F466971

General Info

Members Datasets Scaffolds Average Seq Length
590 357 1180 200

Family's Representative Sequence

Representative Sequence 3300015261|Ga0182006_1044194|Ga0182006_10441942
Length 220
Sequence MASMFDYLYRYCNGHQFKVCPMNWQEFTALLVLATAMSFSPGPNTTLSTALAANGGLPRAMRFVWAVPVGWSLLLALCAAGIGALVVAAPSLRWFIKAFGIAYLLWLAWKLSGSRALGQADGAQLRVGFKQGVMLQFLNIKAWLLALTLVANFIAGQPDALQRYAIVAPVMLVYAFASNFLYALAGAVLRHWLAQGQRLLWFNRAMAALLALTAWWMAGA

Samples

Sample ID Description Type Environment
1 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
130 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
139 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
140 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
141 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
159 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
160 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
161 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
162 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
163 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
164 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
165 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
166 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
167 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
168 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
169 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
170 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
171 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
172 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
173 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
174 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
175 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
176 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
177 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
178 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
179 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
180 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
181 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
182 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
183 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
184 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
185 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
186 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
187 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
188 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
189 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
190 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
210 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
214 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
217 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
227 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
228 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
229 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
230 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
243 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
248 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
251 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
265 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
266 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
276 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
277 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
288 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
292 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
293 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
294 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
295 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
296 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
297 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
298 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
299 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
300 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
301 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
302 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
303 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
304 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
305 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
306 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
307 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
310 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
311 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
312 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
314 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
315 2547132374 Acidovorax radicis N35 Isolate Unclassified
316 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
317 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
318 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
319 2643221570 Acidovorax sp. Root568 Isolate Unclassified
320 2643221609 Acidovorax sp. Root217 Isolate Unclassified
321 2643221611 Acidovorax sp. Root219 Isolate Unclassified
322 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
323 2643221652 Acidovorax sp. Root402 Isolate Unclassified
324 2643221658 Variovorax sp. Root411 Isolate Unclassified
325 2643221672 Variovorax sp. Root434 Isolate Unclassified
326 2643221683 Variovorax sp. Root473 Isolate Unclassified
327 2643221717 Acidovorax sp. Root267 Isolate Unclassified
328 2721755523 Delftia sp. HK171 Isolate Unclassified
329 2738541277 Variovorax sp. GV051 Isolate Unclassified
330 2738543012 Acidovorax sp. CF301 Isolate Unclassified
331 2738543013 Variovorax sp. BT01 Isolate Unclassified
332 2738543019 Variovorax sp. GV040 Isolate Unclassified
333 2816332133 Acidovorax radicis 2721A Isolate Unclassified
334 2818991446 Variovorax sp. 1180 Isolate Unclassified
335 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
336 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
337 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
338 2842733646 Variovorax sp. R-72446 Isolate Unclassified
339 2842747753 Variovorax sp. R-72060 Isolate Unclassified
340 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
341 2885198086 Variovorax sp. 679 Isolate Unclassified
342 2885211737 Variovorax sp. 553 Isolate Unclassified
343 2899924645 Variovorax sp. 369 Isolate Unclassified
344 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
345 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
346 2928037797 Variovorax sp. 1126 Isolate Unclassified
347 2928044640 Variovorax sp. 1128 Isolate Unclassified
348 2928051484 Variovorax sp. 1133 Isolate Unclassified
349 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
350 2928070936 Variovorax gossypii 1167 Isolate Unclassified
351 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
352 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
353 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
354 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
355 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
356 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
357 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.03
Metatranscriptomes 0.51
Isolates 7.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.15
Nodule 1.53
Rhizoplane 3.05
Rhizosphere 54.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182006_1044194 3300015261 Bacteria 1739
2 JGI24740J21852_10014589 3300001979 Bacteria 2892
3 JGI25150J39212_1001496 3300002774 Bacteria 6488
4 JGI25150J39212_1006057 3300002774 Bacteria 2531
5 JGI25159J45721_1009236 3300002987 Bacteria 2619
6 JGI25151J46595_10002455 3300003187 Bacteria 11125
7 JGI25151J46595_10002592 3300003187 Bacteria 10668
8 JGI25151J46595_10006084 3300003187 Bacteria 6131
9 JGI25151J46595_10027885 3300003187 Bacteria 2256
10 rootH1_10100364 3300003316 Bacteria 1567
11 rootL2_10180109 3300003322 Bacteria 1337
12 Ga0006562J51391_1017565 3300003578 Bacteria 11194
13 Ga0006562J51391_1039270 3300003578 Bacteria 7340
14 Ga0006562J51391_1039273 3300003578 Bacteria 4860
15 Ga0055532_1003205 3300003758 Bacteria 2925
16 Ga0055535_1001301 3300003761 Bacteria 13406
17 Ga0055542_1000091 3300003762 Bacteria 121973
18 Ga0055526_1011199 3300003771 Bacteria 4073
19 Ga0055526_1012342 3300003771 Bacteria 3741
20 Ga0055537_1014080 3300003773 Bacteria 1468
21 Ga0055524_1002672 3300003775 Bacteria 9028
22 Ga0055524_1015394 3300003775 Bacteria 2791
23 Ga0055536_1000087 3300003781 Bacteria 79591
24 Ga0055534_1000081 3300003784 Bacteria 75591
25 Ga0055534_1002093 3300003784 Bacteria 7168
26 Ga0055534_1006196 3300003784 Bacteria 3056
27 Ga0055534_1010612 3300003784 Bacteria 1917
28 Ga0055528_1000107 3300003790 Bacteria 67056
29 Ga0055530_10000198 3300003791 Bacteria 53879
30 Ga0055540_1003411 3300003792 Bacteria 7691
31 Ga0055540_1010463 3300003792 Bacteria 3085
32 Ga0055540_1010496 3300003792 Bacteria 3078
33 Ga0055531_10005341 3300003794 Bacteria 7533
34 Ga0070676_10484109 3300005328 Bacteria 876
35 Ga0068869_100061790 3300005334 Bacteria 2748
36 Ga0070666_10107912 3300005335 Bacteria 1924
37 Ga0070666_10746243 3300005335 Bacteria 719
38 Ga0068868_100253756 3300005338 Bacteria 1481
39 Ga0070669_100017321 3300005353 Bacteria 5140
40 Ga0070674_100222747 3300005356 Bacteria 1468
41 Ga0070673_100498605 3300005364 Bacteria 1101
42 Ga0070667_100099335 3300005367 Bacteria 2512
43 Ga0070678_100110196 3300005456 Bacteria 2152
44 Ga0070678_100270779 3300005456 Bacteria 1432
45 Ga0070678_100305284 3300005456 Bacteria 1354
46 Ga0070662_100047771 3300005457 Bacteria 3080
47 Ga0068867_100668843 3300005459 Bacteria 913
48 Ga0070706_100008899 3300005467 Bacteria 9349
49 Ga0070699_100472055 3300005518 Bacteria 1138
50 Ga0068853_100154883 3300005539 Bacteria 2064
51 Ga0070672_100125015 3300005543 Bacteria 2109
52 Ga0068855_100058613 3300005563 Bacteria 4509
53 Ga0068855_100384693 3300005563 Bacteria 1540
54 Ga0070664_100066682 3300005564 Bacteria 3074
55 Ga0068857_100053382 3300005577 Bacteria 3585
56 Ga0068856_100375386 3300005614 Bacteria 1441
57 Ga0068861_100466973 3300005719 Bacteria 1134
58 Ga0068851_10001289 3300005834 Bacteria 10932
59 Ga0068870_10112575 3300005840 Bacteria 1556
60 Ga0068863_101490069 3300005841 Bacteria 685
61 Ga0068862_100102994 3300005844 Bacteria 2499
62 Ga0075365_10354447 3300006038 Bacteria 1034
63 Ga0075365_10396342 3300006038 Bacteria 974
64 Ga0075368_10059149 3300006042 Bacteria 1533
65 Ga0075363_100004226 3300006048 Bacteria 6240
66 Ga0075363_100133449 3300006048 Bacteria 1394
67 Ga0075432_10062567 3300006058 Bacteria 1327
68 Ga0075362_10004894 3300006177 Bacteria 4845
69 Ga0075362_10189669 3300006177 Bacteria 998
70 Ga0075362_10268472 3300006177 Bacteria 842
71 Ga0075367_10040649 3300006178 Bacteria 2716
72 Ga0075367_10092883 3300006178 Bacteria 1837
73 Ga0075369_10108616 3300006186 Bacteria 1249
74 Ga0075369_10177736 3300006186 Bacteria 979
75 Ga0075366_10016252 3300006195 Bacteria 4275
76 Ga0075366_10019184 3300006195 Bacteria 3953
77 Ga0075366_10033560 3300006195 Bacteria 3023
78 Ga0075366_10077811 3300006195 Bacteria 1979
79 Ga0075366_10109846 3300006195 Bacteria 1658
80 Ga0097621_100243141 3300006237 Bacteria 1574
81 Ga0075370_10009802 3300006353 Bacteria 4990
82 Ga0075370_10014636 3300006353 Bacteria 4189
83 Ga0075370_10017978 3300006353 Bacteria 3828
84 Ga0075370_10025145 3300006353 Bacteria 3291
85 Ga0075370_10195601 3300006353 Bacteria 1192
86 Ga0068871_100588023 3300006358 Bacteria 1011
87 Ga0079104_1000427 3300006946 Bacteria 47886
88 Ga0079104_1019372 3300006946 Bacteria 1904
89 Ga0099826_10000015 3300006948 Bacteria 254837
90 Ga0099826_10003208 3300006948 Bacteria 11012
91 Ga0105251_10116955 3300009011 Bacteria 1212
92 Ga0105244_10070941 3300009036 Bacteria 1737
93 Ga0105250_10000379 3300009092 Bacteria 33227
94 Ga0105240_10479873 3300009093 Bacteria 1386
95 Ga0105240_10922320 3300009093 Bacteria 938
96 Ga0105245_10058975 3300009098 Bacteria 3455
97 Ga0105243_10000516 3300009148 Bacteria 39400
98 Ga0105243_10042774 3300009148 Bacteria 3548
99 Ga0105243_10117162 3300009148 Bacteria 2238
100 Ga0105243_10164734 3300009148 Bacteria 1914
101 Ga0105241_10262180 3300009174 Bacteria 1469
102 Ga0105242_10139832 3300009176 Bacteria 2100
103 Ga0105242_10797516 3300009176 Bacteria 935
104 Ga0105248_10834548 3300009177 Bacteria 1040
105 Ga0105248_10846583 3300009177 Bacteria 1032
106 Ga0105237_10023848 3300009545 Bacteria 6261
107 Ga0105238_10377158 3300009551 Bacteria 1409
108 Ga0105238_10512800 3300009551 Bacteria 1201
109 Ga0105239_10126201 3300010375 Bacteria 2844
110 Ga0105246_10023507 3300011119 Bacteria 3989
111 Ga0105246_10621624 3300011119 Bacteria 936
112 Ga0157373_10055912 3300013100 Bacteria 2803
113 Ga0157373_10236908 3300013100 Bacteria 1290
114 Ga0157373_10308408 3300013100 Bacteria 1124
115 Ga0157370_10004852 3300013104 Bacteria 15272
116 Ga0157370_11170178 3300013104 Bacteria 694
117 Ga0163162_10096328 3300013306 Bacteria 3047
118 Ga0163162_10553049 3300013306 Bacteria 1279
119 Ga0157372_10019198 3300013307 Bacteria 7361
120 Ga0157375_10289107 3300013308 Bacteria 1802
121 Ga0157375_10594131 3300013308 Bacteria 1266
122 Ga0163163_10975277 3300014325 Bacteria 911
123 Ga0157380_10617136 3300014326 Bacteria 1076
124 Ga0182008_10000402 3300014497 Bacteria 33508
125 Ga0182008_10003768 3300014497 Bacteria 9026
126 Ga0182008_10014012 3300014497 Bacteria 4205
127 Ga0182008_10037287 3300014497 Bacteria 2432
128 Ga0182006_1001861 3300015261 Bacteria 12082
129 Ga0182006_1081054 3300015261 Bacteria 1184
130 Ga0182006_1141746 3300015261 Bacteria 821
131 Ga0182007_10002443 3300015262 Bacteria 9247
132 Ga0182007_10003983 3300015262 Bacteria 6817
133 Ga0182005_1086823 3300015265 Bacteria 867
134 Ga0183362_10021 3300015683 Bacteria 12373
135 Ga0163161_10000239 3300017792 Bacteria 49599
136 Ga0163161_10030689 3300017792 Bacteria 3827
137 Ga0163161_10072726 3300017792 Bacteria 2518
138 Ga0209436_107457 3300025208 Bacteria 2283
139 Ga0209672_100799 3300025228 Bacteria 14953
140 Ga0209147_101563 3300025229 Bacteria 7816
141 Ga0209258_100143 3300025242 Bacteria 165551
142 Ga0207425_1004342 3300025245 Bacteria 4286
143 Ga0207425_1004742 3300025245 Bacteria 4005
144 Ga0209148_1000007 3300025254 Bacteria 1592273
145 Ga0209129_1000117 3300025258 Bacteria 140115
146 Ga0209129_1000628 3300025258 Bacteria 23570
147 Ga0209129_1000928 3300025258 Bacteria 17808
148 Ga0209129_1003929 3300025258 Bacteria 6172
149 Ga0209565_1000150 3300025263 Bacteria 94073
150 Ga0209565_1000221 3300025263 Bacteria 63818
151 Ga0209565_1000340 3300025263 Bacteria 41364
152 Ga0209565_1001143 3300025263 Bacteria 12781
153 Ga0209565_1006446 3300025263 Bacteria 3289
154 Ga0209673_1000114 3300025273 Bacteria 178557
155 Ga0209673_1000424 3300025273 Bacteria 73591
156 Ga0209673_1000578 3300025273 Bacteria 57974
157 Ga0209673_1002234 3300025273 Bacteria 14012
158 Ga0209130_1000933 3300025284 Bacteria 23391
159 Ga0209130_1001083 3300025284 Bacteria 20338
160 Ga0209130_1003286 3300025284 Bacteria 7033
161 Ga0209675_1000062 3300025291 Bacteria 178557
162 Ga0209675_1000215 3300025291 Bacteria 60572
163 Ga0209675_1001637 3300025291 Bacteria 12521
164 Ga0209675_1002012 3300025291 Bacteria 10898
165 Ga0209675_1031773 3300025291 Bacteria 1244
166 Ga0209676_1000012 3300025292 Bacteria 841431
167 Ga0209676_1000112 3300025292 Bacteria 208328
168 Ga0209676_1000325 3300025292 Bacteria 91840
169 Ga0209676_1004487 3300025292 Bacteria 7750
170 Ga0209676_1008997 3300025292 Bacteria 4371
171 Ga0209676_1021759 3300025292 Bacteria 2143
172 Ga0209676_1064390 3300025292 Bacteria 897
173 Ga0209025_1000208 3300025294 Bacteria 140415
174 Ga0209025_1000233 3300025294 Bacteria 130512
175 Ga0209025_1000306 3300025294 Bacteria 109280
176 Ga0209025_1000944 3300025294 Bacteria 44214
177 Ga0209025_1001130 3300025294 Bacteria 38222
178 Ga0209025_1001144 3300025294 Bacteria 37770
179 Ga0209025_1008396 3300025294 Bacteria 7444
180 Ga0209025_1008418 3300025294 Bacteria 7429
181 Ga0209025_1034696 3300025294 Bacteria 2297
182 Ga0209564_1000108 3300025295 Bacteria 213699
183 Ga0209564_1000212 3300025295 Bacteria 133160
184 Ga0209564_1001395 3300025295 Bacteria 25126
185 Ga0209564_1004213 3300025295 Bacteria 8961
186 Ga0209564_1004429 3300025295 Bacteria 8602
187 Ga0209758_1000664 3300025297 Bacteria 51488
188 Ga0209758_1004902 3300025297 Bacteria 10761
189 Ga0209758_1014919 3300025297 Bacteria 4077
190 Ga0209050_1000052 3300025298 Bacteria 351785
191 Ga0209050_1000662 3300025298 Bacteria 53092
192 Ga0209050_1019052 3300025298 Bacteria 2630
193 Ga0209256_1000101 3300025299 Bacteria 200246
194 Ga0209256_1000399 3300025299 Bacteria 68769
195 Ga0209256_1000589 3300025299 Bacteria 50593
196 Ga0209256_1000789 3300025299 Bacteria 40866
197 Ga0207426_1000086 3300025302 Bacteria 292089
198 Ga0207426_1000207 3300025302 Bacteria 140594
199 Ga0207426_1000351 3300025302 Bacteria 84439
200 Ga0209051_1000105 3300025303 Bacteria 160893
201 Ga0209051_1000186 3300025303 Bacteria 109900
202 Ga0209051_1000208 3300025303 Bacteria 102967
203 Ga0209051_1000216 3300025303 Bacteria 97590
204 Ga0209051_1000427 3300025303 Bacteria 57606
205 Ga0209051_1000537 3300025303 Bacteria 46665
206 Ga0209051_1011438 3300025303 Bacteria 4379
207 Ga0209257_1000037 3300025304 Bacteria 612915
208 Ga0209257_1000516 3300025304 Bacteria 67246
209 Ga0209257_1006065 3300025304 Bacteria 8038
210 Ga0207656_10003674 3300025321 Bacteria 5307
211 Ga0207696_1000722 3300025711 Bacteria 22265
212 Ga0207655_1002697 3300025728 Bacteria 13923
213 Ga0207680_10114673 3300025903 Bacteria 1754
214 Ga0207643_10120083 3300025908 Bacteria 1556
215 Ga0207684_10009791 3300025910 Bacteria 8454
216 Ga0207654_10169796 3300025911 Bacteria 1415
217 Ga0207695_10393807 3300025913 Bacteria 1270
218 Ga0207657_10524013 3300025919 Bacteria 927
219 Ga0207681_10204931 3300025923 Bacteria 1516
220 Ga0207687_10038191 3300025927 Bacteria 3280
221 Ga0207706_10102552 3300025933 Bacteria 2517
222 Ga0207686_10090876 3300025934 Bacteria 2015
223 Ga0207709_10000382 3300025935 Bacteria 44040
224 Ga0207709_10000395 3300025935 Bacteria 42894
225 Ga0207709_10001832 3300025935 Bacteria 14179
226 Ga0207691_10097390 3300025940 Bacteria 2629
227 Ga0207711_10516292 3300025941 Bacteria 1114
228 Ga0207689_10060589 3300025942 Bacteria 3112
229 Ga0207679_10178396 3300025945 Bacteria 1755
230 Ga0207667_10094426 3300025949 Bacteria 3088
231 Ga0207667_10199552 3300025949 Bacteria 2052
232 Ga0207658_10096640 3300025986 Bacteria 2304
233 Ga0207639_10776518 3300026041 Bacteria 892
234 Ga0207678_10403261 3300026067 Bacteria 1184
235 Ga0207674_10018881 3300026116 Bacteria 7478
236 Ga0207674_10557375 3300026116 Bacteria 1107
237 Ga0207675_100309608 3300026118 Bacteria 1540
238 Ga0207683_10056365 3300026121 Bacteria 3447
239 Ga0207683_10126436 3300026121 Bacteria 2298
240 Ga0207698_10187593 3300026142 Bacteria 1838
241 Ga0209281_1000072 3300027111 Bacteria 273114
242 Ga0209282_1000033 3300027666 Bacteria 141940
243 Ga0209282_1001560 3300027666 Bacteria 12656
244 Ga0209282_1148399 3300027666 Bacteria 1136
245 Ga0209813_10169236 3300027866 Bacteria 793
246 Ga0209974_10011596 3300027876 Bacteria 2958
247 Ga0209974_10086440 3300027876 Bacteria 1084
248 Ga0207428_10379361 3300027907 Bacteria 1037
249 Ga0268266_10131003 3300028379 Bacteria 2243
250 Ga0268265_10076007 3300028380 Bacteria 2633
251 Ga0307517_10279228 3300028786 Bacteria 954
252 Ga0307515_10000873 3300028794 Bacteria 69237
253 Ga0307515_10158297 3300028794 Bacteria 2325
254 Ga0314311_1038315 3300030733 Bacteria 4510
255 Ga0316183_1109966 3300030742 Bacteria 1019
256 Ga0316183_1146954 3300030742 Bacteria 4765
257 Ga0316181_1121113 3300030744 Bacteria 1066
258 Ga0316182_1005604 3300030745 Bacteria 4439
259 Ga0316182_1428222 3300030745 Bacteria 831
260 Ga0265327_10002739 3300031251 Bacteria 17948
261 Ga0265327_10069627 3300031251 Bacteria 1766
262 Ga0307513_10153015 3300031456 Bacteria 2212
263 Ga0307513_10170331 3300031456 Bacteria 2056
264 Ga0307408_100006919 3300031548 Bacteria 7506
265 Ga0307408_100046623 3300031548 Bacteria 3100
266 Ga0307408_100049841 3300031548 Bacteria 3009
267 Ga0307408_100085193 3300031548 Bacteria 2372
268 Ga0307514_10017190 3300031649 Bacteria 5955
269 Ga0307405_10111317 3300031731 Bacteria 1855
270 Ga0307405_10374304 3300031731 Bacteria 1106
271 Ga0307410_10541843 3300031852 Bacteria 963
272 Ga0307406_10062000 3300031901 Bacteria 2417
273 Ga0307412_10000996 3300031911 Bacteria 16209
274 Ga0307412_10009334 3300031911 Bacteria 5624
275 Ga0307412_10033056 3300031911 Bacteria 3283
276 Ga0307412_10045291 3300031911 Bacteria 2875
277 Ga0307412_10260108 3300031911 Bacteria 1352
278 Ga0307412_10346301 3300031911 Bacteria 1191
279 Ga0307412_10520646 3300031911 Bacteria 993
280 Ga0307412_10887836 3300031911 Bacteria 780
281 Ga0307416_100023445 3300032002 Bacteria 4479
282 Ga0307414_10064690 3300032004 Bacteria 2605
283 Ga0307414_10146774 3300032004 Bacteria 1855
284 Ga0307414_10460483 3300032004 Bacteria 1117
285 Ga0307414_10975163 3300032004 Bacteria 779
286 Ga0307411_10014806 3300032005 Bacteria 4355
287 Ga0307411_10116352 3300032005 Bacteria 1925
288 Ga0307411_10262967 3300032005 Bacteria 1363
289 Ga0395899_0017285 3300037312 Bacteria 5496
290 Ga0395900_0104737 3300037418 Bacteria 2906
291 Ga0395898_0245748 3300037466 Bacteria 1706
292 Ga0395905_0231893 3300037471 Bacteria 1726
293 Ga0395901_0048912 3300038443 Bacteria 4391
294 Ga0439436_0008907 3300041404 Bacteria 3080
295 Ga0439436_0032420 3300041404 Bacteria 1515
296 Ga0439438_036008 3300041405 Bacteria 1299
297 Ga0439461_0010129 3300041410 Bacteria 1725
298 Ga0439466_0004049 3300041411 Bacteria 5662
299 Ga0439466_0006517 3300041411 Bacteria 4436
300 Ga0439466_0011829 3300041411 Bacteria 3222
301 Ga0439465_0007340 3300041413 Bacteria 3501
302 Ga0439465_0079319 3300041413 Bacteria 1111
303 Ga0439465_0248013 3300041413 Bacteria 658
304 Ga0451843_0146688 3300041509 Bacteria 784
305 Ga0439431_0052865 3300041997 Bacteria 1056
306 Ga0439431_0104552 3300041997 Bacteria 780
307 Ga0439433_0002376 3300041999 Bacteria 3986
308 Ga0439433_0026458 3300041999 Bacteria 1313
309 Ga0439442_005865 3300042002 Bacteria 2460
310 Ga0439442_013201 3300042002 Bacteria 1694
311 Ga0439442_014560 3300042002 Bacteria 1619
312 Ga0439445_0000602 3300042004 Bacteria 7364
313 Ga0439432_000888 3300042006 Bacteria 11215
314 Ga0439432_125054 3300042006 Bacteria 760
315 Ga0439449_0002470 3300042007 Bacteria 7227
316 Ga0439449_0005939 3300042007 Bacteria 4662
317 Ga0439449_0015545 3300042007 Bacteria 2860
318 Ga0439452_001745 3300042010 Bacteria 8518
319 Ga0439452_010110 3300042010 Bacteria 2757
320 Ga0439455_0024238 3300042012 Bacteria 1467
321 Ga0439457_006358 3300042014 Bacteria 2900
322 Ga0439462_0002807 3300042015 Bacteria 4105
323 Ga0439462_0005749 3300042015 Bacteria 3067
324 Ga0439462_0091135 3300042015 Bacteria 836
325 Ga0450911_011233 3300042115 Bacteria 1229
326 Ga0450920_004803 3300042122 Bacteria 2388
327 Ga0450921_000055 3300042123 Bacteria 3107
328 Ga0450921_000724 3300042123 Bacteria 1712
329 Ga0450897_011740 3300042128 Bacteria 858
330 Ga0450896_005062 3300042133 Bacteria 1795
331 Ga0450896_013376 3300042133 Bacteria 1167
332 Ga0450898_034237 3300042134 Bacteria 943
333 Ga0450906_001670 3300042145 Bacteria 4875
334 Ga0450906_004539 3300042145 Bacteria 2900
335 Ga0450907_020257 3300042146 Bacteria 1116
336 Ga0450910_000768 3300042147 Bacteria 3866
337 Ga0439446_0002135 3300042156 Bacteria 4694
338 Ga0450908_007012 3300042184 Bacteria 2133
339 Ga0450909_004452 3300042185 Bacteria 1998
340 Ga0439434_0000675 3300042435 Bacteria 9849
341 Ga0439434_0003094 3300042435 Bacteria 4881
342 Ga0439464_0097139 3300042439 Bacteria 892
343 Ga0450916_040565 3300042530 Bacteria 706
344 Ga0450918_000530 3300042531 Bacteria 8191
345 Ga0450893_0007759 3300042532 Bacteria 1744
346 Ga0450893_0008516 3300042532 Bacteria 1668
347 Ga0451577_0005155 3300042876 Bacteria 13442
348 Ga0451577_0107841 3300042876 Bacteria 2490
349 Ga0451577_0536532 3300042876 Bacteria 1062
350 Ga0466969_0000013 3300044656 Bacteria 111537
351 Ga0466969_0015119 3300044656 Bacteria 4048
352 Ga0466972_0073214 3300044658 Bacteria 1633
353 Ga0453683_0013789 3300044673 Bacteria 5259
354 Ga0466965_0018819 3300044683 Bacteria 3314
355 Ga0466965_0120128 3300044683 Bacteria 1356
356 Ga0466965_0136284 3300044683 Bacteria 1275
357 Ga0466966_0003674 3300044684 Bacteria 10126
358 Ga0466966_0016338 3300044684 Bacteria 4906
359 Ga0466966_0100455 3300044684 Bacteria 1789
360 Ga0466961_0001040 3300044693 Bacteria 17129
361 Ga0466961_0004397 3300044693 Bacteria 8823
362 Ga0466961_0025568 3300044693 Bacteria 3796
363 Ga0466963_0031400 3300044694 Bacteria 3433
364 Ga0466964_0000979 3300044706 Bacteria 9463
365 Ga0466964_0006889 3300044706 Bacteria 4244
366 Ga0453684_0009125 3300044712 Bacteria 17469
367 Ga0466971_0014210 3300044719 Bacteria 3500
368 Ga0466970_0003768 3300044765 Bacteria 7416
369 Ga0466970_0030395 3300044765 Bacteria 2848
370 Ga0466970_0072110 3300044765 Bacteria 1858
371 Ga0466957_0099590 3300044842 Bacteria 1830
372 Ga0466957_0195583 3300044842 Bacteria 1326
373 Ga0466960_0031664 3300044901 Bacteria 2442
374 Ga0466960_0208770 3300044901 Bacteria 1070
375 Ga0466959_0000128 3300045049 Bacteria 48803
376 Ga0466959_0033137 3300045049 Bacteria 3821
377 Ga0466959_0147499 3300045049 Bacteria 1659
378 Ga0451576_0012256 3300045051 Bacteria 9651
379 Ga0451576_0044383 3300045051 Bacteria 4685
380 Ga0466958_0045995 3300045836 Bacteria 2633
381 Ga0466958_0080725 3300045836 Bacteria 2001
382 Ga0466967_0001617 3300045976 Bacteria 13299
383 Ga0495627_031036 3300046453 Bacteria 1690
384 Ga0495627_065764 3300046453 Bacteria 1065
385 Ga0495590_0160711 3300046457 Bacteria 817
386 Ga0495629_0118479 3300046459 Bacteria 1845
387 Ga0495638_0037458 3300046460 Bacteria 3085
388 Ga0495650_0003277 3300046471 Bacteria 11988
389 Ga0495605_0001087 3300046474 Bacteria 18122
390 Ga0495639_0032556 3300046475 Bacteria 2325
391 Ga0495596_0000536 3300046500 Bacteria 23864
392 Ga0495607_0014422 3300046501 Bacteria 5143
393 Ga0495610_0003005 3300046512 Bacteria 13544
394 Ga0495616_0001076 3300046513 Bacteria 19387
395 Ga0495616_0007999 3300046513 Bacteria 6299
396 Ga0495620_0059054 3300046515 Bacteria 1604
397 Ga0495631_0000181 3300046518 Bacteria 42933
398 Ga0495637_0005674 3300046520 Bacteria 6330
399 Ga0495643_0084159 3300046522 Bacteria 1651
400 Ga0495648_0149090 3300046524 Bacteria 1222
401 Ga0495663_0037143 3300046525 Bacteria 1468
402 Ga0495663_0045096 3300046525 Bacteria 1351
403 Ga0495642_0011952 3300046528 Bacteria 3344
404 Ga0495642_0071929 3300046528 Bacteria 1448
405 Ga0495654_0006640 3300046530 Bacteria 6548
406 Ga0495654_0128066 3300046530 Bacteria 1142
407 Ga0495609_0006294 3300046538 Bacteria 6076
408 Ga0495609_0111175 3300046538 Bacteria 1182
409 Ga0495621_0015508 3300046539 Bacteria 2431
410 Ga0495621_0023406 3300046539 Bacteria 2054
411 Ga0495597_0077935 3300046542 Bacteria 1420
412 Ga0495656_0001122 3300046615 Bacteria 8706
413 Ga0495668_0147798 3300046616 Bacteria 1287
414 Ga0495625_0000437 3300046660 Bacteria 62719
415 Ga0495625_0073443 3300046660 Bacteria 2397
416 Ga0495635_0299668 3300046663 Bacteria 1078
417 Ga0495661_0017551 3300046665 Bacteria 4724
418 Ga0495661_0126646 3300046665 Bacteria 1405
419 Ga0495588_0116271 3300046674 Bacteria 1409
420 Ga0495588_0152672 3300046674 Bacteria 1220
421 Ga0495588_0192101 3300046674 Bacteria 1078
422 Ga0495599_0453354 3300046678 Bacteria 759
423 Ga0495646_0162075 3300046680 Bacteria 1237
424 Ga0495658_0195800 3300046683 Bacteria 1258
425 Ga0495658_0590623 3300046683 Bacteria 711
426 Ga0495613_0121457 3300046689 Bacteria 1876
427 Ga0495670_0076366 3300046691 Bacteria 1702
428 Ga0495670_0181896 3300046691 Bacteria 1110
429 Ga0495670_0270526 3300046691 Bacteria 908
430 Ga0495671_0004671 3300046692 Bacteria 8115
431 Ga0495671_0007941 3300046692 Bacteria 6003
432 Ga0495649_0021810 3300046694 Bacteria 3588
433 Ga0495581_0051887 3300047315 Bacteria 2369
434 Ga0495604_0409051 3300047317 Bacteria 892
435 Ga0495672_0012955 3300047320 Bacteria 5780
436 Ga0495677_0031265 3300047445 Bacteria 1938
437 Ga0495685_002301 3300047447 Bacteria 5959
438 Ga0495593_0016381 3300047673 Bacteria 4182
439 Ga0495614_0037889 3300048089 Bacteria 2069
440 Ga0495615_0010291 3300048090 Bacteria 1865
441 Ga0496100_0038198 3300048903 Bacteria 3041
442 Ga0496101_0025050 3300048904 Bacteria 4135
443 Ga0496101_0134143 3300048904 Bacteria 1882
444 Ga0496102_0013400 3300048905 Bacteria 7102
445 Ga0496102_0427417 3300048905 Bacteria 1244
446 Ga0496103_0016097 3300048906 Bacteria 4462
447 Ga0496104_0019226 3300048907 Bacteria 6245
448 Ga0496105_0039223 3300048908 Bacteria 3903
449 Ga0496106_0047410 3300048909 Bacteria 3234
450 Ga0496107_0192458 3300048910 Bacteria 1516
451 Ga0496107_0297404 3300048910 Bacteria 1201
452 Ga0496108_0389815 3300048911 Bacteria 1216
453 Ga0496110_0143652 3300048913 Bacteria 2158
454 Ga0496110_1117583 3300048913 Bacteria 696
455 Ga0496111_0152457 3300048914 Bacteria 1714
456 Ga0496114_0223940 3300048917 Bacteria 1651
457 Ga0496116_0013507 3300048919 Bacteria 6577
458 Ga0496116_0047650 3300048919 Bacteria 2883
459 Ga0496116_0067690 3300048919 Bacteria 2279
460 Ga0496117_0049304 3300048920 Bacteria 2996
461 Ga0496117_0123771 3300048920 Bacteria 1583
462 Ga0496118_0019613 3300048921 Bacteria 6037
463 Ga0496118_0091610 3300048921 Bacteria 2090
464 Ga0496118_0092483 3300048921 Bacteria 2075
465 Ga0496118_0397276 3300048921 Bacteria 717
466 Ga0496121_0015548 3300048924 Bacteria 7957
467 Ga0496121_0029125 3300048924 Bacteria 5118
468 Ga0496121_0161385 3300048924 Bacteria 1638
469 Ga0496121_0232675 3300048924 Bacteria 1289
470 Ga0496122_0000184 3300048925 Bacteria 144437
471 Ga0496122_0054292 3300048925 Bacteria 3011
472 Ga0496122_0070056 3300048925 Bacteria 2508
473 Ga0496122_0125082 3300048925 Bacteria 1648
474 Ga0496123_0000181 3300048926 Bacteria 127092
475 Ga0496123_0012961 3300048926 Bacteria 7044
476 Ga0496123_0018597 3300048926 Bacteria 5517
477 Ga0496124_0177698 3300048927 Bacteria 1641
478 Ga0496124_0325097 3300048927 Bacteria 1099
479 Ga0496124_0593745 3300048927 Bacteria 722
480 Ga0496125_0026759 3300048928 Bacteria 5242
481 Ga0496125_0046753 3300048928 Bacteria 3627
482 Ga0496125_0075596 3300048928 Bacteria 2606
483 Ga0496125_0103920 3300048928 Bacteria 2083
484 Ga0496125_0266209 3300048928 Bacteria 1071
485 Ga0496126_0594220 3300048929 Bacteria 873
486 Ga0501038_0313050 3300049574 Bacteria 1230
487 Ga0501043_0148812 3300049579 Bacteria 1833
488 Ga0501249_000300 3300049679 Bacteria 13891
489 Ga0501225_0005546 3300049705 Bacteria 3699
490 Ga0501262_000007 3300049759 Bacteria 38668
491 Ga0501035_0118496 3300049822 Bacteria 2316
492 nmdc:mga03683_13134_c1 3300050489 Bacteria 3041
493 nmdc:mga03683_169809_c1 3300050489 Bacteria 991
494 nmdc:mga03683_282034_c1 3300050489 Bacteria 776
495 nmdc:mga03683_57032_c1 3300050489 Bacteria 1643
496 nmdc:mga03n38_20618_c1 3300050490 Bacteria 2641
497 nmdc:mga03n38_29857_c1 3300050490 Bacteria 2286
498 nmdc:mga03n38_409114_c1 3300050490 Bacteria 748
499 nmdc:mga00v17_120659_c1 3300050491 Bacteria 1669
500 nmdc:mga0yw44_408241_c1 3300050492 Bacteria 919
501 nmdc:mga0k408_18609_c1 3300050493 Bacteria 3878
502 nmdc:mga0k408_49994_c1 3300050493 Bacteria 2420
503 nmdc:mga06z11_372851_c1 3300050494 Bacteria 857
504 nmdc:mga06z11_440184_c1 3300050494 Bacteria 787
505 nmdc:mga04h51_195337_c1 3300050495 Bacteria 793
506 nmdc:mga07m45_122600_c1 3300050496 Bacteria 1502
507 nmdc:mga07m45_126033_c1 3300050496 Bacteria 1481
508 nmdc:mga07m45_141210_c1 3300050496 Bacteria 1395
509 nmdc:mga07m45_30187_c1 3300050496 Bacteria 3001
510 nmdc:mga07m45_425729_c1 3300050496 Bacteria 770
511 nmdc:mga07m45_4544_c1 3300050496 Bacteria 6796
512 nmdc:mga07m45_7817_c1 3300050496 Bacteria 5472
513 nmdc:mga0sz30_126046_c1 3300050516 Bacteria 1127
514 Ga0500610_0001934 3300053079 Bacteria 7370
515 Ga0500610_0020716 3300053079 Bacteria 3214
516 Ga0500610_0161972 3300053079 Bacteria 1112
517 Ga0495595_0218200 3300053084 Bacteria 952
518 Ga0495619_0188727 3300053085 Bacteria 1427
519 Ga0500651_0000030 3300053093 Bacteria 112247
520 Ga0500566_0070401 3300053094 Bacteria 1964
521 Ga0500566_0213033 3300053094 Bacteria 966
522 Ga0500571_000049 3300053110 Bacteria 36301
523 Ga0500592_004953 3300053116 Bacteria 2115
524 Ga0500593_000117 3300053117 Bacteria 30894
525 Ga0500594_0003501 3300053118 Bacteria 3454
526 Ga0500595_135001 3300053119 Bacteria 693
527 Ga0500607_001200 3300053121 Bacteria 23870
528 Ga0500607_038446 3300053121 Bacteria 2603
529 Ga0500608_035003 3300053122 Bacteria 2394
530 Ga0500655_004996 3300053133 Bacteria 2383
531 Ga0500658_0001628 3300053134 Bacteria 8957
532 Ga0500658_0001697 3300053134 Bacteria 8724
533 Ga0500559_0002185 3300053136 Bacteria 10338
534 Ga0500564_030739 3300053138 Bacteria 2474
535 Ga0500568_0005131 3300053139 Bacteria 6836
536 Ga0500573_0017788 3300053140 Bacteria 4049
537 Ga0500574_003086 3300053141 Bacteria 2874
538 Ga0500586_041440 3300053145 Bacteria 1563
539 Ga0500616_0064142 3300053153 Bacteria 1892
540 Ga0500634_0004933 3300053161 Bacteria 6263
541 Ga0500638_032163 3300053162 Bacteria 2533
542 Ga0500625_024129 3300053729 Bacteria 2874
543 Ga0500596_011579 3300053735 Bacteria 1348
544 Ga0466962_0003612 3300061719 Bacteria 7372
545 Ga0466962_0078956 3300061719 Bacteria 1573
546 Ga0466962_0079000 3300061719 Bacteria 1572
547 2513231847 2513020051 Bacteria 6053213
548 2548501276 2547132374 Bacteria 5530232
549 2599674131 2599185226 Bacteria 8233575
550 2599678321 2599185227 Bacteria 8246414
551 2599690574 2599185229 Bacteria 8216126
552 2643868484 2643221570 Bacteria 5103772
553 2644061638 2643221609 Bacteria 6756331
554 2644075170 2643221611 Bacteria 6820941
555 2644161206 2643221628 Bacteria 5745828
556 2644295436 2643221652 Bacteria 5140275
557 2644325702 2643221658 Bacteria 6064537
558 2644400913 2643221672 Bacteria 6322190
559 2644466150 2643221683 Bacteria 5749203
560 2644649180 2643221717 Bacteria 5676132
561 2722881362 2721755523 Bacteria 6430384
562 2738723085 2738541277 Bacteria 7458140
563 2739243335 2738543012 Bacteria 7115078
564 2739249794 2738543013 Bacteria 5618633
565 2739283816 2738543019 Bacteria 7459457
566 2816473913 2816332133 Bacteria 7249298
567 2819602378 2818991446 Bacteria 7757362
568 2831270028 2831265667 Bacteria 7184833
569 2838054963 2838054893 Bacteria 7451788
570 2839140612 2839138175 Bacteria 6549354
571 2842737382 2842733646 Bacteria 5716726
572 2842749887 2842747753 Bacteria 5578255
573 2885194937 2885192300 Bacteria 5882526
574 2885202051 2885198086 Bacteria 7212419
575 2885215239 2885211737 Bacteria 7212420
576 2899927040 2899924645 Bacteria 7487985
577 2904545915 2904541872 Bacteria 8915136
578 2919706739 2919704043 Bacteria 5560311
579 2928043892 2928037797 Bacteria 7273642
580 2928048540 2928044640 Bacteria 7271509
581 2928054865 2928051484 Bacteria 7773759
582 2928068303 2928064002 Bacteria 7419480
583 2928073796 2928070936 Bacteria 8062541
584 2928086057 2928084124 Bacteria 7159212
585 2929161101 2929160207 Bacteria 9075316
586 2939633929 2939631187 Bacteria 6118131
587 2945973968 2945972063 Bacteria 6086495
588 2945990188 2945984333 Bacteria 7358892
589 2954770457 2954767861 Bacteria 5535784
590 2990715521 2990710928 Bacteria 5002431
591 Ga0182006_1044194
592 JGI24740J21852_10014589
593 JGI25150J39212_1001496
594 JGI25150J39212_1006057
595 JGI25159J45721_1009236
596 JGI25151J46595_10002455
597 JGI25151J46595_10002592
598 JGI25151J46595_10006084
599 JGI25151J46595_10027885
600 rootH1_10100364
601 rootL2_10180109
602 Ga0006562J51391_1017565
603 Ga0006562J51391_1039270
604 Ga0006562J51391_1039273
605 Ga0055532_1003205
606 Ga0055535_1001301
607 Ga0055542_1000091
608 Ga0055526_1011199
609 Ga0055526_1012342
610 Ga0055537_1014080
611 Ga0055524_1002672
612 Ga0055524_1015394
613 Ga0055536_1000087
614 Ga0055534_1000081
615 Ga0055534_1002093
616 Ga0055534_1006196
617 Ga0055534_1010612
618 Ga0055528_1000107
619 Ga0055530_10000198
620 Ga0055540_1003411
621 Ga0055540_1010463
622 Ga0055540_1010496
623 Ga0055531_10005341
624 Ga0070676_10484109
625 Ga0068869_100061790
626 Ga0070666_10107912
627 Ga0070666_10746243
628 Ga0068868_100253756
629 Ga0070669_100017321
630 Ga0070674_100222747
631 Ga0070673_100498605
632 Ga0070667_100099335
633 Ga0070678_100110196
634 Ga0070678_100270779
635 Ga0070678_100305284
636 Ga0070662_100047771
637 Ga0068867_100668843
638 Ga0070706_100008899
639 Ga0070699_100472055
640 Ga0068853_100154883
641 Ga0070672_100125015
642 Ga0068855_100058613
643 Ga0068855_100384693
644 Ga0070664_100066682
645 Ga0068857_100053382
646 Ga0068856_100375386
647 Ga0068861_100466973
648 Ga0068851_10001289
649 Ga0068870_10112575
650 Ga0068863_101490069
651 Ga0068862_100102994
652 Ga0075365_10354447
653 Ga0075365_10396342
654 Ga0075368_10059149
655 Ga0075363_100004226
656 Ga0075363_100133449
657 Ga0075432_10062567
658 Ga0075362_10004894
659 Ga0075362_10189669
660 Ga0075362_10268472
661 Ga0075367_10040649
662 Ga0075367_10092883
663 Ga0075369_10108616
664 Ga0075369_10177736
665 Ga0075366_10016252
666 Ga0075366_10019184
667 Ga0075366_10033560
668 Ga0075366_10077811
669 Ga0075366_10109846
670 Ga0097621_100243141
671 Ga0075370_10009802
672 Ga0075370_10014636
673 Ga0075370_10017978
674 Ga0075370_10025145
675 Ga0075370_10195601
676 Ga0068871_100588023
677 Ga0079104_1000427
678 Ga0079104_1019372
679 Ga0099826_10000015
680 Ga0099826_10003208
681 Ga0105251_10116955
682 Ga0105244_10070941
683 Ga0105250_10000379
684 Ga0105240_10479873
685 Ga0105240_10922320
686 Ga0105245_10058975
687 Ga0105243_10000516
688 Ga0105243_10042774
689 Ga0105243_10117162
690 Ga0105243_10164734
691 Ga0105241_10262180
692 Ga0105242_10139832
693 Ga0105242_10797516
694 Ga0105248_10834548
695 Ga0105248_10846583
696 Ga0105237_10023848
697 Ga0105238_10377158
698 Ga0105238_10512800
699 Ga0105239_10126201
700 Ga0105246_10023507
701 Ga0105246_10621624
702 Ga0157373_10055912
703 Ga0157373_10236908
704 Ga0157373_10308408
705 Ga0157370_10004852
706 Ga0157370_11170178
707 Ga0163162_10096328
708 Ga0163162_10553049
709 Ga0157372_10019198
710 Ga0157375_10289107
711 Ga0157375_10594131
712 Ga0163163_10975277
713 Ga0157380_10617136
714 Ga0182008_10000402
715 Ga0182008_10003768
716 Ga0182008_10014012
717 Ga0182008_10037287
718 Ga0182006_1001861
719 Ga0182006_1081054
720 Ga0182006_1141746
721 Ga0182007_10002443
722 Ga0182007_10003983
723 Ga0182005_1086823
724 Ga0183362_10021
725 Ga0163161_10000239
726 Ga0163161_10030689
727 Ga0163161_10072726
728 Ga0209436_107457
729 Ga0209672_100799
730 Ga0209147_101563
731 Ga0209258_100143
732 Ga0207425_1004342
733 Ga0207425_1004742
734 Ga0209148_1000007
735 Ga0209129_1000117
736 Ga0209129_1000628
737 Ga0209129_1000928
738 Ga0209129_1003929
739 Ga0209565_1000150
740 Ga0209565_1000221
741 Ga0209565_1000340
742 Ga0209565_1001143
743 Ga0209565_1006446
744 Ga0209673_1000114
745 Ga0209673_1000424
746 Ga0209673_1000578
747 Ga0209673_1002234
748 Ga0209130_1000933
749 Ga0209130_1001083
750 Ga0209130_1003286
751 Ga0209675_1000062
752 Ga0209675_1000215
753 Ga0209675_1001637
754 Ga0209675_1002012
755 Ga0209675_1031773
756 Ga0209676_1000012
757 Ga0209676_1000112
758 Ga0209676_1000325
759 Ga0209676_1004487
760 Ga0209676_1008997
761 Ga0209676_1021759
762 Ga0209676_1064390
763 Ga0209025_1000208
764 Ga0209025_1000233
765 Ga0209025_1000306
766 Ga0209025_1000944
767 Ga0209025_1001130
768 Ga0209025_1001144
769 Ga0209025_1008396
770 Ga0209025_1008418
771 Ga0209025_1034696
772 Ga0209564_1000108
773 Ga0209564_1000212
774 Ga0209564_1001395
775 Ga0209564_1004213
776 Ga0209564_1004429
777 Ga0209758_1000664
778 Ga0209758_1004902
779 Ga0209758_1014919
780 Ga0209050_1000052
781 Ga0209050_1000662
782 Ga0209050_1019052
783 Ga0209256_1000101
784 Ga0209256_1000399
785 Ga0209256_1000589
786 Ga0209256_1000789
787 Ga0207426_1000086
788 Ga0207426_1000207
789 Ga0207426_1000351
790 Ga0209051_1000105
791 Ga0209051_1000186
792 Ga0209051_1000208
793 Ga0209051_1000216
794 Ga0209051_1000427
795 Ga0209051_1000537
796 Ga0209051_1011438
797 Ga0209257_1000037
798 Ga0209257_1000516
799 Ga0209257_1006065
800 Ga0207656_10003674
801 Ga0207696_1000722
802 Ga0207655_1002697
803 Ga0207680_10114673
804 Ga0207643_10120083
805 Ga0207684_10009791
806 Ga0207654_10169796
807 Ga0207695_10393807
808 Ga0207657_10524013
809 Ga0207681_10204931
810 Ga0207687_10038191
811 Ga0207706_10102552
812 Ga0207686_10090876
813 Ga0207709_10000382
814 Ga0207709_10000395
815 Ga0207709_10001832
816 Ga0207691_10097390
817 Ga0207711_10516292
818 Ga0207689_10060589
819 Ga0207679_10178396
820 Ga0207667_10094426
821 Ga0207667_10199552
822 Ga0207658_10096640
823 Ga0207639_10776518
824 Ga0207678_10403261
825 Ga0207674_10018881
826 Ga0207674_10557375
827 Ga0207675_100309608
828 Ga0207683_10056365
829 Ga0207683_10126436
830 Ga0207698_10187593
831 Ga0209281_1000072
832 Ga0209282_1000033
833 Ga0209282_1001560
834 Ga0209282_1148399
835 Ga0209813_10169236
836 Ga0209974_10011596
837 Ga0209974_10086440
838 Ga0207428_10379361
839 Ga0268266_10131003
840 Ga0268265_10076007
841 Ga0307517_10279228
842 Ga0307515_10000873
843 Ga0307515_10158297
844 Ga0314311_1038315
845 Ga0316183_1109966
846 Ga0316183_1146954
847 Ga0316181_1121113
848 Ga0316182_1005604
849 Ga0316182_1428222
850 Ga0265327_10002739
851 Ga0265327_10069627
852 Ga0307513_10153015
853 Ga0307513_10170331
854 Ga0307408_100006919
855 Ga0307408_100046623
856 Ga0307408_100049841
857 Ga0307408_100085193
858 Ga0307514_10017190
859 Ga0307405_10111317
860 Ga0307405_10374304
861 Ga0307410_10541843
862 Ga0307406_10062000
863 Ga0307412_10000996
864 Ga0307412_10009334
865 Ga0307412_10033056
866 Ga0307412_10045291
867 Ga0307412_10260108
868 Ga0307412_10346301
869 Ga0307412_10520646
870 Ga0307412_10887836
871 Ga0307416_100023445
872 Ga0307414_10064690
873 Ga0307414_10146774
874 Ga0307414_10460483
875 Ga0307414_10975163
876 Ga0307411_10014806
877 Ga0307411_10116352
878 Ga0307411_10262967
879 Ga0395899_0017285
880 Ga0395900_0104737
881 Ga0395898_0245748
882 Ga0395905_0231893
883 Ga0395901_0048912
884 Ga0439436_0008907
885 Ga0439436_0032420
886 Ga0439438_036008
887 Ga0439461_0010129
888 Ga0439466_0004049
889 Ga0439466_0006517
890 Ga0439466_0011829
891 Ga0439465_0007340
892 Ga0439465_0079319
893 Ga0439465_0248013
894 Ga0451843_0146688
895 Ga0439431_0052865
896 Ga0439431_0104552
897 Ga0439433_0002376
898 Ga0439433_0026458
899 Ga0439442_005865
900 Ga0439442_013201
901 Ga0439442_014560
902 Ga0439445_0000602
903 Ga0439432_000888
904 Ga0439432_125054
905 Ga0439449_0002470
906 Ga0439449_0005939
907 Ga0439449_0015545
908 Ga0439452_001745
909 Ga0439452_010110
910 Ga0439455_0024238
911 Ga0439457_006358
912 Ga0439462_0002807
913 Ga0439462_0005749
914 Ga0439462_0091135
915 Ga0450911_011233
916 Ga0450920_004803
917 Ga0450921_000055
918 Ga0450921_000724
919 Ga0450897_011740
920 Ga0450896_005062
921 Ga0450896_013376
922 Ga0450898_034237
923 Ga0450906_001670
924 Ga0450906_004539
925 Ga0450907_020257
926 Ga0450910_000768
927 Ga0439446_0002135
928 Ga0450908_007012
929 Ga0450909_004452
930 Ga0439434_0000675
931 Ga0439434_0003094
932 Ga0439464_0097139
933 Ga0450916_040565
934 Ga0450918_000530
935 Ga0450893_0007759
936 Ga0450893_0008516
937 Ga0451577_0005155
938 Ga0451577_0107841
939 Ga0451577_0536532
940 Ga0466969_0000013
941 Ga0466969_0015119
942 Ga0466972_0073214
943 Ga0453683_0013789
944 Ga0466965_0018819
945 Ga0466965_0120128
946 Ga0466965_0136284
947 Ga0466966_0003674
948 Ga0466966_0016338
949 Ga0466966_0100455
950 Ga0466961_0001040
951 Ga0466961_0004397
952 Ga0466961_0025568
953 Ga0466963_0031400
954 Ga0466964_0000979
955 Ga0466964_0006889
956 Ga0453684_0009125
957 Ga0466971_0014210
958 Ga0466970_0003768
959 Ga0466970_0030395
960 Ga0466970_0072110
961 Ga0466957_0099590
962 Ga0466957_0195583
963 Ga0466960_0031664
964 Ga0466960_0208770
965 Ga0466959_0000128
966 Ga0466959_0033137
967 Ga0466959_0147499
968 Ga0451576_0012256
969 Ga0451576_0044383
970 Ga0466958_0045995
971 Ga0466958_0080725
972 Ga0466967_0001617
973 Ga0495627_031036
974 Ga0495627_065764
975 Ga0495590_0160711
976 Ga0495629_0118479
977 Ga0495638_0037458
978 Ga0495650_0003277
979 Ga0495605_0001087
980 Ga0495639_0032556
981 Ga0495596_0000536
982 Ga0495607_0014422
983 Ga0495610_0003005
984 Ga0495616_0001076
985 Ga0495616_0007999
986 Ga0495620_0059054
987 Ga0495631_0000181
988 Ga0495637_0005674
989 Ga0495643_0084159
990 Ga0495648_0149090
991 Ga0495663_0037143
992 Ga0495663_0045096
993 Ga0495642_0011952
994 Ga0495642_0071929
995 Ga0495654_0006640
996 Ga0495654_0128066
997 Ga0495609_0006294
998 Ga0495609_0111175
999 Ga0495621_0015508
1000 Ga0495621_0023406
1001 Ga0495597_0077935
1002 Ga0495656_0001122
1003 Ga0495668_0147798
1004 Ga0495625_0000437
1005 Ga0495625_0073443
1006 Ga0495635_0299668
1007 Ga0495661_0017551
1008 Ga0495661_0126646
1009 Ga0495588_0116271
1010 Ga0495588_0152672
1011 Ga0495588_0192101
1012 Ga0495599_0453354
1013 Ga0495646_0162075
1014 Ga0495658_0195800
1015 Ga0495658_0590623
1016 Ga0495613_0121457
1017 Ga0495670_0076366
1018 Ga0495670_0181896
1019 Ga0495670_0270526
1020 Ga0495671_0004671
1021 Ga0495671_0007941
1022 Ga0495649_0021810
1023 Ga0495581_0051887
1024 Ga0495604_0409051
1025 Ga0495672_0012955
1026 Ga0495677_0031265
1027 Ga0495685_002301
1028 Ga0495593_0016381
1029 Ga0495614_0037889
1030 Ga0495615_0010291
1031 Ga0496100_0038198
1032 Ga0496101_0025050
1033 Ga0496101_0134143
1034 Ga0496102_0013400
1035 Ga0496102_0427417
1036 Ga0496103_0016097
1037 Ga0496104_0019226
1038 Ga0496105_0039223
1039 Ga0496106_0047410
1040 Ga0496107_0192458
1041 Ga0496107_0297404
1042 Ga0496108_0389815
1043 Ga0496110_0143652
1044 Ga0496110_1117583
1045 Ga0496111_0152457
1046 Ga0496114_0223940
1047 Ga0496116_0013507
1048 Ga0496116_0047650
1049 Ga0496116_0067690
1050 Ga0496117_0049304
1051 Ga0496117_0123771
1052 Ga0496118_0019613
1053 Ga0496118_0091610
1054 Ga0496118_0092483
1055 Ga0496118_0397276
1056 Ga0496121_0015548
1057 Ga0496121_0029125
1058 Ga0496121_0161385
1059 Ga0496121_0232675
1060 Ga0496122_0000184
1061 Ga0496122_0054292
1062 Ga0496122_0070056
1063 Ga0496122_0125082
1064 Ga0496123_0000181
1065 Ga0496123_0012961
1066 Ga0496123_0018597
1067 Ga0496124_0177698
1068 Ga0496124_0325097
1069 Ga0496124_0593745
1070 Ga0496125_0026759
1071 Ga0496125_0046753
1072 Ga0496125_0075596
1073 Ga0496125_0103920
1074 Ga0496125_0266209
1075 Ga0496126_0594220
1076 Ga0501038_0313050
1077 Ga0501043_0148812
1078 Ga0501249_000300
1079 Ga0501225_0005546
1080 Ga0501262_000007
1081 Ga0501035_0118496
1082 nmdc:mga03683_13134_c1
1083 nmdc:mga03683_169809_c1
1084 nmdc:mga03683_282034_c1
1085 nmdc:mga03683_57032_c1
1086 nmdc:mga03n38_20618_c1
1087 nmdc:mga03n38_29857_c1
1088 nmdc:mga03n38_409114_c1
1089 nmdc:mga00v17_120659_c1
1090 nmdc:mga0yw44_408241_c1
1091 nmdc:mga0k408_18609_c1
1092 nmdc:mga0k408_49994_c1
1093 nmdc:mga06z11_372851_c1
1094 nmdc:mga06z11_440184_c1
1095 nmdc:mga04h51_195337_c1
1096 nmdc:mga07m45_122600_c1
1097 nmdc:mga07m45_126033_c1
1098 nmdc:mga07m45_141210_c1
1099 nmdc:mga07m45_30187_c1
1100 nmdc:mga07m45_425729_c1
1101 nmdc:mga07m45_4544_c1
1102 nmdc:mga07m45_7817_c1
1103 nmdc:mga0sz30_126046_c1
1104 Ga0500610_0001934
1105 Ga0500610_0020716
1106 Ga0500610_0161972
1107 Ga0495595_0218200
1108 Ga0495619_0188727
1109 Ga0500651_0000030
1110 Ga0500566_0070401
1111 Ga0500566_0213033
1112 Ga0500571_000049
1113 Ga0500592_004953
1114 Ga0500593_000117
1115 Ga0500594_0003501
1116 Ga0500595_135001
1117 Ga0500607_001200
1118 Ga0500607_038446
1119 Ga0500608_035003
1120 Ga0500655_004996
1121 Ga0500658_0001628
1122 Ga0500658_0001697
1123 Ga0500559_0002185
1124 Ga0500564_030739
1125 Ga0500568_0005131
1126 Ga0500573_0017788
1127 Ga0500574_003086
1128 Ga0500586_041440
1129 Ga0500616_0064142
1130 Ga0500634_0004933
1131 Ga0500638_032163
1132 Ga0500625_024129
1133 Ga0500596_011579
1134 Ga0466962_0003612
1135 Ga0466962_0078956
1136 Ga0466962_0079000
1137 2513231847
1138 2548501276
1139 2599674131
1140 2599678321
1141 2599690574
1142 2643868484
1143 2644061638
1144 2644075170
1145 2644161206
1146 2644295436
1147 2644325702
1148 2644400913
1149 2644466150
1150 2644649180
1151 2722881362
1152 2738723085
1153 2739243335
1154 2739249794
1155 2739283816
1156 2816473913
1157 2819602378
1158 2831270028
1159 2838054963
1160 2839140612
1161 2842737382
1162 2842749887
1163 2885194937
1164 2885202051
1165 2885215239
1166 2899927040
1167 2904545915
1168 2919706739
1169 2928043892
1170 2928048540
1171 2928054865
1172 2928068303
1173 2928073796
1174 2928086057
1175 2929161101
1176 2939633929
1177 2945973968
1178 2945990188
1179 2954770457
1180 2990715521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

35

218

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.4935 4 193
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.4763 4 193
8sbe-assembly1.cif.gz_A structure of the rat vesicular glutamate transporter 2 determined by single-particle cryo-em 0.4415 1 197
8sbe-assembly1.cif.gz_A structure of the rat vesicular glutamate transporter 2 determined by single-particle cryo-em 0.4288 1 197
6lyy-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate azd3965 in the outward-open conformation. 0.4154 6 196
ID Description Score Start End Superfamily
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5498 8 191 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5324 4 191 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5241 4 191 1.20.1250.20
af_C6TIG3_1_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5184 4 197 1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5179 8 191 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3R9ZAE6-F1-model_v4 LysE family translocator 0.9908 1 199 GO:0005886
GO:0015171
GO:0033228
AF-A0A7W9VS55-F1-model_v4 deleted 0.9889 1 199
AF-A0A519GYC3-F1-model_v4 LysE family translocator 0.9881 1 199 GO:0005886
GO:0015171
GO:0033228
AF-A0A653JK63-F1-model_v4 deleted 0.9835 1 199
AF-A0A317R8J9-F1-model_v4 Threonine/homoserine/homoserine lactone efflux protein 0.983 1 199 GO:0005886
GO:0015171
GO:0033228

Map