| 37 | 3300005719 | Ga0068861_100399547 | Ga0068861_1003995472 | 167 |
| 38 | 3300026118 | Ga0207675_100376189 | Ga0207675_1003761892 | 167 |
| 39 | 3300013297 | Ga0157378_10000043 | Ga0157378_1000004366 | 168 |
| 40 | 3300049585 | Ga0501069_0411812 | Ga0501069_0411812_72_677 | 168 |
| 41 | 3300049589 | Ga0501073_0275332 | Ga0501073_0275332_469_1074 | 168 |
| 42 | 3300005455 | Ga0070663_100040929 | Ga0070663_1000409293 | 171 |
| 43 | 3300005466 | Ga0070685_10007456 | Ga0070685_100074562 | 171 |
| 44 | 3300009093 | Ga0105240_10002519 | Ga0105240_100025196 | 171 |
| 45 | 3300009545 | Ga0105237_10021360 | Ga0105237_100213605 | 171 |
| 46 | 3300009551 | Ga0105238_10007377 | Ga0105238_100073774 | 171 |
| 47 | 3300010375 | Ga0105239_10023401 | Ga0105239_100234014 | 171 |
| 48 | 3300013307 | Ga0157372_10963376 | Ga0157372_109633762 | 171 |
| 49 | 3300025261 | Ga0209233_1012881 | Ga0209233_10128812 | 171 |
| 50 | 3300025913 | Ga0207695_10000032 | Ga0207695_1000003227 | 171 |
| 51 | 3300025914 | Ga0207671_10241451 | Ga0207671_102414512 | 171 |
| 52 | 3300025924 | Ga0207694_10008048 | Ga0207694_100080485 | 171 |
| 53 | 3300026067 | Ga0207678_10047635 | Ga0207678_100476354 | 171 |
| 54 | 3300048920 | Ga0496117_0233481 | Ga0496117_0233481_98_760 | 171 |
| 55 | 3300048921 | Ga0496118_0027688 | Ga0496118_0027688_1382_2044 | 171 |
| 56 | 3300049823 | Ga0501044_0403430 | Ga0501044_0403430_43_648 | 172 |
| 57 | 3300033179 | Ga0307507_10338174 | Ga0307507_103381741 | 173 |
| 58 | 3300046557 | Ga0495622_0119116 | Ga0495622_0119116_500_1105 | 173 |
| 59 | 3300047319 | Ga0495674_0407958 | Ga0495674_0407958_162_767 | 173 |
| 60 | 3300047673 | Ga0495593_0215093 | Ga0495593_0215093_171_776 | 173 |
| 61 | 3300005617 | Ga0068859_100558340 | Ga0068859_1005583402 | 174 |
| 62 | 3300005841 | Ga0068863_100068883 | Ga0068863_1000688833 | 174 |
| 63 | 3300006358 | Ga0068871_100168206 | Ga0068871_1001682062 | 174 |
| 64 | 3300006931 | Ga0097620_100558286 | Ga0097620_1005582862 | 174 |
| 65 | 3300009177 | Ga0105248_10627696 | Ga0105248_106276961 | 174 |
| 66 | 3300009551 | Ga0105238_10685765 | Ga0105238_106857651 | 174 |
| 67 | 3300013104 | Ga0157370_10630467 | Ga0157370_106304672 | 174 |
| 68 | 3300014969 | Ga0157376_10051604 | Ga0157376_100516043 | 174 |
| 69 | 3300025924 | Ga0207694_10352802 | Ga0207694_103528022 | 174 |
| 70 | 3300026088 | Ga0207641_10157420 | Ga0207641_101574201 | 174 |
| 71 | 3300031616 | Ga0307508_10010006 | Ga0307508_100100062 | 174 |
| 72 | 3300048906 | Ga0496103_0211789 | Ga0496103_0211789_453_1049 | 174 |
| 73 | 3300009545 | Ga0105237_10557716 | Ga0105237_105577162 | 175 |
| 74 | 3300010375 | Ga0105239_10909056 | Ga0105239_109090562 | 175 |
| 75 | 3300048903 | Ga0496100_0082187 | Ga0496100_0082187_15_635 | 175 |
| 76 | 3300005327 | Ga0070658_10097790 | Ga0070658_100977902 | 176 |
| 77 | 3300005327 | Ga0070658_10338232 | Ga0070658_103382321 | 176 |
| 78 | 3300005331 | Ga0070670_100127852 | Ga0070670_1001278522 | 176 |
| 79 | 3300005335 | Ga0070666_10025858 | Ga0070666_100258583 | 176 |
| 80 | 3300005335 | Ga0070666_10246751 | Ga0070666_102467512 | 176 |
| 81 | 3300005338 | Ga0068868_100215677 | Ga0068868_1002156772 | 176 |
| 82 | 3300005344 | Ga0070661_100005718 | Ga0070661_1000057182 | 176 |
| 83 | 3300005344 | Ga0070661_100436920 | Ga0070661_1004369202 | 176 |
| 84 | 3300005367 | Ga0070667_100058101 | Ga0070667_1000581013 | 176 |
| 85 | 3300005455 | Ga0070663_100195119 | Ga0070663_1001951192 | 176 |
| 86 | 3300005457 | Ga0070662_100021135 | Ga0070662_1000211354 | 176 |
| 87 | 3300005459 | Ga0068867_100266789 | Ga0068867_1002667892 | 176 |
| 88 | 3300005535 | Ga0070684_100608669 | Ga0070684_1006086691 | 176 |
| 89 | 3300005539 | Ga0068853_100004939 | Ga0068853_1000049394 | 176 |
| 90 | 3300005539 | Ga0068853_100145407 | Ga0068853_1001454072 | 176 |
| 91 | 3300005539 | Ga0068853_100266417 | Ga0068853_1002664172 | 176 |
| 92 | 3300005547 | Ga0070693_100233489 | Ga0070693_1002334891 | 176 |
| 93 | 3300005548 | Ga0070665_100001267 | Ga0070665_1000012679 | 176 |
| 94 | 3300005563 | Ga0068855_100013206 | Ga0068855_1000132062 | 176 |
| 95 | 3300005578 | Ga0068854_100006601 | Ga0068854_1000066012 | 176 |
| 96 | 3300005578 | Ga0068854_100334594 | Ga0068854_1003345941 | 176 |
| 97 | 3300005614 | Ga0068856_100050715 | Ga0068856_1000507155 | 176 |
| 98 | 3300005614 | Ga0068856_100285486 | Ga0068856_1002854862 | 176 |
| 99 | 3300005614 | Ga0068856_100357784 | Ga0068856_1003577842 | 176 |
| 100 | 3300005616 | Ga0068852_100012981 | Ga0068852_1000129812 | 176 |
| 101 | 3300005616 | Ga0068852_100040375 | Ga0068852_1000403754 | 176 |
| 102 | 3300005616 | Ga0068852_100180323 | Ga0068852_1001803232 | 176 |
| 103 | 3300005618 | Ga0068864_100145443 | Ga0068864_1001454433 | 176 |
| 104 | 3300005834 | Ga0068851_10002041 | Ga0068851_100020416 | 176 |
| 105 | 3300005842 | Ga0068858_100003531 | Ga0068858_1000035314 | 176 |
| 106 | 3300006237 | Ga0097621_100129782 | Ga0097621_1001297822 | 176 |
| 107 | 3300006237 | Ga0097621_100595963 | Ga0097621_1005959631 | 176 |
| 108 | 3300006358 | Ga0068871_100112492 | Ga0068871_1001124922 | 176 |
| 109 | 3300006881 | Ga0068865_100091972 | Ga0068865_1000919723 | 176 |
| 110 | 3300006881 | Ga0068865_100390483 | Ga0068865_1003904832 | 176 |
| 111 | 3300009093 | Ga0105240_10013886 | Ga0105240_100138864 | 176 |
| 112 | 3300009093 | Ga0105240_10133360 | Ga0105240_101333602 | 176 |
| 113 | 3300009098 | Ga0105245_10770497 | Ga0105245_107704971 | 176 |
| 114 | 3300009098 | Ga0105245_10918177 | Ga0105245_109181772 | 176 |
| 115 | 3300009101 | Ga0105247_10194962 | Ga0105247_101949622 | 176 |
| 116 | 3300009174 | Ga0105241_10012626 | Ga0105241_100126262 | 176 |
| 117 | 3300009174 | Ga0105241_10270023 | Ga0105241_102700231 | 176 |
| 118 | 3300009174 | Ga0105241_10322248 | Ga0105241_103222481 | 176 |
| 119 | 3300009176 | Ga0105242_10200045 | Ga0105242_102000452 | 176 |
| 120 | 3300009545 | Ga0105237_10034671 | Ga0105237_100346716 | 176 |
| 121 | 3300009545 | Ga0105237_10074292 | Ga0105237_100742922 | 176 |
| 122 | 3300009545 | Ga0105237_10353458 | Ga0105237_103534581 | 176 |
| 123 | 3300009551 | Ga0105238_10015192 | Ga0105238_100151924 | 176 |
| 124 | 3300009551 | Ga0105238_10016212 | Ga0105238_1001621210 | 176 |
| 125 | 3300009551 | Ga0105238_10554302 | Ga0105238_105543022 | 176 |
| 126 | 3300009553 | Ga0105249_10005661 | Ga0105249_100056614 | 176 |
| 127 | 3300010375 | Ga0105239_10079172 | Ga0105239_100791725 | 176 |
| 128 | 3300011119 | Ga0105246_10179791 | Ga0105246_101797912 | 176 |
| 129 | 3300013104 | Ga0157370_10470064 | Ga0157370_104700642 | 176 |
| 130 | 3300013105 | Ga0157369_10063246 | Ga0157369_100632462 | 176 |
| 131 | 3300013105 | Ga0157369_10633116 | Ga0157369_106331162 | 176 |
| 132 | 3300013296 | Ga0157374_10030115 | Ga0157374_100301156 | 176 |
| 133 | 3300013296 | Ga0157374_10057130 | Ga0157374_100571304 | 176 |
| 134 | 3300013296 | Ga0157374_11238361 | Ga0157374_112383611 | 176 |
| 135 | 3300013307 | Ga0157372_10004512 | Ga0157372_1000451210 | 176 |
| 136 | 3300013307 | Ga0157372_10031403 | Ga0157372_100314034 | 176 |
| 137 | 3300013307 | Ga0157372_10491005 | Ga0157372_104910052 | 176 |
| 138 | 3300014325 | Ga0163163_10051824 | Ga0163163_100518243 | 176 |
| 139 | 3300014968 | Ga0157379_10139624 | Ga0157379_101396243 | 176 |
| 140 | 3300014969 | Ga0157376_10062563 | Ga0157376_100625632 | 176 |
| 141 | 3300025321 | Ga0207656_10000309 | Ga0207656_100003092 | 176 |
| 142 | 3300025321 | Ga0207656_10027103 | Ga0207656_100271032 | 176 |
| 143 | 3300025904 | Ga0207647_10000155 | Ga0207647_1000015523 | 176 |
| 144 | 3300025904 | Ga0207647_10004843 | Ga0207647_100048437 | 176 |
| 145 | 3300025909 | Ga0207705_10060809 | Ga0207705_100608093 | 176 |
| 146 | 3300025909 | Ga0207705_10109883 | Ga0207705_101098832 | 176 |
| 147 | 3300025911 | Ga0207654_10033897 | Ga0207654_100338972 | 176 |
| 148 | 3300025911 | Ga0207654_10122740 | Ga0207654_101227401 | 176 |
| 149 | 3300025913 | Ga0207695_10000182 | Ga0207695_10000182174 | 176 |
| 150 | 3300025913 | Ga0207695_10005772 | Ga0207695_100057728 | 176 |
| 151 | 3300025913 | Ga0207695_10206526 | Ga0207695_102065261 | 176 |
| 152 | 3300025914 | Ga0207671_10005975 | Ga0207671_100059756 | 176 |
| 153 | 3300025914 | Ga0207671_10028320 | Ga0207671_100283204 | 176 |
| 154 | 3300025914 | Ga0207671_10046119 | Ga0207671_100461193 | 176 |
| 155 | 3300025914 | Ga0207671_10280549 | Ga0207671_102805492 | 176 |
| 156 | 3300025920 | Ga0207649_10001300 | Ga0207649_100013003 | 176 |
| 157 | 3300025924 | Ga0207694_10008628 | Ga0207694_100086284 | 176 |
| 158 | 3300025924 | Ga0207694_10547163 | Ga0207694_105471632 | 176 |
| 159 | 3300025927 | Ga0207687_10181620 | Ga0207687_101816202 | 176 |
| 160 | 3300025927 | Ga0207687_10341029 | Ga0207687_103410292 | 176 |
| 161 | 3300025931 | Ga0207644_10209768 | Ga0207644_102097682 | 176 |
| 162 | 3300025933 | Ga0207706_10007442 | Ga0207706_100074424 | 176 |
| 163 | 3300025938 | Ga0207704_10009199 | Ga0207704_100091992 | 176 |
| 164 | 3300025938 | Ga0207704_10045149 | Ga0207704_100451492 | 176 |
| 165 | 3300025945 | Ga0207679_10150222 | Ga0207679_101502223 | 176 |
| 166 | 3300025949 | Ga0207667_10002731 | Ga0207667_1000273115 | 176 |
| 167 | 3300025960 | Ga0207651_10160758 | Ga0207651_101607582 | 176 |
| 168 | 3300025961 | Ga0207712_10002780 | Ga0207712_100027805 | 176 |
| 169 | 3300025981 | Ga0207640_10003183 | Ga0207640_100031835 | 176 |
| 170 | 3300025986 | Ga0207658_10008000 | Ga0207658_100080005 | 176 |
| 171 | 3300025986 | Ga0207658_10655445 | Ga0207658_106554451 | 176 |
| 172 | 3300026023 | Ga0207677_10130747 | Ga0207677_101307473 | 176 |
| 173 | 3300026023 | Ga0207677_10212305 | Ga0207677_102123051 | 176 |
| 174 | 3300026035 | Ga0207703_10001094 | Ga0207703_1000109413 | 176 |
| 175 | 3300026041 | Ga0207639_10002290 | Ga0207639_100022905 | 176 |
| 176 | 3300026041 | Ga0207639_10008722 | Ga0207639_100087224 | 176 |
| 177 | 3300026041 | Ga0207639_10011916 | Ga0207639_100119162 | 176 |
| 178 | 3300026067 | Ga0207678_10017061 | Ga0207678_100170615 | 176 |
| 179 | 3300026078 | Ga0207702_10033104 | Ga0207702_100331043 | 176 |
| 180 | 3300026078 | Ga0207702_10041945 | Ga0207702_100419454 | 176 |
| 181 | 3300026078 | Ga0207702_10287930 | Ga0207702_102879302 | 176 |
| 182 | 3300026089 | Ga0207648_10054375 | Ga0207648_100543752 | 176 |
| 183 | 3300026116 | Ga0207674_10084724 | Ga0207674_100847244 | 176 |
| 184 | 3300026116 | Ga0207674_10264982 | Ga0207674_102649822 | 176 |
| 185 | 3300026142 | Ga0207698_10008023 | Ga0207698_100080232 | 176 |
| 186 | 3300026142 | Ga0207698_10209325 | Ga0207698_102093252 | 176 |
| 187 | 3300028379 | Ga0268266_10000013 | Ga0268266_10000013190 | 176 |
| 188 | 3300048918 | Ga0496115_0000062 | Ga0496115_0000062_62669_63265 | 176 |
| 189 | 3300048928 | Ga0496125_0183282 | Ga0496125_0183282_773_1378 | 176 |
| 190 | 3300048929 | Ga0496126_0000057 | Ga0496126_0000057_37702_38298 | 176 |
| 191 | 3300009148 | Ga0105243_10332491 | Ga0105243_103324912 | 177 |
| 192 | 3300026067 | Ga0207678_10508321 | Ga0207678_105083212 | 178 |
| 193 | 3300041498 | Ga0451841_1262016 | Ga0451841_1262016_183_788 | 178 |
| 194 | 3300005434 | Ga0070709_10077562 | Ga0070709_100775623 | 179 |
| 195 | 3300049569 | Ga0501032_0002234 | Ga0501032_0002234_4543_5232 | 179 |
| 196 | 3300049569 | Ga0501032_0010768 | Ga0501032_0010768_5036_5641 | 179 |
| 197 | 3300049571 | Ga0501034_0002776 | Ga0501034_0002776_15714_16319 | 179 |
| 198 | 3300049571 | Ga0501034_0174422 | Ga0501034_0174422_701_1390 | 179 |
| 199 | 3300049572 | Ga0501036_0112617 | Ga0501036_0112617_813_1502 | 179 |
| 200 | 3300049572 | Ga0501036_0508099 | Ga0501036_0508099_209_814 | 179 |
| 201 | 3300049573 | Ga0501037_0000499 | Ga0501037_0000499_17886_18575 | 179 |
| 202 | 3300049573 | Ga0501037_0014841 | Ga0501037_0014841_3744_4349 | 179 |
| 203 | 3300049574 | Ga0501038_0003315 | Ga0501038_0003315_2795_3484 | 179 |
| 204 | 3300049574 | Ga0501038_0026778 | Ga0501038_0026778_53_658 | 179 |
| 205 | 3300049575 | Ga0501039_0002265 | Ga0501039_0002265_9130_9819 | 179 |
| 206 | 3300049575 | Ga0501039_0366443 | Ga0501039_0366443_264_869 | 179 |
| 207 | 3300049576 | Ga0501040_0202156 | Ga0501040_0202156_322_1011 | 179 |
| 208 | 3300049579 | Ga0501043_0014452 | Ga0501043_0014452_3784_4473 | 179 |
| 209 | 3300049580 | Ga0501046_0003027 | Ga0501046_0003027_11819_12508 | 179 |
| 210 | 3300049581 | Ga0501047_0001523 | Ga0501047_0001523_6597_7202 | 179 |
| 211 | 3300049583 | Ga0501067_0000619 | Ga0501067_0000619_15910_16515 | 179 |
| 212 | 3300049583 | Ga0501067_0223484 | Ga0501067_0223484_211_816 | 179 |
| 213 | 3300049584 | Ga0501068_0013627 | Ga0501068_0013627_600_1205 | 179 |
| 214 | 3300049585 | Ga0501069_0004748 | Ga0501069_0004748_2449_3054 | 179 |
| 215 | 3300049586 | Ga0501070_0003167 | Ga0501070_0003167_7865_8470 | 179 |
| 216 | 3300049588 | Ga0501072_0188828 | Ga0501072_0188828_383_988 | 179 |
| 217 | 3300049589 | Ga0501073_0001312 | Ga0501073_0001312_4881_5486 | 179 |
| 218 | 3300049589 | Ga0501073_0002117 | Ga0501073_0002117_13970_14659 | 179 |
| 219 | 3300049590 | Ga0501074_0015939 | Ga0501074_0015939_2071_2676 | 179 |
| 220 | 3300049822 | Ga0501035_0004851 | Ga0501035_0004851_8124_8813 | 179 |
| 221 | 3300049823 | Ga0501044_0029462 | Ga0501044_0029462_3993_4598 | 179 |
| 222 | 3300049823 | Ga0501044_0105390 | Ga0501044_0105390_377_1066 | 179 |
| 223 | 3300054114 | Ga0501084_0200644 | Ga0501084_0200644_876_1481 | 179 |
| 224 | 3300055283 | Ga0500661_001778 | Ga0500661_001778_1553_2158 | 179 |
| 225 | 3300060353 | Ga0501082_0087352 | Ga0501082_0087352_136_741 | 179 |
| 226 | 3300005347 | Ga0070668_100038823 | Ga0070668_1000388235 | 180 |
| 227 | 3300005617 | Ga0068859_100000265 | Ga0068859_10000026518 | 180 |
| 228 | 3300005834 | Ga0068851_10125179 | Ga0068851_101251792 | 180 |
| 229 | 3300005841 | Ga0068863_100020907 | Ga0068863_1000209077 | 180 |
| 230 | 3300006931 | Ga0097620_100000265 | Ga0097620_10000026518 | 180 |
| 231 | 3300009545 | Ga0105237_10030200 | Ga0105237_100302003 | 180 |
| 232 | 3300010375 | Ga0105239_10010293 | Ga0105239_100102937 | 180 |
| 233 | 3300013105 | Ga0157369_11304716 | Ga0157369_113047162 | 180 |
| 234 | 3300025914 | Ga0207671_10146022 | Ga0207671_101460222 | 180 |
| 235 | 3300025972 | Ga0207668_10141913 | Ga0207668_101419132 | 180 |
| 236 | 3300026088 | Ga0207641_10081865 | Ga0207641_100818652 | 180 |
| 237 | 3300053093 | Ga0500651_0043511 | Ga0500651_0043511_1170_1775 | 180 |
| 238 | 3300009174 | Ga0105241_10009542 | Ga0105241_100095425 | 182 |
| 239 | 3300013104 | Ga0157370_10535908 | Ga0157370_105359082 | 182 |
| 240 | 3300025911 | Ga0207654_10000597 | Ga0207654_1000059723 | 182 |
| 241 | 3300049573 | Ga0501037_0378798 | Ga0501037_0378798_283_888 | 182 |
| 242 | 3300049589 | Ga0501073_0027891 | Ga0501073_0027891_1522_2127 | 182 |
| 243 | 3300049742 | Ga0501080_0024328 | Ga0501080_0024328_428_1033 | 182 |
| 244 | 3300005577 | Ga0068857_100104071 | Ga0068857_1001040712 | 183 |
| 245 | 3300048920 | Ga0496117_0008490 | Ga0496117_0008490_4980_5585 | 183 |
| 246 | 3300048921 | Ga0496118_0007069 | Ga0496118_0007069_58_663 | 183 |
| 247 | iso_pu_bacteria | 2571042365 | 2572256234 | 183 |
| 248 | iso_pu_bacteria | 2576861471 | 2578458835 | 183 |
| 249 | iso_pu_bacteria | 2643221559 | 2643815724 | 183 |
| 250 | iso_pu_bacteria | 2643221573 | 2643878162 | 183 |
| 251 | iso_pu_bacteria | 2643221586 | 2643940771 | 183 |
| 252 | iso_pu_bacteria | 2643221593 | 2643975591 | 183 |
| 253 | iso_pu_bacteria | 2643221612 | 2644080182 | 183 |
| 254 | iso_pu_bacteria | 2643221695 | 2644528554 | 183 |
| 255 | iso_pu_bacteria | 2643221720 | 2644659467 | 183 |
| 256 | iso_pu_bacteria | 2643221727 | 2644695778 | 183 |
| 257 | iso_pu_bacteria | 2643221728 | 2644700784 | 183 |
| 258 | iso_pu_bacteria | 2765235840 | 2765578551 | 183 |
| 259 | iso_pu_bacteria | 2816332141 | 2816516628 | 183 |
| 260 | iso_pu_bacteria | 2842391507 | 2842392720 | 183 |
| 261 | iso_pu_bacteria | 2852649853 | 2852651191 | 183 |
| 262 | iso_pu_bacteria | 2857442823 | 2857445338 | 183 |
| 263 | iso_pu_bacteria | 2874220319 | 2874221180 | 183 |
| 264 | iso_pu_bacteria | 2895498888 | 2895499340 | 183 |
| 265 | iso_pu_bacteria | 2895511927 | 2895512361 | 183 |
| 266 | iso_pu_bacteria | 2895522137 | 2895522373 | 183 |
| 267 | iso_pu_bacteria | 2895525241 | 2895527187 | 183 |
| 268 | iso_pu_bacteria | 2919089067 | 2919092565 | 183 |
| 269 | iso_pu_bacteria | 2919134579 | 2919136270 | 183 |
| 270 | iso_pu_bacteria | 2928496128 | 2928496149 | 183 |
| 271 | iso_pu_bacteria | 2931380184 | 2931381178 | 183 |
| 272 | iso_pu_bacteria | 2937610967 | 2937612000 | 183 |
| 273 | iso_pu_bacteria | 2939589442 | 2939590646 | 183 |
| 274 | iso_pu_bacteria | 2939622612 | 2939622823 | 183 |
| 275 | iso_pu_bacteria | 2939626828 | 2939629732 | 183 |
| 276 | iso_pu_bacteria | 2941475908 | 2941477866 | 183 |
| 277 | iso_pu_bacteria | 2961047084 | 2961047945 | 183 |
| 278 | iso_pu_bacteria | 2961064222 | 2961065661 | 183 |
| 279 | iso_pu_bacteria | 2974307012 | 2974309306 | 183 |
| 280 | iso_pu_bacteria | 2977247770 | 2977250027 | 183 |
| 281 | iso_pu_bacteria | 2984514374 | 2984515484 | 183 |
| 282 | iso_pu_bacteria | 2987605356 | 2987605917 | 183 |
| 283 | iso_pu_bacteria | 8002869464 | 8002871574 | 183 |
| 284 | 3300005616 | Ga0068852_100149129 | Ga0068852_1001491292 | 184 |
| 285 | 3300009093 | Ga0105240_10836956 | Ga0105240_108369561 | 184 |
| 286 | 3300013306 | Ga0163162_10000015 | Ga0163162_10000015138 | 184 |
| 287 | 3300041512 | Ga0451853_1363320 | Ga0451853_1363320_195_791 | 184 |
| 288 | 3300041494 | Ga0451837_1385472 | Ga0451837_1385472_36_635 | 185 |
| 289 | iso_pu_bacteria | 2941489479 | 2941491708 | 185 |
| 290 | iso_pu_bacteria | 2995948881 | 2995952670 | 185 |
| 291 | 3300001904 | JGI24736J21556_1018268 | JGI24736J21556_10182682 | 187 |
| 292 | 3300001915 | JGI24741J21665_1009554 | JGI24741J21665_10095542 | 187 |
| 293 | 3300001979 | JGI24740J21852_10003881 | JGI24740J21852_100038817 | 187 |
| 294 | 3300003771 | Ga0055526_1000011 | Ga0055526_1000011162 | 187 |
| 295 | 3300003773 | Ga0055537_1000443 | Ga0055537_100044319 | 187 |
| 296 | 3300003773 | Ga0055537_1000588 | Ga0055537_10005882 | 187 |
| 297 | 3300003775 | Ga0055524_1000034 | Ga0055524_1000034116 | 187 |
| 298 | 3300003784 | Ga0055534_1000013 | Ga0055534_100001387 | 187 |
| 299 | 3300003790 | Ga0055528_1000005 | Ga0055528_1000005162 | 187 |
| 300 | 3300005327 | Ga0070658_10096006 | Ga0070658_100960063 | 187 |
| 301 | 3300005327 | Ga0070658_10783099 | Ga0070658_107830991 | 187 |
| 302 | 3300005328 | Ga0070676_10439947 | Ga0070676_104399471 | 187 |
| 303 | 3300005329 | Ga0070683_100002771 | Ga0070683_1000027719 | 187 |
| 304 | 3300005329 | Ga0070683_100041570 | Ga0070683_1000415703 | 187 |
| 305 | 3300005334 | Ga0068869_100140603 | Ga0068869_1001406032 | 187 |
| 306 | 3300005334 | Ga0068869_100402022 | Ga0068869_1004020222 | 187 |
| 307 | 3300005336 | Ga0070680_100127303 | Ga0070680_1001273032 | 187 |
| 308 | 3300005337 | Ga0070682_100179534 | Ga0070682_1001795343 | 187 |
| 309 | 3300005339 | Ga0070660_100026814 | Ga0070660_1000268143 | 187 |
| 310 | 3300005339 | Ga0070660_100734745 | Ga0070660_1007347452 | 187 |
| 311 | 3300005344 | Ga0070661_100109934 | Ga0070661_1001099343 | 187 |
| 312 | 3300005345 | Ga0070692_10001616 | Ga0070692_100016169 | 187 |
| 313 | 3300005355 | Ga0070671_101072813 | Ga0070671_1010728131 | 187 |
| 314 | 3300005366 | Ga0070659_100598777 | Ga0070659_1005987772 | 187 |
| 315 | 3300005367 | Ga0070667_100000005 | Ga0070667_10000000594 | 187 |
| 316 | 3300005367 | Ga0070667_100043517 | Ga0070667_1000435174 | 187 |
| 317 | 3300005367 | Ga0070667_100053111 | Ga0070667_1000531112 | 187 |
| 318 | 3300005367 | Ga0070667_100136551 | Ga0070667_1001365512 | 187 |
| 319 | 3300005367 | Ga0070667_100247707 | Ga0070667_1002477072 | 187 |
| 320 | 3300005367 | Ga0070667_100474018 | Ga0070667_1004740182 | 187 |
| 321 | 3300005439 | Ga0070711_100076603 | Ga0070711_1000766033 | 187 |
| 322 | 3300005455 | Ga0070663_100006105 | Ga0070663_1000061055 | 187 |
| 323 | 3300005455 | Ga0070663_100009056 | Ga0070663_1000090568 | 187 |
| 324 | 3300005455 | Ga0070663_100057050 | Ga0070663_1000570503 | 187 |
| 325 | 3300005455 | Ga0070663_100122012 | Ga0070663_1001220122 | 187 |
| 326 | 3300005455 | Ga0070663_100248663 | Ga0070663_1002486632 | 187 |
| 327 | 3300005455 | Ga0070663_100384492 | Ga0070663_1003844922 | 187 |
| 328 | 3300005455 | Ga0070663_100887311 | Ga0070663_1008873111 | 187 |
| 329 | 3300005458 | Ga0070681_10166299 | Ga0070681_101662992 | 187 |
| 330 | 3300005518 | Ga0070699_100754394 | Ga0070699_1007543942 | 187 |
| 331 | 3300005530 | Ga0070679_100005021 | Ga0070679_1000050213 | 187 |
| 332 | 3300005535 | Ga0070684_100012322 | Ga0070684_1000123221 | 187 |
| 333 | 3300005535 | Ga0070684_100425920 | Ga0070684_1004259201 | 187 |
| 334 | 3300005539 | Ga0068853_100003367 | Ga0068853_1000033679 | 187 |
| 335 | 3300005539 | Ga0068853_100009317 | Ga0068853_10000931710 | 187 |
| 336 | 3300005539 | Ga0068853_100023295 | Ga0068853_1000232954 | 187 |
| 337 | 3300005539 | Ga0068853_100073316 | Ga0068853_1000733163 | 187 |
| 338 | 3300005539 | Ga0068853_100324629 | Ga0068853_1003246292 | 187 |
| 339 | 3300005546 | Ga0070696_100188893 | Ga0070696_1001888934 | 187 |
| 340 | 3300005547 | Ga0070693_100005909 | Ga0070693_1000059097 | 187 |
| 341 | 3300005548 | Ga0070665_100000062 | Ga0070665_10000006297 | 187 |
| 342 | 3300005548 | Ga0070665_100013310 | Ga0070665_10001331012 | 187 |
| 343 | 3300005548 | Ga0070665_100039150 | Ga0070665_1000391504 | 187 |
| 344 | 3300005548 | Ga0070665_100059354 | Ga0070665_1000593546 | 187 |
| 345 | 3300005548 | Ga0070665_100176464 | Ga0070665_1001764642 | 187 |
| 346 | 3300005548 | Ga0070665_100191901 | Ga0070665_1001919013 | 187 |
| 347 | 3300005563 | Ga0068855_100024470 | Ga0068855_1000244707 | 187 |
| 348 | 3300005563 | Ga0068855_100108560 | Ga0068855_1001085602 | 187 |
| 349 | 3300005563 | Ga0068855_100261978 | Ga0068855_1002619784 | 187 |
| 350 | 3300005563 | Ga0068855_100295291 | Ga0068855_1002952913 | 187 |
| 351 | 3300005577 | Ga0068857_100026469 | Ga0068857_1000264694 | 187 |
| 352 | 3300005578 | Ga0068854_100195754 | Ga0068854_1001957542 | 187 |
| 353 | 3300005578 | Ga0068854_100257698 | Ga0068854_1002576982 | 187 |
| 354 | 3300005614 | Ga0068856_100033308 | Ga0068856_1000333085 | 187 |
| 355 | 3300005614 | Ga0068856_100039774 | Ga0068856_1000397745 | 187 |
| 356 | 3300005614 | Ga0068856_100434213 | Ga0068856_1004342133 | 187 |
| 357 | 3300005614 | Ga0068856_100826099 | Ga0068856_1008260991 | 187 |
| 358 | 3300005616 | Ga0068852_100017034 | Ga0068852_1000170347 | 187 |
| 359 | 3300005616 | Ga0068852_100959965 | Ga0068852_1009599652 | 187 |
| 360 | 3300005616 | Ga0068852_101544267 | Ga0068852_1015442671 | 187 |
| 361 | 3300005841 | Ga0068863_100176214 | Ga0068863_1001762143 | 187 |
| 362 | 3300005841 | Ga0068863_100488330 | Ga0068863_1004883302 | 187 |
| 363 | 3300005841 | Ga0068863_100718645 | Ga0068863_1007186452 | 187 |
| 364 | 3300005842 | Ga0068858_100115545 | Ga0068858_1001155454 | 187 |
| 365 | 3300005842 | Ga0068858_100139632 | Ga0068858_1001396323 | 187 |
| 366 | 3300005843 | Ga0068860_100171077 | Ga0068860_1001710773 | 187 |
| 367 | 3300005844 | Ga0068862_100005271 | Ga0068862_10000527113 | 187 |
| 368 | 3300006237 | Ga0097621_100046022 | Ga0097621_1000460225 | 187 |
| 369 | 3300006237 | Ga0097621_100274315 | Ga0097621_1002743152 | 187 |
| 370 | 3300009093 | Ga0105240_10176224 | Ga0105240_101762242 | 187 |
| 371 | 3300009093 | Ga0105240_10284227 | Ga0105240_102842272 | 187 |
| 372 | 3300009093 | Ga0105240_10892805 | Ga0105240_108928052 | 187 |
| 373 | 3300009098 | Ga0105245_11000527 | Ga0105245_110005272 | 187 |
| 374 | 3300009174 | Ga0105241_10751397 | Ga0105241_107513972 | 187 |
| 375 | 3300009177 | Ga0105248_10002061 | Ga0105248_1000206116 | 187 |
| 376 | 3300009177 | Ga0105248_11298639 | Ga0105248_112986391 | 187 |
| 377 | 3300009545 | Ga0105237_10004780 | Ga0105237_1000478013 | 187 |
| 378 | 3300009545 | Ga0105237_10829833 | Ga0105237_108298331 | 187 |
| 379 | 3300009551 | Ga0105238_10223172 | Ga0105238_102231722 | 187 |
| 380 | 3300009553 | Ga0105249_10002473 | Ga0105249_1000247313 | 187 |
| 381 | 3300009553 | Ga0105249_10020935 | Ga0105249_100209356 | 187 |
| 382 | 3300009553 | Ga0105249_10530166 | Ga0105249_105301662 | 187 |
| 383 | 3300010375 | Ga0105239_10038519 | Ga0105239_100385195 | 187 |
| 384 | 3300010375 | Ga0105239_10046624 | Ga0105239_100466246 | 187 |
| 385 | 3300013100 | Ga0157373_10088365 | Ga0157373_100883653 | 187 |
| 386 | 3300013102 | Ga0157371_10405423 | Ga0157371_104054232 | 187 |
| 387 | 3300013104 | Ga0157370_10006966 | Ga0157370_100069669 | 187 |
| 388 | 3300013104 | Ga0157370_10622354 | Ga0157370_106223542 | 187 |
| 389 | 3300013105 | Ga0157369_10049428 | Ga0157369_100494283 | 187 |
| 390 | 3300013105 | Ga0157369_10102646 | Ga0157369_101026462 | 187 |
| 391 | 3300013105 | Ga0157369_10818289 | Ga0157369_108182892 | 187 |
| 392 | 3300013105 | Ga0157369_11122139 | Ga0157369_111221391 | 187 |
| 393 | 3300013307 | Ga0157372_10007958 | Ga0157372_1000795810 | 187 |
| 394 | 3300014497 | Ga0182008_10000116 | Ga0182008_1000011665 | 187 |
| 395 | 3300014497 | Ga0182008_10029602 | Ga0182008_100296024 | 187 |
| 396 | 3300014968 | Ga0157379_10355767 | Ga0157379_103557672 | 187 |
| 397 | 3300014969 | Ga0157376_10068610 | Ga0157376_100686104 | 187 |
| 398 | 3300014969 | Ga0157376_10987132 | Ga0157376_109871321 | 187 |
| 399 | 3300015689 | Ga0183360_10001 | Ga0183360_10001541 | 187 |
| 400 | 3300017792 | Ga0163161_10013088 | Ga0163161_100130885 | 187 |
| 401 | 3300020070 | Ga0206356_10279723 | Ga0206356_102797232 | 187 |
| 402 | 3300020610 | Ga0154015_1087219 | Ga0154015_10872192 | 187 |
| 403 | 3300025263 | Ga0209565_1000005 | Ga0209565_1000005569 | 187 |
| 404 | 3300025273 | Ga0209673_1000011 | Ga0209673_1000011224 | 187 |
| 405 | 3300025291 | Ga0209675_1000004 | Ga0209675_1000004569 | 187 |
| 406 | 3300025295 | Ga0209564_1000018 | Ga0209564_1000018224 | 187 |
| 407 | 3300025299 | Ga0209256_1000021 | Ga0209256_1000021172 | 187 |
| 408 | 3300025321 | Ga0207656_10032576 | Ga0207656_100325763 | 187 |
| 409 | 3300025903 | Ga0207680_10340857 | Ga0207680_103408571 | 187 |
| 410 | 3300025904 | Ga0207647_10001282 | Ga0207647_1000128213 | 187 |
| 411 | 3300025904 | Ga0207647_10274710 | Ga0207647_102747101 | 187 |
| 412 | 3300025906 | Ga0207699_10766536 | Ga0207699_107665361 | 187 |
| 413 | 3300025909 | Ga0207705_10000837 | Ga0207705_1000083719 | 187 |
| 414 | 3300025909 | Ga0207705_10422183 | Ga0207705_104221831 | 187 |
| 415 | 3300025911 | Ga0207654_10433815 | Ga0207654_104338152 | 187 |
| 416 | 3300025912 | Ga0207707_10000414 | Ga0207707_100004143 | 187 |
| 417 | 3300025912 | Ga0207707_10008245 | Ga0207707_100082459 | 187 |
| 418 | 3300025912 | Ga0207707_10071212 | Ga0207707_100712123 | 187 |
| 419 | 3300025913 | Ga0207695_10036075 | Ga0207695_100360753 | 187 |
| 420 | 3300025913 | Ga0207695_10055081 | Ga0207695_100550816 | 187 |
| 421 | 3300025913 | Ga0207695_10084274 | Ga0207695_100842744 | 187 |
| 422 | 3300025914 | Ga0207671_10593359 | Ga0207671_105933592 | 187 |
| 423 | 3300025916 | Ga0207663_10077521 | Ga0207663_100775212 | 187 |
| 424 | 3300025917 | Ga0207660_10006460 | Ga0207660_100064607 | 187 |
| 425 | 3300025920 | Ga0207649_10012555 | Ga0207649_100125553 | 187 |
| 426 | 3300025920 | Ga0207649_10084750 | Ga0207649_100847503 | 187 |
| 427 | 3300025921 | Ga0207652_10000398 | Ga0207652_1000039837 | 187 |
| 428 | 3300025921 | Ga0207652_10005492 | Ga0207652_100054929 | 187 |
| 429 | 3300025921 | Ga0207652_10053325 | Ga0207652_100533252 | 187 |
| 430 | 3300025925 | Ga0207650_10086706 | Ga0207650_100867063 | 187 |
| 431 | 3300025932 | Ga0207690_10088241 | Ga0207690_100882413 | 187 |
| 432 | 3300025933 | Ga0207706_10268303 | Ga0207706_102683032 | 187 |
| 433 | 3300025940 | Ga0207691_10456877 | Ga0207691_104568771 | 187 |
| 434 | 3300025941 | Ga0207711_10000470 | Ga0207711_1000047010 | 187 |
| 435 | 3300025942 | Ga0207689_10387409 | Ga0207689_103874092 | 187 |
| 436 | 3300025944 | Ga0207661_10021296 | Ga0207661_100212966 | 187 |
| 437 | 3300025944 | Ga0207661_10021754 | Ga0207661_100217546 | 187 |
| 438 | 3300025945 | Ga0207679_10379102 | Ga0207679_103791022 | 187 |
| 439 | 3300025949 | Ga0207667_10018341 | Ga0207667_100183416 | 187 |
| 440 | 3300025949 | Ga0207667_10516289 | Ga0207667_105162892 | 187 |
| 441 | 3300025949 | Ga0207667_10530301 | Ga0207667_105303011 | 187 |
| 442 | 3300025961 | Ga0207712_10000771 | Ga0207712_1000077119 | 187 |
| 443 | 3300025961 | Ga0207712_10500971 | Ga0207712_105009711 | 187 |
| 444 | 3300025981 | Ga0207640_10002921 | Ga0207640_1000292110 | 187 |
| 445 | 3300025981 | Ga0207640_10320024 | Ga0207640_103200241 | 187 |
| 446 | 3300025986 | Ga0207658_10000006 | Ga0207658_10000006278 | 187 |
| 447 | 3300025986 | Ga0207658_10022079 | Ga0207658_100220793 | 187 |
| 448 | 3300026035 | Ga0207703_10083079 | Ga0207703_100830794 | 187 |
| 449 | 3300026035 | Ga0207703_10650003 | Ga0207703_106500032 | 187 |
| 450 | 3300026041 | Ga0207639_10013430 | Ga0207639_100134303 | 187 |
| 451 | 3300026041 | Ga0207639_10028117 | Ga0207639_100281177 | 187 |
| 452 | 3300026041 | Ga0207639_10047047 | Ga0207639_100470474 | 187 |
| 453 | 3300026041 | Ga0207639_10225136 | Ga0207639_102251362 | 187 |
| 454 | 3300026067 | Ga0207678_10001340 | Ga0207678_1000134016 | 187 |
| 455 | 3300026067 | Ga0207678_10030841 | Ga0207678_100308412 | 187 |
| 456 | 3300026067 | Ga0207678_10167103 | Ga0207678_101671032 | 187 |
| 457 | 3300026078 | Ga0207702_10002732 | Ga0207702_1000273213 | 187 |
| 458 | 3300026078 | Ga0207702_10005747 | Ga0207702_1000574711 | 187 |
| 459 | 3300026078 | Ga0207702_10028842 | Ga0207702_100288423 | 187 |
| 460 | 3300026116 | Ga0207674_10017518 | Ga0207674_100175186 | 187 |
| 461 | 3300026142 | Ga0207698_10003683 | Ga0207698_100036839 | 187 |
| 462 | 3300026142 | Ga0207698_11676541 | Ga0207698_116765411 | 187 |
| 463 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000011775 | 187 |
| 464 | 3300028379 | Ga0268266_10035083 | Ga0268266_100350832 | 187 |
| 465 | 3300028379 | Ga0268266_10459502 | Ga0268266_104595022 | 187 |
| 466 | 3300028380 | Ga0268265_10003764 | Ga0268265_1000376413 | 187 |
| 467 | 3300028380 | Ga0268265_10446946 | Ga0268265_104469462 | 187 |
| 468 | 3300030732 | Ga0316176_1202100 | Ga0316176_12021002 | 187 |
| 469 | 3300031548 | Ga0307408_100034350 | Ga0307408_1000343503 | 187 |
| 470 | 3300031824 | Ga0307413_10263471 | Ga0307413_102634712 | 187 |
| 471 | 3300031824 | Ga0307413_10498832 | Ga0307413_104988322 | 187 |
| 472 | 3300031901 | Ga0307406_10003052 | Ga0307406_100030521 | 187 |
| 473 | 3300032004 | Ga0307414_10068734 | Ga0307414_100687343 | 187 |
| 474 | 3300032005 | Ga0307411_10175880 | Ga0307411_101758802 | 187 |
| 475 | 3300041404 | Ga0439436_0004028 | Ga0439436_0004028_1370_1987 | 187 |
| 476 | 3300041404 | Ga0439436_0017545 | Ga0439436_0017545_1036_1650 | 187 |
| 477 | 3300041406 | Ga0439439_0027830 | Ga0439439_0027830_579_1196 | 187 |
| 478 | 3300041407 | Ga0439447_003391 | Ga0439447_003391_4572_5183 | 187 |
| 479 | 3300041443 | Ga0451789_0310415 | Ga0451789_0310415_153_758 | 187 |
| 480 | 3300041451 | Ga0451791_0013794 | Ga0451791_0013794_1359_1964 | 187 |
| 481 | 3300041451 | Ga0451791_0250013 | Ga0451791_0250013_900_1505 | 187 |
| 482 | 3300041459 | Ga0451800_0983679 | Ga0451800_0983679_74_679 | 187 |
| 483 | 3300041460 | Ga0451802_0598371 | Ga0451802_0598371_2394_2999 | 187 |
| 484 | 3300041486 | Ga0451807_1606519 | Ga0451807_1606519_335_940 | 187 |
| 485 | 3300041498 | Ga0451841_1239236 | Ga0451841_1239236_1270_1884 | 187 |
| 486 | 3300041512 | Ga0451853_1131241 | Ga0451853_1131241_1481_2086 | 187 |
| 487 | 3300041512 | Ga0451853_1972459 | Ga0451853_1972459_294_899 | 187 |
| 488 | 3300041999 | Ga0439433_0033238 | Ga0439433_0033238_399_1016 | 187 |
| 489 | 3300042007 | Ga0439449_0015453 | Ga0439449_0015453_815_1432 | 187 |
| 490 | 3300042015 | Ga0439462_0003666 | Ga0439462_0003666_231_848 | 187 |
| 491 | 3300044658 | Ga0466972_0000993 | Ga0466972_0000993_272_877 | 187 |
| 492 | 3300044765 | Ga0466970_0001822 | Ga0466970_0001822_154_759 | 187 |
| 493 | 3300046460 | Ga0495638_0009055 | Ga0495638_0009055_2696_3310 | 187 |
| 494 | 3300046518 | Ga0495631_0004079 | Ga0495631_0004079_5190_5804 | 187 |
| 495 | 3300046525 | Ga0495663_0015309 | Ga0495663_0015309_862_1476 | 187 |
| 496 | 3300046525 | Ga0495663_0020718 | Ga0495663_0020718_532_1143 | 187 |
| 497 | 3300046616 | Ga0495668_0001422 | Ga0495668_0001422_16144_16755 | 187 |
| 498 | 3300047472 | Ga0495686_0007599 | Ga0495686_0007599_4282_4887 | 187 |
| 499 | 3300048917 | Ga0496114_0448035 | Ga0496114_0448035_377_982 | 187 |
| 500 | 3300048918 | Ga0496115_0121157 | Ga0496115_0121157_1259_1864 | 187 |
| 501 | 3300048920 | Ga0496117_0029620 | Ga0496117_0029620_2250_2855 | 187 |
| 502 | 3300048920 | Ga0496117_0049405 | Ga0496117_0049405_1612_2226 | 187 |
| 503 | 3300048921 | Ga0496118_0000177 | Ga0496118_0000177_6911_7516 | 187 |
| 504 | 3300048921 | Ga0496118_0052607 | Ga0496118_0052607_2392_3006 | 187 |
| 505 | 3300048922 | Ga0496119_0000211 | Ga0496119_0000211_3622_4236 | 187 |
| 506 | 3300048922 | Ga0496119_0320585 | Ga0496119_0320585_69_674 | 187 |
| 507 | 3300048923 | Ga0496120_0000432 | Ga0496120_0000432_62925_63539 | 187 |
| 508 | 3300048924 | Ga0496121_0017668 | Ga0496121_0017668_5750_6367 | 187 |
| 509 | 3300048924 | Ga0496121_0042072 | Ga0496121_0042072_784_1398 | 187 |
| 510 | 3300048924 | Ga0496121_0043961 | Ga0496121_0043961_1668_2282 | 187 |
| 511 | 3300048924 | Ga0496121_0098342 | Ga0496121_0098342_99_704 | 187 |
| 512 | 3300048924 | Ga0496121_0343850 | Ga0496121_0343850_361_966 | 187 |
| 513 | 3300048925 | Ga0496122_0000463 | Ga0496122_0000463_1353_1958 | 187 |
| 514 | 3300048925 | Ga0496122_0006129 | Ga0496122_0006129_10493_11107 | 187 |
| 515 | 3300048925 | Ga0496122_0144809 | Ga0496122_0144809_305_919 | 187 |
| 516 | 3300048926 | Ga0496123_0000151 | Ga0496123_0000151_137554_138168 | 187 |
| 517 | 3300048926 | Ga0496123_0000296 | Ga0496123_0000296_57220_57825 | 187 |
| 518 | 3300048926 | Ga0496123_0218932 | Ga0496123_0218932_43_657 | 187 |
| 519 | 3300048927 | Ga0496124_0015478 | Ga0496124_0015478_5070_5684 | 187 |
| 520 | 3300048927 | Ga0496124_0083776 | Ga0496124_0083776_395_1009 | 187 |
| 521 | 3300048928 | Ga0496125_0017369 | Ga0496125_0017369_1261_1875 | 187 |
| 522 | 3300048928 | Ga0496125_0029116 | Ga0496125_0029116_3626_4240 | 187 |
| 523 | 3300048929 | Ga0496126_0005495 | Ga0496126_0005495_2736_3350 | 187 |
| 524 | 3300048929 | Ga0496126_0131107 | Ga0496126_0131107_478_1083 | 187 |
| 525 | 3300049569 | Ga0501032_0016320 | Ga0501032_0016320_2711_3316 | 187 |
| 526 | 3300049570 | Ga0501033_0000324 | Ga0501033_0000324_15636_16241 | 187 |
| 527 | 3300049570 | Ga0501033_0262203 | Ga0501033_0262203_30_632 | 187 |
| 528 | 3300049570 | Ga0501033_0436190 | Ga0501033_0436190_35_637 | 187 |
| 529 | 3300049571 | Ga0501034_0054659 | Ga0501034_0054659_840_1445 | 187 |
| 530 | 3300049572 | Ga0501036_0004120 | Ga0501036_0004120_6690_7295 | 187 |
| 531 | 3300049573 | Ga0501037_0007006 | Ga0501037_0007006_4935_5540 | 187 |
| 532 | 3300049573 | Ga0501037_0031216 | Ga0501037_0031216_1394_1996 | 187 |
| 533 | 3300049574 | Ga0501038_0010510 | Ga0501038_0010510_6690_7295 | 187 |
| 534 | 3300049574 | Ga0501038_0105851 | Ga0501038_0105851_695_1300 | 187 |
| 535 | 3300049575 | Ga0501039_0004305 | Ga0501039_0004305_1413_2018 | 187 |
| 536 | 3300049579 | Ga0501043_0074174 | Ga0501043_0074174_378_983 | 187 |
| 537 | 3300049579 | Ga0501043_0287473 | Ga0501043_0287473_218_820 | 187 |
| 538 | 3300049580 | Ga0501046_0005386 | Ga0501046_0005386_1999_2604 | 187 |
| 539 | 3300049580 | Ga0501046_0014037 | Ga0501046_0014037_4657_5262 | 187 |
| 540 | 3300049581 | Ga0501047_0001148 | Ga0501047_0001148_2130_2732 | 187 |
| 541 | 3300049581 | Ga0501047_0048701 | Ga0501047_0048701_913_1518 | 187 |
| 542 | 3300049581 | Ga0501047_0205590 | Ga0501047_0205590_1076_1681 | 187 |
| 543 | 3300049583 | Ga0501067_0389283 | Ga0501067_0389283_75_680 | 187 |
| 544 | 3300049584 | Ga0501068_0005515 | Ga0501068_0005515_951_1556 | 187 |
| 545 | 3300049584 | Ga0501068_0252334 | Ga0501068_0252334_433_1038 | 187 |
| 546 | 3300049585 | Ga0501069_0040934 | Ga0501069_0040934_1300_1902 | 187 |
| 547 | 3300049585 | Ga0501069_0062749 | Ga0501069_0062749_976_1581 | 187 |
| 548 | 3300049585 | Ga0501069_0062773 | Ga0501069_0062773_1177_1779 | 187 |
| 549 | 3300049585 | Ga0501069_0064119 | Ga0501069_0064119_270_872 | 187 |
| 550 | 3300049586 | Ga0501070_0002328 | Ga0501070_0002328_9865_10467 | 187 |
| 551 | 3300049586 | Ga0501070_0014124 | Ga0501070_0014124_343_945 | 187 |
| 552 | 3300049586 | Ga0501070_0589532 | Ga0501070_0589532_243_848 | 187 |
| 553 | 3300049587 | Ga0501071_0003560 | Ga0501071_0003560_8762_9364 | 187 |
| 554 | 3300049587 | Ga0501071_0051941 | Ga0501071_0051941_397_1002 | 187 |
| 555 | 3300049589 | Ga0501073_0000130 | Ga0501073_0000130_17981_18583 | 187 |
| 556 | 3300049589 | Ga0501073_0006715 | Ga0501073_0006715_2369_2974 | 187 |
| 557 | 3300049589 | Ga0501073_0071826 | Ga0501073_0071826_1483_2088 | 187 |
| 558 | 3300049589 | Ga0501073_0143446 | Ga0501073_0143446_779_1381 | 187 |
| 559 | 3300049589 | Ga0501073_0594356 | Ga0501073_0594356_15_620 | 187 |
| 560 | 3300049590 | Ga0501074_0000732 | Ga0501074_0000732_9572_10174 | 187 |
| 561 | 3300049590 | Ga0501074_0065748 | Ga0501074_0065748_1413_2018 | 187 |
| 562 | 3300049590 | Ga0501074_0092042 | Ga0501074_0092042_737_1339 | 187 |
| 563 | 3300049741 | Ga0501079_0096701 | Ga0501079_0096701_1385_1990 | 187 |
| 564 | 3300049741 | Ga0501079_0096867 | Ga0501079_0096867_62_664 | 187 |
| 565 | 3300049742 | Ga0501080_0000685 | Ga0501080_0000685_19358_19960 | 187 |
| 566 | 3300049742 | Ga0501080_0035297 | Ga0501080_0035297_3372_3977 | 187 |
| 567 | 3300049742 | Ga0501080_0995565 | Ga0501080_0995565_93_698 | 187 |
| 568 | 3300049744 | Ga0501083_0085735 | Ga0501083_0085735_1043_1648 | 187 |
| 569 | 3300049744 | Ga0501083_0377948 | Ga0501083_0377948_150_755 | 187 |
| 570 | 3300049763 | Ga0501266_029362 | Ga0501266_029362_100_717 | 187 |
| 571 | 3300049822 | Ga0501035_0009865 | Ga0501035_0009865_5896_6498 | 187 |
| 572 | 3300049822 | Ga0501035_0011894 | Ga0501035_0011894_1355_1957 | 187 |
| 573 | 3300049822 | Ga0501035_0034005 | Ga0501035_0034005_59_664 | 187 |
| 574 | 3300049822 | Ga0501035_0103152 | Ga0501035_0103152_1513_2118 | 187 |
| 575 | 3300049822 | Ga0501035_0172721 | Ga0501035_0172721_1121_1723 | 187 |
| 576 | 3300049823 | Ga0501044_0008866 | Ga0501044_0008866_4736_5338 | 187 |
| 577 | 3300049823 | Ga0501044_0025157 | Ga0501044_0025157_1496_2098 | 187 |
| 578 | 3300049823 | Ga0501044_0050779 | Ga0501044_0050779_3043_3648 | 187 |
| 579 | 3300049823 | Ga0501044_0068728 | Ga0501044_0068728_1996_2598 | 187 |
| 580 | 3300049823 | Ga0501044_0103565 | Ga0501044_0103565_59_664 | 187 |
| 581 | 3300049823 | Ga0501044_0118208 | Ga0501044_0118208_967_1572 | 187 |
| 582 | 3300050492 | nmdc:mga0yw44_146431_c1 | nmdc:mga0yw44_146431_c1_388_1002 | 187 |
| 583 | 3300053079 | Ga0500610_0003430 | Ga0500610_0003430_742_1347 | 187 |
| 584 | 3300053087 | Ga0500643_005173 | Ga0500643_005173_4584_5189 | 187 |
| 585 | 3300053120 | Ga0500597_000335 | Ga0500597_000335_4219_4824 | 187 |
| 586 | 3300053139 | Ga0500568_0000952 | Ga0500568_0000952_4357_4962 | 187 |
| 587 | 3300053155 | Ga0500620_053618 | Ga0500620_053618_623_1228 | 187 |
| 588 | 3300054114 | Ga0501084_0093945 | Ga0501084_0093945_1568_2173 | 187 |
| 589 | 3300054114 | Ga0501084_0307965 | Ga0501084_0307965_499_1104 | 187 |
| 590 | 3300060353 | Ga0501082_0012969 | Ga0501082_0012969_4977_5582 | 187 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4xgh-assembly1.cif.gz_A | x-ray crystal structure of citrate synthase from burkholderia thailandensis | 0.4673 | 23 | 170 |
| 4xgh-assembly1.cif.gz_A | x-ray crystal structure of citrate synthase from burkholderia thailandensis | 0.3883 | 23 | 170 |
| 4ja4-assembly2.cif.gz_B | inward open conformation of the xylose transporter xyle from e. coli | 0.2504 | 8 | 182 |
| 4ja4-assembly3.cif.gz_C | inward open conformation of the xylose transporter xyle from e. coli | 0.2492 | 8 | 182 |
| 4ja4-assembly1.cif.gz_A | inward open conformation of the xylose transporter xyle from e. coli | 0.2481 | 21 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ADR0_21_135_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7321 | 40 | 162 | 1.10.1760.20 |
| af_P0ADR0_21_135_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.6793 | 40 | 162 | 1.10.1760.20 |
| af_A0A1D6HIR6_348_453_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.5625 | 5 | 68 | 1.25.40.10 |
| af_Q4D393_285_540_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.477 | 4 | 67 | 1.25.10.10 |
| af_A0A1D6LXJ5_560_883_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.4747 | 6 | 74 | 1.25.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A149RXY7-F1-model_v4 | Cytochrome B | 0.9049 | 3 | 179 |
GO:0005886
|
| AF-A0A1V5LDI8-F1-model_v4 | SNARE associated Golgi protein | 0.9014 | 2 | 186 |
GO:0005886
|
| AF-A0A3A0E395-F1-model_v4 | Cytochrome B | 0.8982 | 3 | 186 |
GO:0005886
|
| AF-A0A1I6GB26-F1-model_v4 | Membrane protein YqaA, SNARE-associated domain | 0.898 | 4 | 186 |
GO:0005886
|
| AF-A0A1E3H8P4-F1-model_v4 | SNARE associated Golgi protein | 0.8972 | 3 | 186 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar