F466980

General Info

Members Datasets Scaffolds Average Seq Length
590 293 1180 315

Family's Representative Sequence

Representative Sequence 3300035207|Ga0373942_0002748|Ga0373942_0002748_1865_3004
Length 379
Sequence MIMGRVLRFIMCSFAVSTCASIVPTRFGEYLRQIRLRRRRKFRQLAQKFNAIPAFVTFAPFCGSICRMRRVRVIDSHTGGEPTRVVISGGPDLGSDSLANRLERFRNDHDDFRCAVVNEPRGSDGVVGALLCAPVDESCVTGLIFFDRSGYLGMCGHGTIGVVTTLAHLNRIGPGNHRIETPVGIVVAHLNENGKVEVTNVPSYRLATNVTIDVPGIGPVTGDVAWGGNWFFLVNDHGQQLEFENIDRLLEFTLRVREALARAGITGADGHEIDHVELFGPSQLPGVNSKNFVLCPSKTYDRSPCGTGTSAKLACLFADGKLQEGQVWKQESIVGTVFEGTIKLVDNMVHPRIKGSAFITAEADLILDARDPFAMGIGR

Samples

Sample ID Description Type Environment
1 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
134 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
240 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
241 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
256 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
257 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
261 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
262 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
263 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
264 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
265 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
268 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
282 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
283 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
284 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
285 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
286 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
287 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
288 2919085039 Luteibacter sp. 1214 Isolate Unclassified
289 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
290 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
291 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
292 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
293 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 3.05
Nodule 0
Rhizoplane 1.86
Rhizosphere 90.68
Stem 0
Stem Tuber 0
Unclassified 5.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373942_0002748 3300035207 Bacteria 4202
2 MRS1b_contig_4046139 2162886011 Bacteria 2216
3 CNAas_1000687 3300000532 Unclassified 3256
4 LJNas_1000973 3300000546 Bacteria 4564
5 JGI25156J39149_1000222 3300002705 Bacteria 39568
6 JGI25156J39149_1000835 3300002705 Bacteria 15565
7 JGI25154J39366_1002986 3300002738 Bacteria 3860
8 JGI25157J39369_1000056 3300002741 Bacteria 107681
9 JGI25157J39369_1000100 3300002741 Bacteria 73363
10 rootH1_10002255 3300003316 Bacteria 2358
11 Ga0055539_1000400 3300003752 Bacteria 16967
12 Ga0055533_1000080 3300003756 Bacteria 131291
13 Ga0055525_1001850 3300003759 Bacteria 2847
14 Ga0055535_1000357 3300003761 Bacteria 44443
15 Ga0055529_1000433 3300003763 Bacteria 42325
16 Ga0055529_1000772 3300003763 Bacteria 20105
17 Ga0065714_10064425 3300005288 Bacteria 189652
18 Ga0065704_10084316 3300005289 Bacteria 3349
19 Ga0065712_10067727 3300005290 Bacteria 189643
20 Ga0065715_10000520 3300005293 Bacteria 22337
21 Ga0065715_10009366 3300005293 Bacteria 2974
22 Ga0065715_10122956 3300005293 Bacteria 2184
23 Ga0065707_10014475 3300005295 Bacteria 2744
24 Ga0070658_10008509 3300005327 Bacteria 8249
25 Ga0070658_10023738 3300005327 Bacteria 4918
26 Ga0070658_10055663 3300005327 Bacteria 3214
27 Ga0070658_10391693 3300005327 Bacteria 1193
28 Ga0070676_10306289 3300005328 Bacteria 1079
29 Ga0070683_100136737 3300005329 Unclassified 2321
30 Ga0070690_100013982 3300005330 Bacteria 4759
31 Ga0070670_100000190 3300005331 Bacteria 56382
32 Ga0070670_100107096 3300005331 Bacteria 2409
33 Ga0068869_100071495 3300005334 Unclassified 2569
34 Ga0068869_100143540 3300005334 Bacteria 1846
35 Ga0068869_100159889 3300005334 Bacteria 1753
36 Ga0068869_100184643 3300005334 Bacteria 1636
37 Ga0070666_10038327 3300005335 Bacteria 3188
38 Ga0070680_100097092 3300005336 Unclassified 2443
39 Ga0070680_100226177 3300005336 Unclassified 1580
40 Ga0070682_100028147 3300005337 Bacteria 3378
41 Ga0068868_100030083 3300005338 Bacteria 4163
42 Ga0068868_100405157 3300005338 Bacteria 1178
43 Ga0070660_100194307 3300005339 Bacteria 1644
44 Ga0070689_100011690 3300005340 Bacteria 6299
45 Ga0070687_100057980 3300005343 Bacteria 2033
46 Ga0070661_100011670 3300005344 Bacteria 6125
47 Ga0070661_100248856 3300005344 Unclassified 1371
48 Ga0070692_10038186 3300005345 Bacteria 2446
49 Ga0070692_10084609 3300005345 Bacteria 1714
50 Ga0070669_100025253 3300005353 Bacteria 4267
51 Ga0070669_100230629 3300005353 Bacteria 1467
52 Ga0070675_100098253 3300005354 Bacteria 2462
53 Ga0070675_100314201 3300005354 Unclassified 1383
54 Ga0070671_100058154 3300005355 Bacteria 3219
55 Ga0070673_100003539 3300005364 Bacteria 9740
56 Ga0070673_100168728 3300005364 Bacteria 1867
57 Ga0070659_100002688 3300005366 Bacteria 12637
58 Ga0070659_100040156 3300005366 Bacteria 3655
59 Ga0070667_100038272 3300005367 Bacteria 4021
60 Ga0070703_10055496 3300005406 Bacteria 1280
61 Ga0070709_10254185 3300005434 Bacteria 1267
62 Ga0070714_100178260 3300005435 Bacteria 1932
63 Ga0070713_100003514 3300005436 Bacteria 10353
64 Ga0070713_100065812 3300005436 Unclassified 3046
65 Ga0070701_10245812 3300005438 Bacteria 1078
66 Ga0070705_100160613 3300005440 Bacteria 1502
67 Ga0070700_100000047 3300005441 Bacteria 90040
68 Ga0070700_100009101 3300005441 Bacteria 5442
69 Ga0070700_100017991 3300005441 Bacteria 4055
70 Ga0070694_100031779 3300005444 Bacteria 3463
71 Ga0070694_100053848 3300005444 Bacteria 2724
72 Ga0070662_100305608 3300005457 Bacteria 1293
73 Ga0070681_10000991 3300005458 Bacteria 24026
74 Ga0070681_10011837 3300005458 Bacteria 8647
75 Ga0070681_10019055 3300005458 Bacteria 6868
76 Ga0070681_10062988 3300005458 Unclassified 3681
77 Ga0068867_100066515 3300005459 Bacteria 2685
78 Ga0070706_100000305 3300005467 Bacteria 59523
79 Ga0070707_100003309 3300005468 Bacteria 15219
80 Ga0070707_100030775 3300005468 Bacteria 5112
81 Ga0070698_100030109 3300005471 Bacteria 5631
82 Ga0070698_100055758 3300005471 Bacteria 4005
83 Ga0070698_100366511 3300005471 Bacteria 1373
84 Ga0070699_100000978 3300005518 Bacteria 26634
85 Ga0070699_100052966 3300005518 Bacteria 3512
86 Ga0070679_100015571 3300005530 Bacteria 7307
87 Ga0070679_100131172 3300005530 Unclassified 2487
88 Ga0070679_100159787 3300005530 Bacteria 2228
89 Ga0070684_100000038 3300005535 Bacteria 94959
90 Ga0070697_100171668 3300005536 Bacteria 1835
91 Ga0068853_100024960 3300005539 Bacteria 5016
92 Ga0070686_100159888 3300005544 Bacteria 1586
93 Ga0070695_100055708 3300005545 Bacteria 2549
94 Ga0070696_100115532 3300005546 Bacteria 1937
95 Ga0070696_100309414 3300005546 Bacteria 1213
96 Ga0070704_100063873 3300005549 Bacteria 2644
97 Ga0070704_100101781 3300005549 Bacteria 2166
98 Ga0070704_100339459 3300005549 Bacteria 1264
99 Ga0068855_100004750 3300005563 Bacteria 16587
100 Ga0068855_100043417 3300005563 Bacteria 5325
101 Ga0068855_100238384 3300005563 Bacteria 2033
102 Ga0070664_100002701 3300005564 Bacteria 14318
103 Ga0070664_100052266 3300005564 Bacteria 3460
104 Ga0070664_100056741 3300005564 Bacteria 3327
105 Ga0070664_100076952 3300005564 Bacteria 2868
106 Ga0070664_100531173 3300005564 Bacteria 1087
107 Ga0068857_100001183 3300005577 Bacteria 20375
108 Ga0068857_100003033 3300005577 Bacteria 13888
109 Ga0068857_100018023 3300005577 Bacteria 6194
110 Ga0068857_100028380 3300005577 Bacteria 4938
111 Ga0068857_100055661 3300005577 Bacteria 3510
112 Ga0068857_100234109 3300005577 Bacteria 1680
113 Ga0068857_100240734 3300005577 Bacteria 1656
114 Ga0068857_100394094 3300005577 Bacteria 1288
115 Ga0068854_100045828 3300005578 Bacteria 3111
116 Ga0068854_100260509 3300005578 Unclassified 1388
117 Ga0068856_100000247 3300005614 Bacteria 58943
118 Ga0068856_100000722 3300005614 Bacteria 35876
119 Ga0070702_100003608 3300005615 Bacteria 6953
120 Ga0070702_100224629 3300005615 Bacteria 1258
121 Ga0070702_100250324 3300005615 Bacteria 1201
122 Ga0068852_100031067 3300005616 Bacteria 4402
123 Ga0068852_100040345 3300005616 Bacteria 3937
124 Ga0068852_100072927 3300005616 Bacteria 3019
125 Ga0068852_100143422 3300005616 Bacteria 2213
126 Ga0068859_100006226 3300005617 Bacteria 12112
127 Ga0068859_100009958 3300005617 Bacteria 9589
128 Ga0068859_100019709 3300005617 Bacteria 6774
129 Ga0068859_100023383 3300005617 Bacteria 6202
130 Ga0068859_100028873 3300005617 Bacteria 5563
131 Ga0068859_100034560 3300005617 Bacteria 5073
132 Ga0068859_100060421 3300005617 Unclassified 3819
133 Ga0068859_100080936 3300005617 Bacteria 3289
134 Ga0068859_100090560 3300005617 Bacteria 3110
135 Ga0068859_100376924 3300005617 Unclassified 1514
136 Ga0068859_100528631 3300005617 Bacteria 1274
137 Ga0068864_100005438 3300005618 Bacteria 10444
138 Ga0068864_100060141 3300005618 Bacteria 3289
139 Ga0068864_100060926 3300005618 Unclassified 3268
140 Ga0068864_100216790 3300005618 Bacteria 1764
141 Ga0068864_100264708 3300005618 Bacteria 1600
142 Ga0068866_10130515 3300005718 Bacteria 1428
143 Ga0068861_100067771 3300005719 Bacteria 2756
144 Ga0068861_100139309 3300005719 Bacteria 1978
145 Ga0068861_100147422 3300005719 Bacteria 1927
146 Ga0068861_100372781 3300005719 Bacteria 1258
147 Ga0068851_10006676 3300005834 Bacteria 5279
148 Ga0068863_100041372 3300005841 Bacteria 4382
149 Ga0068863_100068757 3300005841 Bacteria 3350
150 Ga0068863_100092211 3300005841 Bacteria 2874
151 Ga0068863_100161928 3300005841 Bacteria 2144
152 Ga0068858_100048925 3300005842 Bacteria 3916
153 Ga0068858_100051777 3300005842 Bacteria 3799
154 Ga0068858_100103386 3300005842 Bacteria 2657
155 Ga0068858_100194295 3300005842 Bacteria 1918
156 Ga0068858_100285068 3300005842 Bacteria 1573
157 Ga0068860_100020977 3300005843 Bacteria 6331
158 Ga0068860_100046626 3300005843 Bacteria 4132
159 Ga0068860_100083605 3300005843 Bacteria 3036
160 Ga0068860_100087101 3300005843 Bacteria 2973
161 Ga0068860_100179005 3300005843 Bacteria 2049
162 Ga0068860_100335564 3300005843 Bacteria 1486
163 Ga0068862_100075016 3300005844 Bacteria 2924
164 Ga0068862_100131999 3300005844 Bacteria 2210
165 Ga0068862_100158387 3300005844 Bacteria 2020
166 Ga0081455_10083166 3300005937 Bacteria 2616
167 Ga0081539_10001529 3300005985 Bacteria 38746
168 Ga0081539_10005669 3300005985 Bacteria 12532
169 Ga0081539_10018864 3300005985 Bacteria 4754
170 Ga0081539_10083112 3300005985 Unclassified 1677
171 Ga0070717_10073137 3300006028 Bacteria 2864
172 Ga0070717_10097272 3300006028 Bacteria 2494
173 Ga0097621_100005230 3300006237 Bacteria 9125
174 Ga0097621_100010737 3300006237 Bacteria 6716
175 Ga0097621_100037611 3300006237 Bacteria 3880
176 Ga0097621_100047701 3300006237 Bacteria 3472
177 Ga0097621_100192884 3300006237 Bacteria 1765
178 Ga0068871_100019181 3300006358 Bacteria 5219
179 Ga0068871_100044637 3300006358 Bacteria 3566
180 Ga0068871_100070632 3300006358 Bacteria 2870
181 Ga0075428_100071806 3300006844 Bacteria 3783
182 Ga0075428_100497209 3300006844 Bacteria 1305
183 Ga0075431_100460325 3300006847 Bacteria 1267
184 Ga0075433_10088101 3300006852 Bacteria 2742
185 Ga0075433_10120465 3300006852 Bacteria 2330
186 Ga0075433_10178161 3300006852 Bacteria 1891
187 Ga0075434_100063142 3300006871 Bacteria 3686
188 Ga0075434_100196361 3300006871 Bacteria 2038
189 Ga0075434_100500056 3300006871 Bacteria 1237
190 Ga0075429_100058672 3300006880 Bacteria 3352
191 Ga0075429_100178375 3300006880 Bacteria 1861
192 Ga0068865_100023803 3300006881 Bacteria 4014
193 Ga0075436_100006391 3300006914 Bacteria 8076
194 Ga0075436_100050778 3300006914 Bacteria 2862
195 Ga0075436_100220045 3300006914 Bacteria 1347
196 Ga0097620_100006226 3300006931 Bacteria 12112
197 Ga0097620_100009957 3300006931 Bacteria 9589
198 Ga0097620_100019709 3300006931 Bacteria 6774
199 Ga0097620_100023383 3300006931 Bacteria 6202
200 Ga0097620_100028871 3300006931 Bacteria 5563
201 Ga0097620_100034558 3300006931 Bacteria 5073
202 Ga0097620_100060422 3300006931 Unclassified 3819
203 Ga0097620_100080935 3300006931 Bacteria 3289
204 Ga0097620_100090559 3300006931 Bacteria 3110
205 Ga0097620_100315517 3300006931 Bacteria 1657
206 Ga0097620_100376934 3300006931 Unclassified 1514
207 Ga0097620_100528607 3300006931 Bacteria 1274
208 Ga0075435_100305126 3300007076 Bacteria 1362
209 Ga0105251_10004327 3300009011 Bacteria 9721
210 Ga0105251_10042756 3300009011 Bacteria 2196
211 Ga0105251_10115148 3300009011 Bacteria 1223
212 Ga0105251_10117009 3300009011 Bacteria 1212
213 Ga0105244_10020684 3300009036 Bacteria 3652
214 Ga0105240_10037272 3300009093 Bacteria 6250
215 Ga0105240_10049969 3300009093 Bacteria 5275
216 Ga0105240_10122290 3300009093 Bacteria 3132
217 Ga0105240_10211213 3300009093 Bacteria 2268
218 Ga0111539_10024249 3300009094 Bacteria 7449
219 Ga0111539_10106009 3300009094 Bacteria 3297
220 Ga0111539_10139405 3300009094 Bacteria 2840
221 Ga0111539_10409110 3300009094 Bacteria 1580
222 Ga0105245_10136474 3300009098 Bacteria 2306
223 Ga0105247_10001923 3300009101 Bacteria 14491
224 Ga0114129_10013535 3300009147 Bacteria 11626
225 Ga0105243_10000144 3300009148 Bacteria 81484
226 Ga0105243_10002285 3300009148 Bacteria 16071
227 Ga0105243_10099965 3300009148 Bacteria 2406
228 Ga0105241_10021785 3300009174 Bacteria 4742
229 Ga0105241_10119423 3300009174 Bacteria 2121
230 Ga0105241_10138667 3300009174 Bacteria 1978
231 Ga0105241_10179691 3300009174 Bacteria 1754
232 Ga0105241_10246745 3300009174 Unclassified 1512
233 Ga0105242_10051934 3300009176 Bacteria 3343
234 Ga0105242_10122544 3300009176 Bacteria 2234
235 Ga0105242_10268931 3300009176 Bacteria 1543
236 Ga0105242_10326998 3300009176 Bacteria 1408
237 Ga0105248_10008342 3300009177 Bacteria 11380
238 Ga0105248_10026990 3300009177 Bacteria 6387
239 Ga0105248_10034742 3300009177 Bacteria 5641
240 Ga0105248_10038862 3300009177 Bacteria 5328
241 Ga0105248_10170110 3300009177 Bacteria 2456
242 Ga0105248_10207095 3300009177 Bacteria 2210
243 Ga0105248_10654933 3300009177 Bacteria 1185
244 Ga0105237_10000843 3300009545 Bacteria 41798
245 Ga0105237_10028407 3300009545 Bacteria 5698
246 Ga0105237_10231625 3300009545 Bacteria 1848
247 Ga0105238_10000370 3300009551 Bacteria 48257
248 Ga0105238_10006520 3300009551 Bacteria 11616
249 Ga0105238_10013280 3300009551 Bacteria 8312
250 Ga0105249_10000844 3300009553 Bacteria 27423
251 Ga0105249_10261993 3300009553 Bacteria 1718
252 Ga0105028_107051 3300009993 Bacteria 1173
253 Ga0105239_10040324 3300010375 Bacteria 5116
254 Ga0105239_10053571 3300010375 Bacteria 4425
255 Ga0105239_10124425 3300010375 Bacteria 2865
256 Ga0105239_10196306 3300010375 Bacteria 2260
257 Ga0105239_10401014 3300010375 Bacteria 1552
258 Ga0105246_10151469 3300011119 Bacteria 1756
259 Ga0105246_10167253 3300011119 Bacteria 1681
260 Ga0157373_10026181 3300013100 Bacteria 4215
261 Ga0157373_10071289 3300013100 Unclassified 2454
262 Ga0157373_10129172 3300013100 Unclassified 1777
263 Ga0157371_10015105 3300013102 Bacteria 5804
264 Ga0157370_10007038 3300013104 Bacteria 12279
265 Ga0157370_10055878 3300013104 Bacteria 3759
266 Ga0157370_10178711 3300013104 Bacteria 1972
267 Ga0157369_10000401 3300013105 Bacteria 57752
268 Ga0157369_10001968 3300013105 Bacteria 24775
269 Ga0157369_10016299 3300013105 Bacteria 8365
270 Ga0157369_10050147 3300013105 Bacteria 4522
271 Ga0157369_10113789 3300013105 Bacteria 2874
272 Ga0157369_10276000 3300013105 Bacteria 1751
273 Ga0157374_10008732 3300013296 Bacteria 8669
274 Ga0157374_10052985 3300013296 Unclassified 3781
275 Ga0157374_10105404 3300013296 Bacteria 2708
276 Ga0157378_10003679 3300013297 Bacteria 13600
277 Ga0157378_10020058 3300013297 Bacteria 5879
278 Ga0157378_10174563 3300013297 Bacteria 2018
279 Ga0157378_10194758 3300013297 Bacteria 1914
280 Ga0157378_10286708 3300013297 Unclassified 1589
281 Ga0163162_10004613 3300013306 Bacteria 13279
282 Ga0163162_10027304 3300013306 Bacteria 5644
283 Ga0163162_10043171 3300013306 Bacteria 4514
284 Ga0157372_10004845 3300013307 Bacteria 14308
285 Ga0157372_10010935 3300013307 Bacteria 9659
286 Ga0157372_10072929 3300013307 Bacteria 3869
287 Ga0157372_10090997 3300013307 Bacteria 3470
288 Ga0157372_10170897 3300013307 Bacteria 2515
289 Ga0157372_10215609 3300013307 Bacteria 2225
290 Ga0157372_10571390 3300013307 Bacteria 1318
291 Ga0157372_10880814 3300013307 Bacteria 1039
292 Ga0157375_10096948 3300013308 Bacteria 3022
293 Ga0157375_10113584 3300013308 Bacteria 2809
294 Ga0157375_10674334 3300013308 Bacteria 1189
295 Ga0163163_10000209 3300014325 Bacteria 60592
296 Ga0163163_10002342 3300014325 Bacteria 16028
297 Ga0163163_10004974 3300014325 Bacteria 11444
298 Ga0163163_10018160 3300014325 Bacteria 6576
299 Ga0163163_10048137 3300014325 Bacteria 4191
300 Ga0163163_10074278 3300014325 Bacteria 3392
301 Ga0163163_10094424 3300014325 Bacteria 3009
302 Ga0163163_10237341 3300014325 Bacteria 1873
303 Ga0157380_10023612 3300014326 Bacteria 4641
304 Ga0157380_10382101 3300014326 Bacteria 1329
305 Ga0157377_10000074 3300014745 Bacteria 77443
306 Ga0157377_10106824 3300014745 Bacteria 1677
307 Ga0157379_10046382 3300014968 Bacteria 3876
308 Ga0157376_10061364 3300014969 Bacteria 3160
309 Ga0157376_10069379 3300014969 Bacteria 2988
310 Ga0182005_1000004 3300015265 Bacteria 609645
311 Ga0163161_10012424 3300017792 Bacteria 5913
312 Ga0209674_100003 3300025226 Bacteria 2196646
313 Ga0209563_100049 3300025230 Bacteria 358472
314 Ga0207427_101398 3300025231 Bacteria 8819
315 Ga0209258_100189 3300025242 Bacteria 128268
316 Ga0209646_1000124 3300025246 Bacteria 138207
317 Ga0209026_1000085 3300025250 Bacteria 185778
318 Ga0209677_100135 3300025253 Bacteria 69251
319 Ga0209677_100203 3300025253 Bacteria 47561
320 Ga0209677_103161 3300025253 Bacteria 5556
321 Ga0209759_1000068 3300025256 Bacteria 183479
322 Ga0209759_1000729 3300025256 Bacteria 28835
323 Ga0209759_1002917 3300025256 Bacteria 7174
324 Ga0209759_1010734 3300025256 Bacteria 2662
325 Ga0209455_1000092 3300025272 Bacteria 220516
326 Ga0209051_1004213 3300025303 Bacteria 8973
327 Ga0207697_10088546 3300025315 Bacteria 1310
328 Ga0207656_10003975 3300025321 Bacteria 5122
329 Ga0207713_1029389 3300025735 Bacteria 2463
330 Ga0207653_10000894 3300025885 Bacteria 9903
331 Ga0207642_10048586 3300025899 Bacteria 1903
332 Ga0207710_10001516 3300025900 Bacteria 11506
333 Ga0207680_10018308 3300025903 Bacteria 3721
334 Ga0207680_10085754 3300025903 Bacteria 1990
335 Ga0207647_10003108 3300025904 Bacteria 12466
336 Ga0207647_10098742 3300025904 Bacteria 1735
337 Ga0207645_10041276 3300025907 Bacteria 2954
338 Ga0207643_10010983 3300025908 Bacteria 4886
339 Ga0207643_10040090 3300025908 Bacteria 2636
340 Ga0207643_10135635 3300025908 Bacteria 1467
341 Ga0207705_10010139 3300025909 Bacteria 6857
342 Ga0207705_10043903 3300025909 Bacteria 3211
343 Ga0207684_10000053 3300025910 Bacteria 225260
344 Ga0207684_10031170 3300025910 Bacteria 4538
345 Ga0207654_10014038 3300025911 Bacteria 4132
346 Ga0207707_10000004 3300025912 Bacteria 391281
347 Ga0207707_10009356 3300025912 Bacteria 8498
348 Ga0207707_10114856 3300025912 Bacteria 2353
349 Ga0207695_10024272 3300025913 Bacteria 6827
350 Ga0207695_10111010 3300025913 Bacteria 2721
351 Ga0207695_10151287 3300025913 Bacteria 2260
352 Ga0207695_10194026 3300025913 Bacteria 1947
353 Ga0207671_10043459 3300025914 Bacteria 3323
354 Ga0207660_10002498 3300025917 Bacteria 12095
355 Ga0207660_10126680 3300025917 Unclassified 1940
356 Ga0207660_10126851 3300025917 Unclassified 1938
357 Ga0207662_10024050 3300025918 Bacteria 3505
358 Ga0207662_10151478 3300025918 Bacteria 1475
359 Ga0207657_10084610 3300025919 Bacteria 2658
360 Ga0207652_10000087 3300025921 Bacteria 99945
361 Ga0207652_10008111 3300025921 Bacteria 8432
362 Ga0207652_10127830 3300025921 Bacteria 2264
363 Ga0207652_10135206 3300025921 Unclassified 2201
364 Ga0207646_10069952 3300025922 Bacteria 3134
365 Ga0207646_10226594 3300025922 Bacteria 1688
366 Ga0207646_10352112 3300025922 Bacteria 1331
367 Ga0207694_10003790 3300025924 Bacteria 11963
368 Ga0207694_10025335 3300025924 Bacteria 4508
369 Ga0207694_10028730 3300025924 Bacteria 4241
370 Ga0207650_10000007 3300025925 Bacteria 530810
371 Ga0207650_10150340 3300025925 Bacteria 1837
372 Ga0207650_10271164 3300025925 Bacteria 1379
373 Ga0207659_10067416 3300025926 Bacteria 2599
374 Ga0207659_10137334 3300025926 Bacteria 1894
375 Ga0207659_10265038 3300025926 Bacteria 1399
376 Ga0207687_10075007 3300025927 Bacteria 2426
377 Ga0207700_10102017 3300025928 Bacteria 2290
378 Ga0207700_10108400 3300025928 Bacteria 2230
379 Ga0207700_10235088 3300025928 Bacteria 1560
380 Ga0207700_10434474 3300025928 Unclassified 1155
381 Ga0207664_10017642 3300025929 Bacteria 5238
382 Ga0207664_10189094 3300025929 Bacteria 1771
383 Ga0207644_10353218 3300025931 Bacteria 1194
384 Ga0207690_10045759 3300025932 Bacteria 2893
385 Ga0207690_10062705 3300025932 Unclassified 2532
386 Ga0207690_10090434 3300025932 Bacteria 2161
387 Ga0207690_10185748 3300025932 Bacteria 1568
388 Ga0207706_10010126 3300025933 Bacteria 8632
389 Ga0207706_10216847 3300025933 Bacteria 1676
390 Ga0207686_10234572 3300025934 Bacteria 1332
391 Ga0207686_10257850 3300025934 Bacteria 1277
392 Ga0207670_10001523 3300025936 Bacteria 12188
393 Ga0207670_10244760 3300025936 Bacteria 1383
394 Ga0207704_10296128 3300025938 Bacteria 1237
395 Ga0207691_10014923 3300025940 Bacteria 7402
396 Ga0207711_10028499 3300025941 Unclassified 4699
397 Ga0207711_10114592 3300025941 Bacteria 2401
398 Ga0207689_10014720 3300025942 Bacteria 6643
399 Ga0207689_10047043 3300025942 Bacteria 3564
400 Ga0207689_10048650 3300025942 Bacteria 3498
401 Ga0207689_10064957 3300025942 Bacteria 3002
402 Ga0207689_10132329 3300025942 Bacteria 2053
403 Ga0207689_10135406 3300025942 Bacteria 2028
404 Ga0207689_10179110 3300025942 Bacteria 1748
405 Ga0207689_10265932 3300025942 Bacteria 1419
406 Ga0207661_10093237 3300025944 Unclassified 2513
407 Ga0207667_10002685 3300025949 Bacteria 22003
408 Ga0207667_10074935 3300025949 Bacteria 3514
409 Ga0207667_10127757 3300025949 Bacteria 2618
410 Ga0207667_10146617 3300025949 Bacteria 2430
411 Ga0207651_10082845 3300025960 Bacteria 2317
412 Ga0207651_10102670 3300025960 Bacteria 2126
413 Ga0207651_10109126 3300025960 Bacteria 2073
414 Ga0207651_10349593 3300025960 Bacteria 1244
415 Ga0207712_10001401 3300025961 Bacteria 16456
416 Ga0207712_10096231 3300025961 Bacteria 2191
417 Ga0207640_10035617 3300025981 Bacteria 3116
418 Ga0207640_10068539 3300025981 Bacteria 2378
419 Ga0207677_10333314 3300026023 Bacteria 1265
420 Ga0207703_10036835 3300026035 Bacteria 3895
421 Ga0207703_10169093 3300026035 Bacteria 1921
422 Ga0207703_10249169 3300026035 Bacteria 1600
423 Ga0207639_10008033 3300026041 Bacteria 7212
424 Ga0207639_10144576 3300026041 Bacteria 1985
425 Ga0207639_10386214 3300026041 Bacteria 1258
426 Ga0207678_10402809 3300026067 Unclassified 1185
427 Ga0207708_10000113 3300026075 Bacteria 62692
428 Ga0207708_10014216 3300026075 Bacteria 5952
429 Ga0207708_10024164 3300026075 Bacteria 4596
430 Ga0207708_10084634 3300026075 Bacteria 2438
431 Ga0207708_10299722 3300026075 Bacteria 1307
432 Ga0207702_10000235 3300026078 Bacteria 64091
433 Ga0207702_10001127 3300026078 Bacteria 27289
434 Ga0207702_10024438 3300026078 Bacteria 5014
435 Ga0207702_10055061 3300026078 Bacteria 3373
436 Ga0207641_10051511 3300026088 Unclassified 3487
437 Ga0207641_10086461 3300026088 Bacteria 2734
438 Ga0207641_10270818 3300026088 Bacteria 1593
439 Ga0207641_10409312 3300026088 Bacteria 1304
440 Ga0207648_10012132 3300026089 Bacteria 8080
441 Ga0207648_10032894 3300026089 Bacteria 4576
442 Ga0207648_10095808 3300026089 Unclassified 2596
443 Ga0207676_10003576 3300026095 Bacteria 10980
444 Ga0207676_10014396 3300026095 Bacteria 5690
445 Ga0207676_10054349 3300026095 Bacteria 3138
446 Ga0207674_10003076 3300026116 Bacteria 20639
447 Ga0207674_10009239 3300026116 Bacteria 11299
448 Ga0207674_10045026 3300026116 Bacteria 4541
449 Ga0207674_10047263 3300026116 Bacteria 4413
450 Ga0207674_10050907 3300026116 Bacteria 4228
451 Ga0207674_10092481 3300026116 Bacteria 3014
452 Ga0207674_10205464 3300026116 Bacteria 1919
453 Ga0207674_10221059 3300026116 Bacteria 1842
454 Ga0207674_10258053 3300026116 Bacteria 1690
455 Ga0207674_10365984 3300026116 Bacteria 1394
456 Ga0207675_100006726 3300026118 Bacteria 10871
457 Ga0207675_100096602 3300026118 Bacteria 2782
458 Ga0207683_10247172 3300026121 Bacteria 1627
459 Ga0207698_10048609 3300026142 Bacteria 3222
460 Ga0207698_10116362 3300026142 Bacteria 2253
461 Ga0207698_10125428 3300026142 Bacteria 2182
462 Ga0207698_10294575 3300026142 Bacteria 1508
463 Ga0207428_10009063 3300027907 Bacteria 8949
464 Ga0268266_10000140 3300028379 Bacteria 140387
465 Ga0268265_10106379 3300028380 Bacteria 2279
466 Ga0268265_10402435 3300028380 Bacteria 1266
467 Ga0268265_10490876 3300028380 Bacteria 1155
468 Ga0268264_10012975 3300028381 Bacteria 6851
469 Ga0268264_10043066 3300028381 Bacteria 3739
470 Ga0268264_10086297 3300028381 Bacteria 2696
471 Ga0268264_10097643 3300028381 Bacteria 2547
472 Ga0268264_10105531 3300028381 Bacteria 2458
473 Ga0265336_10000006 3300028666 Bacteria 348453
474 Ga0307515_10097879 3300028794 Bacteria 3580
475 Ga0265324_10001517 3300029957 Bacteria 13111
476 Ga0265339_10163154 3300031249 Eukaryota 1120
477 Ga0307513_10115348 3300031456 Bacteria 2668
478 Ga0307516_10001445 3300031730 Bacteria 32809
479 Ga0307405_10033920 3300031731 Bacteria 3033
480 Ga0307410_10013753 3300031852 Bacteria 4736
481 Ga0307410_10329450 3300031852 Bacteria 1214
482 Ga0307406_10000949 3300031901 Bacteria 16238
483 Ga0307414_10149131 3300032004 Bacteria 1842
484 Ga0307507_10033999 3300033179 Bacteria 5279
485 Ga0373939_0044473 3300035114 Bacteria 1352
486 Ga0373931_0228514 3300035691 Bacteria 1123
487 Ga0373935_0213960 3300035692 Bacteria 1336
488 Ga0373933_0143295 3300035724 Bacteria 1510
489 Ga0373937_0107331 3300036401 Bacteria 2596
490 Ga0373937_0568774 3300036401 Bacteria 1077
491 Ga0373925_0284996 3300037068 Bacteria 1331
492 Ga0395898_0123374 3300037466 Bacteria 2482
493 Ga0395905_0221084 3300037471 Bacteria 1772
494 Ga0436364_0681300 3300037853 Bacteria 3923
495 Ga0436364_1343081 3300037853 Bacteria 2671
496 Ga0395901_0033779 3300038443 Bacteria 5282
497 Ga0395901_0566583 3300038443 Bacteria 1149
498 Ga0242420_000456 3300038996 Bacteria 4628
499 Ga0436360_0258342 3300039438 Bacteria 1360
500 Ga0451577_0087014 3300042876 Bacteria 2788
501 Ga0451577_0270866 3300042876 Bacteria 1538
502 Ga0466969_0002921 3300044656 Bacteria 9118
503 Ga0466965_0003825 3300044683 Bacteria 6644
504 Ga0466966_0008102 3300044684 Bacteria 6966
505 Ga0466961_0037377 3300044693 Bacteria 3114
506 Ga0466964_0004764 3300044706 Bacteria 5016
507 Ga0466957_0020261 3300044842 Bacteria 3914
508 Ga0466959_0002303 3300045049 Bacteria 12179
509 Ga0451576_0016127 3300045051 Bacteria 8255
510 Ga0451576_0150474 3300045051 Bacteria 2427
511 Ga0451576_0458258 3300045051 Bacteria 1339
512 Ga0495582_0217886 3300046473 Bacteria 1092
513 Ga0495582_0341192 3300046473 Bacteria 862
514 Ga0495639_0011388 3300046475 Bacteria 3835
515 Ga0495639_0050284 3300046475 Bacteria 1893
516 Ga0495664_0083564 3300046477 Bacteria 1916
517 Ga0495583_0000224 3300046506 Bacteria 95810
518 Ga0495606_0001614 3300046507 Bacteria 29404
519 Ga0495608_0017001 3300046511 Bacteria 5032
520 Ga0495616_0007064 3300046513 Bacteria 6745
521 Ga0495630_0000667 3300046517 Bacteria 24749
522 Ga0495625_0031520 3300046660 Bacteria 3942
523 Ga0495635_0040140 3300046663 Bacteria 3235
524 Ga0495646_0188281 3300046680 Bacteria 1129
525 Ga0495658_0094808 3300046683 Bacteria 1773
526 Ga0495669_0007294 3300046684 Bacteria 4632
527 Ga0495624_0004031 3300046690 Bacteria 10804
528 Ga0495649_0002245 3300046694 Bacteria 13726
529 Ga0495589_0027344 3300046794 Bacteria 2884
530 Ga0495581_0033187 3300047315 Bacteria 2989
531 Ga0495676_0188098 3300047321 Bacteria 1442
532 Ga0495675_0302149 3300047444 Bacteria 950
533 Ga0495684_0006627 3300047471 Bacteria 8982
534 Ga0495686_0024061 3300047472 Bacteria 4005
535 Ga0496103_0134844 3300048906 Bacteria 1578
536 Ga0496104_0102634 3300048907 Bacteria 2739
537 Ga0496104_0200665 3300048907 Bacteria 1907
538 Ga0496105_0145498 3300048908 Bacteria 1949
539 Ga0496108_0161645 3300048911 Bacteria 1936
540 Ga0496109_0541876 3300048912 Bacteria 1098
541 Ga0496110_0246020 3300048913 Bacteria 1628
542 Ga0496112_0056264 3300048915 Bacteria 3871
543 Ga0496112_0060783 3300048915 Bacteria 3724
544 Ga0496112_0366656 3300048915 Bacteria 1382
545 Ga0496113_0195818 3300048916 Bacteria 1605
546 Ga0501292_008074 3300049515 Bacteria 1531
547 Ga0501298_008826 3300049521 Bacteria 1702
548 Ga0501299_009095 3300049522 Bacteria 1630
549 Ga0501070_0253588 3300049586 Bacteria 1439
550 Ga0501072_0411049 3300049588 Bacteria 1073
551 Ga0501227_014912 3300049665 Bacteria 1731
552 Ga0501230_007695 3300049667 Bacteria 1606
553 Ga0501233_014619 3300049668 Bacteria 1606
554 Ga0501257_007104 3300049686 Bacteria 2497
555 Ga0501221_018094 3300049704 Bacteria 1353
556 Ga0501225_0000594 3300049705 Bacteria 11294
557 Ga0501080_0031731 3300049742 Bacteria 4923
558 Ga0501271_005834 3300049768 Bacteria 1210
559 Ga0501273_000997 3300049770 Bacteria 2539
560 Ga0501044_0001575 3300049823 Bacteria 26679
561 nmdc:mga05p37_113313_c1 3300050507 Bacteria 3334
562 nmdc:mga05p37_86867_c1 3300050507 Bacteria 3855
563 nmdc:mga09592_118706_c1 3300050508 Bacteria 2270
564 nmdc:mga09592_45617_c1 3300050508 Bacteria 3692
565 nmdc:mga08y16_186121_c1 3300050511 Bacteria 2155
566 nmdc:mga08y16_232319_c1 3300050511 Bacteria 1907
567 nmdc:mga08y16_2741_c1 3300050511 Bacteria 18062
568 nmdc:mga08y16_79491_c1 3300050511 Bacteria 3418
569 nmdc:mga0rr50_32695_c1 3300050513 Bacteria 3709
570 nmdc:mga0a205_5488_c1 3300050515 Bacteria 11420
571 nmdc:mga0a205_82339_c1 3300050515 Bacteria 3108
572 nmdc:mga0sz30_130319_c1 3300050516 Bacteria 1108
573 Ga0495601_0000786 3300053077 Bacteria 17145
574 Ga0500635_0000057 3300053080 Bacteria 73077
575 Ga0495595_0035117 3300053084 Bacteria 2271
576 Ga0495619_0002942 3300053085 Bacteria 11061
577 Ga0501084_0207999 3300054114 Viruses 1651
578 Ga0500661_011670 3300055283 Bacteria 1588
579 2510282664 2510065053 Bacteria 5005518
580 2510295318 2510065055 Bacteria 5037935
581 2510311056 2510065058 Bacteria 5005894
582 2688066733 2687453257 Bacteria 6784659
583 2774129151 2773857672 Bacteria 4993178
584 2917833278 2917832318 Bacteria 5346010
585 2919085466 2919085039 Bacteria 4532964
586 2919126182 2919125081 Bacteria 5385106
587 2974302405 2974298342 Bacteria 4840922
588 2984500042 2984499530 Bacteria 5020881
589 2984506580 2984504281 Bacteria 5262371
590 8016731400 8016728285 Bacteria 5263933
591 Ga0373942_0002748
592 MRS1b_contig_4046139
593 CNAas_1000687
594 LJNas_1000973
595 JGI25156J39149_1000222
596 JGI25156J39149_1000835
597 JGI25154J39366_1002986
598 JGI25157J39369_1000056
599 JGI25157J39369_1000100
600 rootH1_10002255
601 Ga0055539_1000400
602 Ga0055533_1000080
603 Ga0055525_1001850
604 Ga0055535_1000357
605 Ga0055529_1000433
606 Ga0055529_1000772
607 Ga0065714_10064425
608 Ga0065704_10084316
609 Ga0065712_10067727
610 Ga0065715_10000520
611 Ga0065715_10009366
612 Ga0065715_10122956
613 Ga0065707_10014475
614 Ga0070658_10008509
615 Ga0070658_10023738
616 Ga0070658_10055663
617 Ga0070658_10391693
618 Ga0070676_10306289
619 Ga0070683_100136737
620 Ga0070690_100013982
621 Ga0070670_100000190
622 Ga0070670_100107096
623 Ga0068869_100071495
624 Ga0068869_100143540
625 Ga0068869_100159889
626 Ga0068869_100184643
627 Ga0070666_10038327
628 Ga0070680_100097092
629 Ga0070680_100226177
630 Ga0070682_100028147
631 Ga0068868_100030083
632 Ga0068868_100405157
633 Ga0070660_100194307
634 Ga0070689_100011690
635 Ga0070687_100057980
636 Ga0070661_100011670
637 Ga0070661_100248856
638 Ga0070692_10038186
639 Ga0070692_10084609
640 Ga0070669_100025253
641 Ga0070669_100230629
642 Ga0070675_100098253
643 Ga0070675_100314201
644 Ga0070671_100058154
645 Ga0070673_100003539
646 Ga0070673_100168728
647 Ga0070659_100002688
648 Ga0070659_100040156
649 Ga0070667_100038272
650 Ga0070703_10055496
651 Ga0070709_10254185
652 Ga0070714_100178260
653 Ga0070713_100003514
654 Ga0070713_100065812
655 Ga0070701_10245812
656 Ga0070705_100160613
657 Ga0070700_100000047
658 Ga0070700_100009101
659 Ga0070700_100017991
660 Ga0070694_100031779
661 Ga0070694_100053848
662 Ga0070662_100305608
663 Ga0070681_10000991
664 Ga0070681_10011837
665 Ga0070681_10019055
666 Ga0070681_10062988
667 Ga0068867_100066515
668 Ga0070706_100000305
669 Ga0070707_100003309
670 Ga0070707_100030775
671 Ga0070698_100030109
672 Ga0070698_100055758
673 Ga0070698_100366511
674 Ga0070699_100000978
675 Ga0070699_100052966
676 Ga0070679_100015571
677 Ga0070679_100131172
678 Ga0070679_100159787
679 Ga0070684_100000038
680 Ga0070697_100171668
681 Ga0068853_100024960
682 Ga0070686_100159888
683 Ga0070695_100055708
684 Ga0070696_100115532
685 Ga0070696_100309414
686 Ga0070704_100063873
687 Ga0070704_100101781
688 Ga0070704_100339459
689 Ga0068855_100004750
690 Ga0068855_100043417
691 Ga0068855_100238384
692 Ga0070664_100002701
693 Ga0070664_100052266
694 Ga0070664_100056741
695 Ga0070664_100076952
696 Ga0070664_100531173
697 Ga0068857_100001183
698 Ga0068857_100003033
699 Ga0068857_100018023
700 Ga0068857_100028380
701 Ga0068857_100055661
702 Ga0068857_100234109
703 Ga0068857_100240734
704 Ga0068857_100394094
705 Ga0068854_100045828
706 Ga0068854_100260509
707 Ga0068856_100000247
708 Ga0068856_100000722
709 Ga0070702_100003608
710 Ga0070702_100224629
711 Ga0070702_100250324
712 Ga0068852_100031067
713 Ga0068852_100040345
714 Ga0068852_100072927
715 Ga0068852_100143422
716 Ga0068859_100006226
717 Ga0068859_100009958
718 Ga0068859_100019709
719 Ga0068859_100023383
720 Ga0068859_100028873
721 Ga0068859_100034560
722 Ga0068859_100060421
723 Ga0068859_100080936
724 Ga0068859_100090560
725 Ga0068859_100376924
726 Ga0068859_100528631
727 Ga0068864_100005438
728 Ga0068864_100060141
729 Ga0068864_100060926
730 Ga0068864_100216790
731 Ga0068864_100264708
732 Ga0068866_10130515
733 Ga0068861_100067771
734 Ga0068861_100139309
735 Ga0068861_100147422
736 Ga0068861_100372781
737 Ga0068851_10006676
738 Ga0068863_100041372
739 Ga0068863_100068757
740 Ga0068863_100092211
741 Ga0068863_100161928
742 Ga0068858_100048925
743 Ga0068858_100051777
744 Ga0068858_100103386
745 Ga0068858_100194295
746 Ga0068858_100285068
747 Ga0068860_100020977
748 Ga0068860_100046626
749 Ga0068860_100083605
750 Ga0068860_100087101
751 Ga0068860_100179005
752 Ga0068860_100335564
753 Ga0068862_100075016
754 Ga0068862_100131999
755 Ga0068862_100158387
756 Ga0081455_10083166
757 Ga0081539_10001529
758 Ga0081539_10005669
759 Ga0081539_10018864
760 Ga0081539_10083112
761 Ga0070717_10073137
762 Ga0070717_10097272
763 Ga0097621_100005230
764 Ga0097621_100010737
765 Ga0097621_100037611
766 Ga0097621_100047701
767 Ga0097621_100192884
768 Ga0068871_100019181
769 Ga0068871_100044637
770 Ga0068871_100070632
771 Ga0075428_100071806
772 Ga0075428_100497209
773 Ga0075431_100460325
774 Ga0075433_10088101
775 Ga0075433_10120465
776 Ga0075433_10178161
777 Ga0075434_100063142
778 Ga0075434_100196361
779 Ga0075434_100500056
780 Ga0075429_100058672
781 Ga0075429_100178375
782 Ga0068865_100023803
783 Ga0075436_100006391
784 Ga0075436_100050778
785 Ga0075436_100220045
786 Ga0097620_100006226
787 Ga0097620_100009957
788 Ga0097620_100019709
789 Ga0097620_100023383
790 Ga0097620_100028871
791 Ga0097620_100034558
792 Ga0097620_100060422
793 Ga0097620_100080935
794 Ga0097620_100090559
795 Ga0097620_100315517
796 Ga0097620_100376934
797 Ga0097620_100528607
798 Ga0075435_100305126
799 Ga0105251_10004327
800 Ga0105251_10042756
801 Ga0105251_10115148
802 Ga0105251_10117009
803 Ga0105244_10020684
804 Ga0105240_10037272
805 Ga0105240_10049969
806 Ga0105240_10122290
807 Ga0105240_10211213
808 Ga0111539_10024249
809 Ga0111539_10106009
810 Ga0111539_10139405
811 Ga0111539_10409110
812 Ga0105245_10136474
813 Ga0105247_10001923
814 Ga0114129_10013535
815 Ga0105243_10000144
816 Ga0105243_10002285
817 Ga0105243_10099965
818 Ga0105241_10021785
819 Ga0105241_10119423
820 Ga0105241_10138667
821 Ga0105241_10179691
822 Ga0105241_10246745
823 Ga0105242_10051934
824 Ga0105242_10122544
825 Ga0105242_10268931
826 Ga0105242_10326998
827 Ga0105248_10008342
828 Ga0105248_10026990
829 Ga0105248_10034742
830 Ga0105248_10038862
831 Ga0105248_10170110
832 Ga0105248_10207095
833 Ga0105248_10654933
834 Ga0105237_10000843
835 Ga0105237_10028407
836 Ga0105237_10231625
837 Ga0105238_10000370
838 Ga0105238_10006520
839 Ga0105238_10013280
840 Ga0105249_10000844
841 Ga0105249_10261993
842 Ga0105028_107051
843 Ga0105239_10040324
844 Ga0105239_10053571
845 Ga0105239_10124425
846 Ga0105239_10196306
847 Ga0105239_10401014
848 Ga0105246_10151469
849 Ga0105246_10167253
850 Ga0157373_10026181
851 Ga0157373_10071289
852 Ga0157373_10129172
853 Ga0157371_10015105
854 Ga0157370_10007038
855 Ga0157370_10055878
856 Ga0157370_10178711
857 Ga0157369_10000401
858 Ga0157369_10001968
859 Ga0157369_10016299
860 Ga0157369_10050147
861 Ga0157369_10113789
862 Ga0157369_10276000
863 Ga0157374_10008732
864 Ga0157374_10052985
865 Ga0157374_10105404
866 Ga0157378_10003679
867 Ga0157378_10020058
868 Ga0157378_10174563
869 Ga0157378_10194758
870 Ga0157378_10286708
871 Ga0163162_10004613
872 Ga0163162_10027304
873 Ga0163162_10043171
874 Ga0157372_10004845
875 Ga0157372_10010935
876 Ga0157372_10072929
877 Ga0157372_10090997
878 Ga0157372_10170897
879 Ga0157372_10215609
880 Ga0157372_10571390
881 Ga0157372_10880814
882 Ga0157375_10096948
883 Ga0157375_10113584
884 Ga0157375_10674334
885 Ga0163163_10000209
886 Ga0163163_10002342
887 Ga0163163_10004974
888 Ga0163163_10018160
889 Ga0163163_10048137
890 Ga0163163_10074278
891 Ga0163163_10094424
892 Ga0163163_10237341
893 Ga0157380_10023612
894 Ga0157380_10382101
895 Ga0157377_10000074
896 Ga0157377_10106824
897 Ga0157379_10046382
898 Ga0157376_10061364
899 Ga0157376_10069379
900 Ga0182005_1000004
901 Ga0163161_10012424
902 Ga0209674_100003
903 Ga0209563_100049
904 Ga0207427_101398
905 Ga0209258_100189
906 Ga0209646_1000124
907 Ga0209026_1000085
908 Ga0209677_100135
909 Ga0209677_100203
910 Ga0209677_103161
911 Ga0209759_1000068
912 Ga0209759_1000729
913 Ga0209759_1002917
914 Ga0209759_1010734
915 Ga0209455_1000092
916 Ga0209051_1004213
917 Ga0207697_10088546
918 Ga0207656_10003975
919 Ga0207713_1029389
920 Ga0207653_10000894
921 Ga0207642_10048586
922 Ga0207710_10001516
923 Ga0207680_10018308
924 Ga0207680_10085754
925 Ga0207647_10003108
926 Ga0207647_10098742
927 Ga0207645_10041276
928 Ga0207643_10010983
929 Ga0207643_10040090
930 Ga0207643_10135635
931 Ga0207705_10010139
932 Ga0207705_10043903
933 Ga0207684_10000053
934 Ga0207684_10031170
935 Ga0207654_10014038
936 Ga0207707_10000004
937 Ga0207707_10009356
938 Ga0207707_10114856
939 Ga0207695_10024272
940 Ga0207695_10111010
941 Ga0207695_10151287
942 Ga0207695_10194026
943 Ga0207671_10043459
944 Ga0207660_10002498
945 Ga0207660_10126680
946 Ga0207660_10126851
947 Ga0207662_10024050
948 Ga0207662_10151478
949 Ga0207657_10084610
950 Ga0207652_10000087
951 Ga0207652_10008111
952 Ga0207652_10127830
953 Ga0207652_10135206
954 Ga0207646_10069952
955 Ga0207646_10226594
956 Ga0207646_10352112
957 Ga0207694_10003790
958 Ga0207694_10025335
959 Ga0207694_10028730
960 Ga0207650_10000007
961 Ga0207650_10150340
962 Ga0207650_10271164
963 Ga0207659_10067416
964 Ga0207659_10137334
965 Ga0207659_10265038
966 Ga0207687_10075007
967 Ga0207700_10102017
968 Ga0207700_10108400
969 Ga0207700_10235088
970 Ga0207700_10434474
971 Ga0207664_10017642
972 Ga0207664_10189094
973 Ga0207644_10353218
974 Ga0207690_10045759
975 Ga0207690_10062705
976 Ga0207690_10090434
977 Ga0207690_10185748
978 Ga0207706_10010126
979 Ga0207706_10216847
980 Ga0207686_10234572
981 Ga0207686_10257850
982 Ga0207670_10001523
983 Ga0207670_10244760
984 Ga0207704_10296128
985 Ga0207691_10014923
986 Ga0207711_10028499
987 Ga0207711_10114592
988 Ga0207689_10014720
989 Ga0207689_10047043
990 Ga0207689_10048650
991 Ga0207689_10064957
992 Ga0207689_10132329
993 Ga0207689_10135406
994 Ga0207689_10179110
995 Ga0207689_10265932
996 Ga0207661_10093237
997 Ga0207667_10002685
998 Ga0207667_10074935
999 Ga0207667_10127757
1000 Ga0207667_10146617
1001 Ga0207651_10082845
1002 Ga0207651_10102670
1003 Ga0207651_10109126
1004 Ga0207651_10349593
1005 Ga0207712_10001401
1006 Ga0207712_10096231
1007 Ga0207640_10035617
1008 Ga0207640_10068539
1009 Ga0207677_10333314
1010 Ga0207703_10036835
1011 Ga0207703_10169093
1012 Ga0207703_10249169
1013 Ga0207639_10008033
1014 Ga0207639_10144576
1015 Ga0207639_10386214
1016 Ga0207678_10402809
1017 Ga0207708_10000113
1018 Ga0207708_10014216
1019 Ga0207708_10024164
1020 Ga0207708_10084634
1021 Ga0207708_10299722
1022 Ga0207702_10000235
1023 Ga0207702_10001127
1024 Ga0207702_10024438
1025 Ga0207702_10055061
1026 Ga0207641_10051511
1027 Ga0207641_10086461
1028 Ga0207641_10270818
1029 Ga0207641_10409312
1030 Ga0207648_10012132
1031 Ga0207648_10032894
1032 Ga0207648_10095808
1033 Ga0207676_10003576
1034 Ga0207676_10014396
1035 Ga0207676_10054349
1036 Ga0207674_10003076
1037 Ga0207674_10009239
1038 Ga0207674_10045026
1039 Ga0207674_10047263
1040 Ga0207674_10050907
1041 Ga0207674_10092481
1042 Ga0207674_10205464
1043 Ga0207674_10221059
1044 Ga0207674_10258053
1045 Ga0207674_10365984
1046 Ga0207675_100006726
1047 Ga0207675_100096602
1048 Ga0207683_10247172
1049 Ga0207698_10048609
1050 Ga0207698_10116362
1051 Ga0207698_10125428
1052 Ga0207698_10294575
1053 Ga0207428_10009063
1054 Ga0268266_10000140
1055 Ga0268265_10106379
1056 Ga0268265_10402435
1057 Ga0268265_10490876
1058 Ga0268264_10012975
1059 Ga0268264_10043066
1060 Ga0268264_10086297
1061 Ga0268264_10097643
1062 Ga0268264_10105531
1063 Ga0265336_10000006
1064 Ga0307515_10097879
1065 Ga0265324_10001517
1066 Ga0265339_10163154
1067 Ga0307513_10115348
1068 Ga0307516_10001445
1069 Ga0307405_10033920
1070 Ga0307410_10013753
1071 Ga0307410_10329450
1072 Ga0307406_10000949
1073 Ga0307414_10149131
1074 Ga0307507_10033999
1075 Ga0373939_0044473
1076 Ga0373931_0228514
1077 Ga0373935_0213960
1078 Ga0373933_0143295
1079 Ga0373937_0107331
1080 Ga0373937_0568774
1081 Ga0373925_0284996
1082 Ga0395898_0123374
1083 Ga0395905_0221084
1084 Ga0436364_0681300
1085 Ga0436364_1343081
1086 Ga0395901_0033779
1087 Ga0395901_0566583
1088 Ga0242420_000456
1089 Ga0436360_0258342
1090 Ga0451577_0087014
1091 Ga0451577_0270866
1092 Ga0466969_0002921
1093 Ga0466965_0003825
1094 Ga0466966_0008102
1095 Ga0466961_0037377
1096 Ga0466964_0004764
1097 Ga0466957_0020261
1098 Ga0466959_0002303
1099 Ga0451576_0016127
1100 Ga0451576_0150474
1101 Ga0451576_0458258
1102 Ga0495582_0217886
1103 Ga0495582_0341192
1104 Ga0495639_0011388
1105 Ga0495639_0050284
1106 Ga0495664_0083564
1107 Ga0495583_0000224
1108 Ga0495606_0001614
1109 Ga0495608_0017001
1110 Ga0495616_0007064
1111 Ga0495630_0000667
1112 Ga0495625_0031520
1113 Ga0495635_0040140
1114 Ga0495646_0188281
1115 Ga0495658_0094808
1116 Ga0495669_0007294
1117 Ga0495624_0004031
1118 Ga0495649_0002245
1119 Ga0495589_0027344
1120 Ga0495581_0033187
1121 Ga0495676_0188098
1122 Ga0495675_0302149
1123 Ga0495684_0006627
1124 Ga0495686_0024061
1125 Ga0496103_0134844
1126 Ga0496104_0102634
1127 Ga0496104_0200665
1128 Ga0496105_0145498
1129 Ga0496108_0161645
1130 Ga0496109_0541876
1131 Ga0496110_0246020
1132 Ga0496112_0056264
1133 Ga0496112_0060783
1134 Ga0496112_0366656
1135 Ga0496113_0195818
1136 Ga0501292_008074
1137 Ga0501298_008826
1138 Ga0501299_009095
1139 Ga0501070_0253588
1140 Ga0501072_0411049
1141 Ga0501227_014912
1142 Ga0501230_007695
1143 Ga0501233_014619
1144 Ga0501257_007104
1145 Ga0501221_018094
1146 Ga0501225_0000594
1147 Ga0501080_0031731
1148 Ga0501271_005834
1149 Ga0501273_000997
1150 Ga0501044_0001575
1151 nmdc:mga05p37_113313_c1
1152 nmdc:mga05p37_86867_c1
1153 nmdc:mga09592_118706_c1
1154 nmdc:mga09592_45617_c1
1155 nmdc:mga08y16_186121_c1
1156 nmdc:mga08y16_232319_c1
1157 nmdc:mga08y16_2741_c1
1158 nmdc:mga08y16_79491_c1
1159 nmdc:mga0rr50_32695_c1
1160 nmdc:mga0a205_5488_c1
1161 nmdc:mga0a205_82339_c1
1162 nmdc:mga0sz30_130319_c1
1163 Ga0495601_0000786
1164 Ga0500635_0000057
1165 Ga0495595_0035117
1166 Ga0495619_0002942
1167 Ga0501084_0207999
1168 Ga0500661_011670
1169 2510282664
1170 2510295318
1171 2510311056
1172 2688066733
1173 2774129151
1174 2917833278
1175 2919085466
1176 2919126182
1177 2974302405
1178 2984500042
1179 2984506580
1180 8016731400

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05544

Pro_racemase

Proline racemase

73

378

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j9x-assembly1.cif.gz_B crystal structure of the complex of a hydroxyproline epimerase (target efi-506499, pseudomonas fluorescens pf-5) with trans-4-hydroxy-l-proline 0.9879 2 307
4k7x-assembly1.cif.gz_A-2 crystal structure of a 4-hydroxyproline epimerase from burkholderia multivorans, target efi-506479, with bound phosphate, closed domains 0.9862 2 305
2azp-assembly1.cif.gz_A crystal structure of pa1268 solved by sulfur sad 0.9812 2 307
4j9x-assembly1.cif.gz_B crystal structure of the complex of a hydroxyproline epimerase (target efi-506499, pseudomonas fluorescens pf-5) with trans-4-hydroxy-l-proline 0.9751 2 307
2azp-assembly1.cif.gz_A crystal structure of pa1268 solved by sulfur sad 0.9749 2 307
ID Description Score Start End Superfamily
4jd7A01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9723 2 127 3.10.310.10
af_D3ZV91_5_159_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9374 1 119 3.10.310.10
af_Q868H8_133_298_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9334 128 270 3.10.310.10
4q60B02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9286 129 281 3.10.310.10
af_A0A0G2L1A2_13_139_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9197 1 116 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A2X4UMG3-F1-model_v4 4-hydroxyproline epimerase (EC 5.1.1.8) 0.9969 2 119 GO:0047580
AF-A0A4Q3N3F3-F1-model_v4 deleted 0.9933 24 206
AF-A0A351G0Y7-F1-model_v4 Hydroxyproline-2-epimerase 0.992 1 269 GO:0003824
AF-A0A429M5E5-F1-model_v4 Hydroxyproline-2-epimerase 0.9917 86 231 GO:0047580
AF-Q1QU06-F1-model_v4 4-hydroxyproline 2-epimerase (4Hyp 2-epimerase) (4HypE) (EC 5.1.1.8) 0.9916 2 307 GO:0047580

Map