F466987

General Info

Members Datasets Scaffolds Average Seq Length
590 342 567 295

Family's Representative Sequence

Representative Sequence 3300041413|Ga0439465_0001902|Ga0439465_0001902_21_1010
Length 329
Sequence MRPDRKITLSKLWLSRPAPTGYFDGRTEGRMTEDLIIQTIEPVTHDLGGFKVHRTLPSRPRTMVGPFIFFDQMGPAHLDVGTGIDVRPHPXINLATVTYLYAGAIDHRDSLGTFATIEPGAVNLMTAGNGIVHSERSPSAERARGPELSGIQTWLALPEADEEIDPAFEHVAAADLPVIEAGGATARVIMGSLWDAAAPTTTYAGTIYADIALAPGGSIPVDAEADERAVYVSMGEASLDGLRLEPMTLYVLRPGTAATLRSERGGRVMLCGGEAFKTPRHVWWNFVSSSRDRINQAKQDWQAGNFAKVPGDDKEWIPIPEVPKTVSYP

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
5 2643221569 Achromobacter sp. Root565 Isolate Unclassified
6 2643221594 Achromobacter sp. Root170 Isolate Unclassified
7 2643221621 Achromobacter sp. Root83 Isolate Unclassified
8 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
9 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
10 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
11 2818991436 Collimonas arenae 515 Isolate Unclassified
12 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
13 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
14 2855730933 Achromobacter sp. HZ28 Isolate Nodule
15 2855767633 Achromobacter sp. HZ34 Isolate Nodule
16 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
17 2858950400 Achromobacter sp. K91 Isolate Unclassified
18 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
19 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
20 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
21 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
22 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
23 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
24 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
25 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
26 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
27 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
28 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
29 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
30 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
33 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
34 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
35 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
36 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
37 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
38 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
39 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
40 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
45 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
49 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
55 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
56 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
57 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
58 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
59 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
127 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
192 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
218 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
219 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
220 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
221 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
224 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
225 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
226 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
227 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
228 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
231 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
238 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
239 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
240 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
241 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
242 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
245 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
248 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
251 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
252 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
253 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
256 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
257 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
258 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
261 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
262 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
265 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
266 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
270 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
271 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
283 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
284 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
285 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
286 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
294 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
295 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
299 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
300 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
301 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
302 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
303 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
304 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
305 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
306 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
307 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
310 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
311 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
312 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
313 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
316 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
319 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
320 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
321 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
322 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
323 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
324 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
325 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
326 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
327 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
328 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
329 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
330 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
331 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
332 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
333 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
334 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
335 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
336 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
337 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
338 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
339 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
340 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.42
Metatranscriptomes 0.68
Isolates 3.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.12
Nodule 0.51
Rhizoplane 2.54
Rhizosphere 70.34
Stem 0
Stem Tuber 0
Unclassified 9.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_299100 2162886011 Bacteria 3052
2 JGI24741J21665_1001690 3300001915 Bacteria 6110
3 JGI24740J21852_10004410 3300001979 Bacteria 6048
4 JGI24739J22299_10011758 3300001989 Bacteria 3225
5 JGI24737J22298_10004273 3300001990 Bacteria 4989
6 JGI24737J22298_10028180 3300001990 Bacteria 1767
7 JGI25162J39368_1000036 3300002737 Bacteria 180433
8 JGI25150J39212_1000081 3300002774 Bacteria 58313
9 JGI25165J46597_1000022 3300003214 Bacteria 357959
10 JGI25165J46597_1000138 3300003214 Bacteria 121773
11 JGI25153J46596_10000080 3300003215 Bacteria 113263
12 JGI25153J46596_10000112 3300003215 Bacteria 92578
13 JGI25153J46596_10048176 3300003215 Bacteria 1247
14 Ga0055538_1000011 3300003751 Bacteria 357959
15 Ga0055539_1000016 3300003752 Bacteria 358248
16 Ga0055533_1000019 3300003756 Bacteria 357959
17 Ga0055525_1000042 3300003759 Bacteria 279804
18 Ga0055525_1000070 3300003759 Bacteria 183047
19 Ga0055542_1000402 3300003762 Bacteria 42527
20 Ga0055529_1000439 3300003763 Bacteria 41829
21 Ga0055526_1001589 3300003771 Bacteria 15946
22 Ga0055537_1001707 3300003773 Bacteria 8124
23 Ga0055524_1000226 3300003775 Bacteria 59950
24 Ga0055530_10000049 3300003791 Bacteria 107051
25 Ga0055530_10000073 3300003791 Bacteria 85352
26 Ga0055530_10026435 3300003791 Bacteria 1604
27 Ga0055540_1000940 3300003792 Bacteria 18931
28 Ga0055531_10000017 3300003794 Bacteria 177036
29 Ga0055531_10007290 3300003794 Bacteria 6066
30 Ga0055541_1000017 3300003841 Bacteria 286811
31 Ga0055543_1027234 3300004625 Bacteria 1013
32 Ga0065165_1003945 3300005262 Bacteria 9759
33 Ga0065165_1006038 3300005262 Bacteria 6510
34 Ga0065165_1012591 3300005262 Bacteria 3431
35 Ga0065165_1023529 3300005262 Bacteria 2087
36 Ga0065704_10095203 3300005289 Bacteria 2499
37 Ga0065712_10071677 3300005290 Bacteria 5119
38 Ga0065712_10154066 3300005290 Bacteria 1348
39 Ga0065715_10130889 3300005293 Bacteria 2018
40 Ga0070658_10000209 3300005327 Bacteria 51813
41 Ga0070658_10003103 3300005327 Bacteria 13704
42 Ga0070676_10125271 3300005328 Bacteria 1618
43 Ga0070683_100322930 3300005329 Bacteria 1469
44 Ga0070670_100001575 3300005331 Bacteria 18384
45 Ga0070677_10001952 3300005333 Bacteria 6539
46 Ga0070680_100029357 3300005336 Bacteria 4417
47 Ga0068868_100000020 3300005338 Bacteria 92590
48 Ga0070660_100000381 3300005339 Bacteria 29499
49 Ga0070660_100000567 3300005339 Bacteria 24778
50 Ga0070660_100002485 3300005339 Bacteria 12648
51 Ga0070660_100005129 3300005339 Bacteria 9051
52 Ga0070660_100058373 3300005339 Bacteria 2991
53 Ga0070660_100131205 3300005339 Bacteria 2005
54 Ga0070660_100141087 3300005339 Bacteria 1933
55 Ga0070661_100000764 3300005344 Bacteria 23216
56 Ga0070661_100018324 3300005344 Bacteria 4977
57 Ga0070692_10020062 3300005345 Bacteria 3235
58 Ga0070668_100246265 3300005347 Bacteria 1482
59 Ga0070669_100053605 3300005353 Bacteria 2952
60 Ga0070669_100089304 3300005353 Bacteria 2308
61 Ga0070675_100002279 3300005354 Bacteria 14247
62 Ga0070675_100006097 3300005354 Bacteria 9244
63 Ga0070675_100075309 3300005354 Bacteria 2805
64 Ga0070675_100082466 3300005354 Bacteria 2683
65 Ga0070671_100009594 3300005355 Bacteria 7777
66 Ga0070671_100010401 3300005355 Bacteria 7463
67 Ga0070671_100066255 3300005355 Bacteria 3009
68 Ga0070671_100078861 3300005355 Bacteria 2752
69 Ga0070674_100004595 3300005356 Bacteria 7891
70 Ga0070674_100035505 3300005356 Bacteria 3339
71 Ga0070673_100007210 3300005364 Bacteria 7310
72 Ga0070673_100264447 3300005364 Bacteria 1504
73 Ga0070659_100000017 3300005366 Bacteria 163966
74 Ga0070659_100119248 3300005366 Bacteria 2135
75 Ga0070659_100286137 3300005366 Bacteria 1372
76 Ga0070667_100009793 3300005367 Bacteria 7947
77 Ga0070667_100085908 3300005367 Bacteria 2699
78 Ga0070667_100157929 3300005367 Bacteria 1996
79 Ga0070667_100359883 3300005367 Bacteria 1319
80 Ga0070711_100033863 3300005439 Bacteria 3404
81 Ga0070663_100015279 3300005455 Bacteria 4951
82 Ga0070681_10033653 3300005458 Bacteria 5145
83 Ga0070681_10067145 3300005458 Bacteria 3555
84 Ga0070685_10096336 3300005466 Bacteria 1800
85 Ga0070679_100000001 3300005530 Bacteria 764811
86 Ga0070679_100003301 3300005530 Bacteria 14768
87 Ga0070672_100120811 3300005543 Bacteria 2144
88 Ga0070686_100000056 3300005544 Bacteria 87537
89 Ga0070696_100122140 3300005546 Bacteria 1886
90 Ga0070665_100000021 3300005548 Bacteria 389668
91 Ga0070665_100000497 3300005548 Bacteria 56270
92 Ga0070665_100101657 3300005548 Bacteria 2879
93 Ga0070665_100185476 3300005548 Bacteria 2081
94 Ga0068855_100035561 3300005563 Bacteria 5933
95 Ga0068855_100147957 3300005563 Bacteria 2672
96 Ga0070664_100004202 3300005564 Bacteria 11571
97 Ga0070664_100063823 3300005564 Bacteria 3140
98 Ga0070664_100240533 3300005564 Bacteria 1625
99 Ga0068857_100009009 3300005577 Bacteria 8652
100 Ga0068854_100034554 3300005578 Bacteria 3533
101 Ga0068854_100366004 3300005578 Bacteria 1184
102 Ga0068852_100533106 3300005616 Bacteria 1173
103 Ga0068859_100015698 3300005617 Bacteria 7610
104 Ga0068864_100000870 3300005618 Bacteria 25428
105 Ga0068864_100134875 3300005618 Bacteria 2222
106 Ga0068861_100000271 3300005719 Bacteria 28950
107 Ga0068851_10010027 3300005834 Bacteria 4412
108 Ga0068863_100000186 3300005841 Bacteria 65963
109 Ga0068863_100025592 3300005841 Bacteria 5627
110 Ga0068858_100000022 3300005842 Bacteria 169718
111 Ga0068858_100000318 3300005842 Bacteria 51170
112 Ga0081540_1053900 3300005983 Bacteria 1969
113 Ga0081539_10026431 3300005985 Bacteria 3704
114 Ga0075366_10038523 3300006195 Bacteria 2823
115 Ga0068871_100007771 3300006358 Bacteria 7678
116 Ga0068871_100275909 3300006358 Bacteria 1469
117 Ga0075430_100256079 3300006846 Bacteria 1450
118 Ga0068865_100005493 3300006881 Bacteria 7691
119 Ga0068865_100099200 3300006881 Bacteria 2129
120 Ga0097620_100015698 3300006931 Bacteria 7610
121 Ga0105240_10796791 3300009093 Bacteria 1024
122 Ga0105245_10001471 3300009098 Bacteria 21285
123 Ga0105245_10076742 3300009098 Bacteria 3045
124 Ga0105243_10001935 3300009148 Bacteria 17641
125 Ga0105243_10134584 3300009148 Bacteria 2101
126 Ga0105241_10010947 3300009174 Bacteria 6653
127 Ga0105248_10003753 3300009177 Bacteria 16834
128 Ga0105248_10052245 3300009177 Bacteria 4586
129 Ga0105248_10067604 3300009177 Bacteria 4012
130 Ga0105248_10143362 3300009177 Bacteria 2696
131 Ga0105237_10014154 3300009545 Bacteria 8350
132 Ga0105237_10184536 3300009545 Bacteria 2086
133 Ga0105238_10009972 3300009551 Bacteria 9525
134 Ga0105249_10011955 3300009553 Bacteria 7636
135 Ga0105239_10015330 3300010375 Bacteria 8492
136 Ga0157373_10138777 3300013100 Bacteria 1709
137 Ga0157371_10000066 3300013102 Bacteria 168406
138 Ga0157370_10042974 3300013104 Bacteria 4352
139 Ga0157369_10005411 3300013105 Bacteria 14863
140 Ga0157374_10224964 3300013296 Bacteria 1842
141 Ga0163162_10001728 3300013306 Bacteria 20466
142 Ga0157372_10613801 3300013307 Bacteria 1268
143 Ga0163163_10230617 3300014325 Bacteria 1901
144 Ga0157379_10122315 3300014968 Bacteria 2342
145 Ga0157379_10128443 3300014968 Bacteria 2281
146 Ga0182006_1040282 3300015261 Bacteria 1839
147 Ga0182007_10009847 3300015262 Bacteria 3814
148 Ga0182005_1000741 3300015265 Bacteria 14944
149 Ga0206353_10341789 3300020082 Bacteria 7854
150 Ga0213873_10000023 3300021358 Bacteria 102573
151 Ga0213876_10000091 3300021384 Bacteria 102527
152 Ga0209784_100019 3300025224 Bacteria 453558
153 Ga0209566_100017 3300025225 Bacteria 453558
154 Ga0209674_100031 3300025226 Bacteria 453558
155 Ga0209563_100035 3300025230 Bacteria 453558
156 Ga0209563_100053 3300025230 Bacteria 332370
157 Ga0207427_100315 3300025231 Bacteria 32969
158 Ga0209437_100038 3300025233 Bacteria 453558
159 Ga0207425_1000019 3300025245 Bacteria 399942
160 Ga0207425_1015084 3300025245 Bacteria 1741
161 Ga0209026_1009440 3300025250 Bacteria 1916
162 Ga0209677_100020 3300025253 Bacteria 453558
163 Ga0209148_1000008 3300025254 Bacteria 1504371
164 Ga0209129_1000951 3300025258 Bacteria 17420
165 Ga0209233_1000049 3300025261 Bacteria 453558
166 Ga0209233_1000182 3300025261 Bacteria 137671
167 Ga0209565_1000007 3300025263 Bacteria 784361
168 Ga0209565_1000089 3300025263 Bacteria 150511
169 Ga0209565_1008886 3300025263 Bacteria 2598
170 Ga0209455_1000002 3300025272 Bacteria 1505459
171 Ga0209455_1007590 3300025272 Bacteria 3041
172 Ga0209673_1001068 3300025273 Bacteria 31210
173 Ga0209675_1006849 3300025291 Bacteria 4493
174 Ga0209676_1008871 3300025292 Bacteria 4421
175 Ga0209676_1013921 3300025292 Bacteria 3061
176 Ga0209025_1000268 3300025294 Bacteria 121656
177 Ga0209564_1001376 3300025295 Bacteria 25390
178 Ga0209758_1000019 3300025297 Bacteria 743682
179 Ga0209758_1000023 3300025297 Bacteria 612453
180 Ga0209050_1000001 3300025298 Bacteria 3563507
181 Ga0209050_1000102 3300025298 Bacteria 229971
182 Ga0209050_1001812 3300025298 Bacteria 20909
183 Ga0209256_1000008 3300025299 Bacteria 975723
184 Ga0209051_1000304 3300025303 Bacteria 77336
185 Ga0209257_1000112 3300025304 Bacteria 234058
186 Ga0209257_1002047 3300025304 Bacteria 21436
187 Ga0209257_1020279 3300025304 Bacteria 2464
188 Ga0207697_10070312 3300025315 Bacteria 1466
189 Ga0207656_10002461 3300025321 Bacteria 6248
190 Ga0207682_10000829 3300025893 Bacteria 14296
191 Ga0207682_10003840 3300025893 Bacteria 6450
192 Ga0207688_10026501 3300025901 Bacteria 3187
193 Ga0207688_10175415 3300025901 Bacteria 1276
194 Ga0207680_10122525 3300025903 Bacteria 1702
195 Ga0207647_10019765 3300025904 Bacteria 4525
196 Ga0207647_10199358 3300025904 Bacteria 1158
197 Ga0207645_10099315 3300025907 Bacteria 1877
198 Ga0207705_10000005 3300025909 Bacteria 673478
199 Ga0207705_10000618 3300025909 Bacteria 29682
200 Ga0207705_10025963 3300025909 Bacteria 4180
201 Ga0207705_10038288 3300025909 Bacteria 3433
202 Ga0207654_10008597 3300025911 Bacteria 5171
203 Ga0207707_10051512 3300025912 Bacteria 3585
204 Ga0207695_10013348 3300025913 Bacteria 9804
205 Ga0207671_10006249 3300025914 Bacteria 10674
206 Ga0207663_10021822 3300025916 Bacteria 3651
207 Ga0207660_10004252 3300025917 Bacteria 9334
208 Ga0207660_10042947 3300025917 Bacteria 3175
209 Ga0207657_10000800 3300025919 Bacteria 33315
210 Ga0207657_10001546 3300025919 Bacteria 24651
211 Ga0207657_10002530 3300025919 Bacteria 19780
212 Ga0207657_10010024 3300025919 Bacteria 9479
213 Ga0207657_10011474 3300025919 Bacteria 8796
214 Ga0207657_10062430 3300025919 Bacteria 3190
215 Ga0207649_10000027 3300025920 Bacteria 161926
216 Ga0207649_10000471 3300025920 Bacteria 28765
217 Ga0207652_10000003 3300025921 Bacteria 502441
218 Ga0207652_10424916 3300025921 Bacteria 1198
219 Ga0207681_10006740 3300025923 Bacteria 7048
220 Ga0207681_10043833 3300025923 Bacteria 2996
221 Ga0207694_10011586 3300025924 Bacteria 6653
222 Ga0207694_10355888 3300025924 Bacteria 1212
223 Ga0207650_10037118 3300025925 Bacteria 3549
224 Ga0207659_10002718 3300025926 Bacteria 10545
225 Ga0207659_10086574 3300025926 Bacteria 2330
226 Ga0207687_10034874 3300025927 Bacteria 3420
227 Ga0207644_10000032 3300025931 Bacteria 133759
228 Ga0207644_10014887 3300025931 Bacteria 5214
229 Ga0207644_10023982 3300025931 Bacteria 4184
230 Ga0207644_10146352 3300025931 Bacteria 1824
231 Ga0207690_10000035 3300025932 Bacteria 149201
232 Ga0207690_10000868 3300025932 Bacteria 19312
233 Ga0207690_10035119 3300025932 Bacteria 3235
234 Ga0207690_10110891 3300025932 Bacteria 1976
235 Ga0207706_10007371 3300025933 Bacteria 10166
236 Ga0207706_10033408 3300025933 Bacteria 4580
237 Ga0207706_10072327 3300025933 Bacteria 3033
238 Ga0207709_10000047 3300025935 Bacteria 238649
239 Ga0207709_10140645 3300025935 Bacteria 1658
240 Ga0207669_10000038 3300025937 Bacteria 74003
241 Ga0207669_10062519 3300025937 Bacteria 2293
242 Ga0207704_10070010 3300025938 Bacteria 2219
243 Ga0207691_10006900 3300025940 Bacteria 10952
244 Ga0207691_10182738 3300025940 Bacteria 1832
245 Ga0207711_10007985 3300025941 Bacteria 8853
246 Ga0207711_10029889 3300025941 Bacteria 4596
247 Ga0207679_10023810 3300025945 Bacteria 4192
248 Ga0207679_10203901 3300025945 Bacteria 1654
249 Ga0207667_10000001 3300025949 Bacteria 1178522
250 Ga0207651_10021974 3300025960 Bacteria 3890
251 Ga0207651_10461627 3300025960 Bacteria 1091
252 Ga0207712_10024593 3300025961 Bacteria 3991
253 Ga0207668_10000034 3300025972 Bacteria 119274
254 Ga0207668_10152673 3300025972 Bacteria 1790
255 Ga0207640_10015362 3300025981 Bacteria 4430
256 Ga0207640_10025108 3300025981 Bacteria 3603
257 Ga0207640_10484559 3300025981 Bacteria 1027
258 Ga0207677_10000071 3300026023 Bacteria 84386
259 Ga0207677_10510683 3300026023 Bacteria 1041
260 Ga0207703_10000048 3300026035 Bacteria 151143
261 Ga0207639_10025577 3300026041 Bacteria 4280
262 Ga0207639_10101014 3300026041 Bacteria 2331
263 Ga0207678_10009241 3300026067 Bacteria 8675
264 Ga0207678_10103986 3300026067 Bacteria 2423
265 Ga0207702_10004316 3300026078 Bacteria 12679
266 Ga0207641_10000031 3300026088 Bacteria 224320
267 Ga0207641_10004526 3300026088 Bacteria 12021
268 Ga0207648_10067850 3300026089 Bacteria 3109
269 Ga0207676_10000270 3300026095 Bacteria 44974
270 Ga0207676_10081571 3300026095 Bacteria 2628
271 Ga0207676_10149427 3300026095 Bacteria 2010
272 Ga0207676_10305615 3300026095 Bacteria 1454
273 Ga0207674_10053276 3300026116 Bacteria 4124
274 Ga0207674_10054927 3300026116 Bacteria 4052
275 Ga0207674_10109871 3300026116 Bacteria 2733
276 Ga0207675_100000038 3300026118 Bacteria 93037
277 Ga0207683_10000100 3300026121 Bacteria 71364
278 Ga0207698_10097414 3300026142 Bacteria 2427
279 Ga0207698_10616177 3300026142 Bacteria 1072
280 Ga0209281_1011408 3300027111 Bacteria 1992
281 Ga0209974_10010519 3300027876 Bacteria 3122
282 Ga0268266_10000015 3300028379 Bacteria 630629
283 Ga0268266_10000294 3300028379 Bacteria 81573
284 Ga0268266_10007596 3300028379 Bacteria 9763
285 Ga0268266_10013743 3300028379 Bacteria 6972
286 Ga0268264_10020145 3300028381 Bacteria 5450
287 Ga0307517_10009422 3300028786 Bacteria 13832
288 Ga0307517_10138967 3300028786 Bacteria 1714
289 Ga0307513_10057007 3300031456 Bacteria 4166
290 Ga0307513_10106571 3300031456 Bacteria 2808
291 Ga0307509_10379440 3300031507 Bacteria 1127
292 Ga0307408_100114422 3300031548 Bacteria 2078
293 Ga0307408_100192243 3300031548 Bacteria 1645
294 Ga0307408_100200798 3300031548 Bacteria 1614
295 Ga0307408_100214980 3300031548 Bacteria 1565
296 Ga0307508_10000550 3300031616 Bacteria 44447
297 Ga0307405_10016845 3300031731 Bacteria 3995
298 Ga0307405_10183562 3300031731 Bacteria 1504
299 Ga0307405_10233130 3300031731 Bacteria 1358
300 Ga0307413_10028544 3300031824 Bacteria 3109
301 Ga0307413_10119061 3300031824 Bacteria 1784
302 Ga0307413_10238472 3300031824 Bacteria 1341
303 Ga0307413_10244290 3300031824 Bacteria 1327
304 Ga0307413_10245410 3300031824 Bacteria 1325
305 Ga0307410_10000178 3300031852 Bacteria 23344
306 Ga0307410_10013007 3300031852 Bacteria 4837
307 Ga0307410_10013226 3300031852 Bacteria 4805
308 Ga0307410_10117314 3300031852 Bacteria 1935
309 Ga0307410_10155448 3300031852 Bacteria 1708
310 Ga0307410_10228140 3300031852 Bacteria 1436
311 Ga0307410_10230356 3300031852 Bacteria 1430
312 Ga0307410_10315201 3300031852 Bacteria 1239
313 Ga0307406_10091615 3300031901 Bacteria 2048
314 Ga0307406_10395872 3300031901 Bacteria 1093
315 Ga0307407_10007202 3300031903 Bacteria 5021
316 Ga0307407_10010715 3300031903 Bacteria 4333
317 Ga0307407_10018363 3300031903 Bacteria 3536
318 Ga0307407_10041543 3300031903 Bacteria 2572
319 Ga0307412_10000748 3300031911 Bacteria 18824
320 Ga0307412_10001148 3300031911 Bacteria 15196
321 Ga0307412_10008404 3300031911 Bacteria 5890
322 Ga0307412_10061202 3300031911 Bacteria 2530
323 Ga0307412_10072047 3300031911 Bacteria 2360
324 Ga0307409_100000947 3300031995 Bacteria 13532
325 Ga0307409_100002166 3300031995 Bacteria 10126
326 Ga0307409_100022765 3300031995 Bacteria 4325
327 Ga0307409_100027349 3300031995 Bacteria 4040
328 Ga0307409_100106575 3300031995 Bacteria 2339
329 Ga0307409_100185748 3300031995 Bacteria 1845
330 Ga0307409_100428986 3300031995 Bacteria 1270
331 Ga0307409_100437037 3300031995 Bacteria 1259
332 Ga0307409_100563254 3300031995 Bacteria 1120
333 Ga0307416_100008752 3300032002 Bacteria 6559
334 Ga0307416_100017891 3300032002 Bacteria 4976
335 Ga0307416_100024444 3300032002 Bacteria 4410
336 Ga0307416_100039405 3300032002 Bacteria 3658
337 Ga0307416_100053637 3300032002 Bacteria 3236
338 Ga0307416_100130377 3300032002 Bacteria 2262
339 Ga0307416_100242577 3300032002 Bacteria 1747
340 Ga0307416_100276642 3300032002 Bacteria 1652
341 Ga0307416_100765232 3300032002 Bacteria 1059
342 Ga0307414_10032682 3300032004 Bacteria 3429
343 Ga0307414_10152630 3300032004 Bacteria 1824
344 Ga0307414_10254903 3300032004 Bacteria 1460
345 Ga0307414_10284496 3300032004 Bacteria 1391
346 Ga0307414_10468601 3300032004 Bacteria 1108
347 Ga0307411_10001198 3300032005 Bacteria 10265
348 Ga0307411_10019714 3300032005 Bacteria 3903
349 Ga0307411_10032907 3300032005 Bacteria 3209
350 Ga0307411_10044462 3300032005 Bacteria 2849
351 Ga0307411_10051868 3300032005 Bacteria 2679
352 Ga0307411_10125970 3300032005 Bacteria 1863
353 Ga0307411_10127002 3300032005 Bacteria 1856
354 Ga0307411_10251359 3300032005 Bacteria 1390
355 Ga0307415_100010658 3300032126 Bacteria 5216
356 Ga0307415_100127655 3300032126 Bacteria 1919
357 Ga0307415_100248318 3300032126 Bacteria 1444
358 Ga0307510_10002463 3300033180 Bacteria 21035
359 Ga0395900_0074842 3300037418 Bacteria 3481
360 Ga0395898_0227941 3300037466 Bacteria 1777
361 Ga0395901_0078048 3300038443 Bacteria 3457
362 Ga0395901_0140808 3300038443 Bacteria 2535
363 Ga0395901_0223175 3300038443 Bacteria 1969
364 Ga0237819_01122 3300038705 Bacteria 7796
365 Ga0436365_0598248 3300039437 Bacteria 40283
366 Ga0436365_1020809 3300039437 Bacteria 10139
367 Ga0436365_1404021 3300039437 Bacteria 6837
368 Ga0436362_0265247 3300039453 Bacteria 102026
369 Ga0439461_0000038 3300041410 Bacteria 16271
370 Ga0439466_0047431 3300041411 Bacteria 1416
371 Ga0439465_0001902 3300041413 Bacteria 6836
372 Ga0439465_0020138 3300041413 Bacteria 2087
373 Ga0451807_0677377 3300041486 Bacteria 2187
374 Ga0451853_0802417 3300041512 Bacteria 1910
375 Ga0439431_0000211 3300041997 Bacteria 11608
376 Ga0439431_0048756 3300041997 Bacteria 1094
377 Ga0439442_000860 3300042002 Bacteria 6251
378 Ga0439445_0000068 3300042004 Bacteria 15640
379 Ga0439445_0002914 3300042004 Bacteria 3821
380 Ga0439432_000877 3300042006 Bacteria 11269
381 Ga0439432_051651 3300042006 Bacteria 1281
382 Ga0450920_013992 3300042122 Bacteria 1514
383 Ga0439434_0002135 3300042435 Bacteria 5723
384 Ga0466957_0416805 3300044842 Bacteria 921
385 Ga0495617_049090 3300046452 Bacteria 1405
386 Ga0495627_012247 3300046453 Bacteria 3051
387 Ga0495592_0001831 3300046454 Bacteria 14948
388 Ga0495638_0000012 3300046460 Bacteria 435577
389 Ga0495638_0002975 3300046460 Bacteria 13525
390 Ga0495651_0004314 3300046462 Bacteria 10896
391 Ga0495651_0049989 3300046462 Bacteria 3226
392 Ga0495653_0002503 3300046463 Bacteria 14634
393 Ga0495650_0000290 3300046471 Bacteria 93004
394 Ga0495585_0002773 3300046492 Bacteria 12212
395 Ga0495585_0020405 3300046492 Bacteria 3812
396 Ga0495585_0126023 3300046492 Bacteria 1351
397 Ga0495607_0016870 3300046501 Bacteria 4702
398 Ga0495583_0000411 3300046506 Bacteria 65040
399 Ga0495583_0001065 3300046506 Bacteria 30658
400 Ga0495583_0003000 3300046506 Bacteria 13518
401 Ga0495583_0013953 3300046506 Bacteria 4452
402 Ga0495606_0000383 3300046507 Bacteria 75070
403 Ga0495608_0001267 3300046511 Bacteria 17938
404 Ga0495618_0052065 3300046514 Bacteria 2587
405 Ga0495628_0001337 3300046516 Bacteria 22626
406 Ga0495631_0029181 3300046518 Bacteria 2512
407 Ga0495631_0031426 3300046518 Bacteria 2402
408 Ga0495632_0000832 3300046519 Bacteria 27194
409 Ga0495643_0000556 3300046522 Bacteria 46207
410 Ga0495643_0006292 3300046522 Bacteria 7853
411 Ga0495643_0031650 3300046522 Bacteria 2943
412 Ga0495643_0050076 3300046522 Bacteria 2250
413 Ga0495644_0044850 3300046523 Bacteria 1663
414 Ga0495648_0000038 3300046524 Bacteria 191612
415 Ga0495648_0000901 3300046524 Bacteria 31037
416 Ga0495648_0013015 3300046524 Bacteria 6174
417 Ga0495652_0031929 3300046529 Bacteria 4609
418 Ga0495652_0112562 3300046529 Bacteria 2186
419 Ga0495652_0147328 3300046529 Bacteria 1843
420 Ga0495654_0078414 3300046530 Bacteria 1553
421 Ga0495598_0001525 3300046537 Bacteria 4625
422 Ga0495621_0002891 3300046539 Bacteria 4678
423 Ga0495597_0026834 3300046542 Bacteria 2645
424 Ga0495645_0288700 3300046543 Bacteria 1076
425 Ga0495622_0005748 3300046557 Bacteria 5751
426 Ga0495622_0129464 3300046557 Bacteria 1150
427 Ga0495633_0002232 3300046558 Bacteria 13853
428 Ga0495633_0013935 3300046558 Bacteria 4215
429 Ga0495633_0015028 3300046558 Bacteria 4024
430 Ga0495633_0016871 3300046558 Bacteria 3749
431 Ga0495668_0000218 3300046616 Bacteria 83540
432 Ga0495611_0005427 3300046648 Bacteria 5451
433 Ga0495611_0035355 3300046648 Bacteria 2213
434 Ga0495625_0000496 3300046660 Bacteria 58853
435 Ga0495625_0001098 3300046660 Bacteria 35115
436 Ga0495625_0028736 3300046660 Bacteria 4166
437 Ga0495625_0040485 3300046660 Bacteria 3398
438 Ga0495625_0061599 3300046660 Bacteria 2655
439 Ga0495661_0116386 3300046665 Bacteria 1483
440 Ga0495599_0002386 3300046678 Bacteria 10924
441 Ga0495646_0004343 3300046680 Bacteria 8932
442 Ga0495646_0010710 3300046680 Bacteria 5826
443 Ga0495669_0000241 3300046684 Bacteria 32038
444 Ga0495669_0002156 3300046684 Bacteria 8083
445 Ga0495669_0011004 3300046684 Bacteria 3831
446 Ga0495669_0015695 3300046684 Bacteria 3243
447 Ga0495670_0000104 3300046691 Bacteria 37290
448 Ga0495670_0027119 3300046691 Bacteria 2836
449 Ga0495670_0054457 3300046691 Bacteria 2004
450 Ga0495670_0056147 3300046691 Bacteria 1975
451 Ga0495671_0000034 3300046692 Bacteria 195385
452 Ga0495649_0035817 3300046694 Bacteria 2729
453 Ga0495600_0015093 3300046809 Bacteria 4879
454 Ga0495683_0002703 3300047323 Bacteria 10584
455 Ga0495687_000082 3300047443 Bacteria 147137
456 Ga0495687_000472 3300047443 Bacteria 48797
457 Ga0495673_0000013 3300047469 Bacteria 612902
458 Ga0495673_0050588 3300047469 Bacteria 1823
459 Ga0495681_0002528 3300047470 Bacteria 13027
460 Ga0495681_0039186 3300047470 Bacteria 2316
461 Ga0495686_0000602 3300047472 Bacteria 50008
462 Ga0495686_0099947 3300047472 Bacteria 1750
463 Ga0495602_0063131 3300048088 Bacteria 3210
464 Ga0496102_0000930 3300048905 Bacteria 27582
465 Ga0496103_0001181 3300048906 Bacteria 17921
466 Ga0496104_0003538 3300048907 Bacteria 13471
467 Ga0496105_0001238 3300048908 Bacteria 17814
468 Ga0496110_0005603 3300048913 Bacteria 9856
469 Ga0496110_0016383 3300048913 Bacteria 6189
470 Ga0496111_0001589 3300048914 Bacteria 13126
471 Ga0496111_0025686 3300048914 Bacteria 4156
472 Ga0496113_0552921 3300048916 Bacteria 923
473 Ga0496115_0000339 3300048918 Bacteria 39809
474 Ga0496115_0009842 3300048918 Bacteria 7117
475 Ga0496116_0006574 3300048919 Bacteria 10525
476 Ga0496116_0015362 3300048919 Bacteria 6054
477 Ga0496116_0158836 3300048919 Bacteria 1243
478 Ga0496117_0003623 3300048920 Bacteria 17798
479 Ga0496118_0002640 3300048921 Bacteria 23762
480 Ga0496118_0049413 3300048921 Bacteria 3239
481 Ga0496118_0071311 3300048921 Bacteria 2502
482 Ga0496119_0116690 3300048922 Bacteria 1473
483 Ga0496120_0014422 3300048923 Bacteria 5267
484 Ga0496120_0018434 3300048923 Bacteria 4500
485 Ga0496121_0000128 3300048924 Bacteria 168457
486 Ga0496121_0000200 3300048924 Bacteria 131314
487 Ga0496121_0004809 3300048924 Bacteria 17800
488 Ga0496122_0000021 3300048925 Bacteria 391363
489 Ga0496122_0182792 3300048925 Bacteria 1248
490 Ga0496123_0000382 3300048926 Bacteria 83286
491 Ga0496123_0008086 3300048926 Bacteria 9727
492 Ga0496123_0008374 3300048926 Bacteria 9506
493 Ga0496123_0057905 3300048926 Bacteria 2518
494 Ga0496123_0086142 3300048926 Bacteria 1886
495 Ga0496124_0000761 3300048927 Bacteria 52586
496 Ga0496124_0001474 3300048927 Bacteria 34588
497 Ga0496124_0003074 3300048927 Bacteria 20784
498 Ga0496124_0040880 3300048927 Bacteria 4006
499 Ga0496124_0082792 3300048927 Bacteria 2633
500 Ga0496125_0000005 3300048928 Bacteria 827598
501 Ga0496125_0004606 3300048928 Bacteria 15755
502 Ga0496125_0015489 3300048928 Bacteria 7369
503 Ga0496126_0000467 3300048929 Bacteria 80295
504 Ga0501290_000033 3300049513 Bacteria 18347
505 Ga0501292_000026 3300049515 Bacteria 42153
506 Ga0501294_001219 3300049517 Bacteria 2658
507 Ga0501034_0143067 3300049571 Bacteria 2370
508 Ga0501038_0050628 3300049574 Bacteria 3588
509 Ga0501206_002038 3300049653 Bacteria 2549
510 Ga0501222_000164 3300049662 Bacteria 13081
511 Ga0501223_000934 3300049663 Bacteria 6908
512 Ga0501227_021106 3300049665 Bacteria 1499
513 Ga0501227_059446 3300049665 Bacteria 977
514 Ga0501233_024172 3300049668 Bacteria 1327
515 Ga0501257_000093 3300049686 Bacteria 21754
516 Ga0501257_022339 3300049686 Bacteria 1497
517 Ga0501261_000055 3300049690 Bacteria 21300
518 Ga0501221_004751 3300049704 Bacteria 2255
519 Ga0501225_0001875 3300049705 Bacteria 6601
520 Ga0501245_000201 3300049708 Bacteria 6667
521 Ga0501080_0108079 3300049742 Bacteria 2578
522 Ga0501279_000066 3300049775 Bacteria 18226
523 Ga0501280_000428 3300049776 Bacteria 10089
524 Ga0501281_00046 3300049777 Bacteria 14598
525 Ga0501282_001783 3300049778 Bacteria 2367
526 Ga0501283_004254 3300049779 Bacteria 1928
527 Ga0501044_0540519 3300049823 Bacteria 1063
528 nmdc:mga0k408_46010_c1 3300050493 Bacteria 2519
529 nmdc:mga07m45_247207_c1 3300050496 Bacteria 1038
530 nmdc:mga0qj67_77037_c1 3300050509 Bacteria 2668
531 Ga0500610_0001098 3300053079 Bacteria 8897
532 Ga0500643_000292 3300053087 Bacteria 43095
533 Ga0500643_001429 3300053087 Bacteria 13765
534 Ga0500643_009896 3300053087 Bacteria 3600
535 Ga0500643_014938 3300053087 Bacteria 2678
536 Ga0500646_0041121 3300053090 Bacteria 1302
537 Ga0500566_0003208 3300053094 Bacteria 9779
538 Ga0500556_0033203 3300053104 Bacteria 1769
539 Ga0500595_001136 3300053119 Bacteria 14745
540 Ga0500595_002209 3300053119 Bacteria 9883
541 Ga0500607_000007 3300053121 Bacteria 134097
542 Ga0500658_0002518 3300053134 Bacteria 7098
543 Ga0500658_0006669 3300053134 Bacteria 4278
544 Ga0500658_0010916 3300053134 Bacteria 3351
545 Ga0500559_0000693 3300053136 Bacteria 22159
546 Ga0500559_0001181 3300053136 Bacteria 15619
547 Ga0500559_0004787 3300053136 Bacteria 6339
548 Ga0500559_0134924 3300053136 Bacteria 1154
549 Ga0500568_0002185 3300053139 Bacteria 11770
550 Ga0500573_0000030 3300053140 Bacteria 135037
551 Ga0500590_130387 3300053148 Bacteria 1164
552 Ga0500604_0000001 3300053151 Bacteria 174619
553 Ga0500604_0031722 3300053151 Bacteria 1553
554 Ga0500616_0000070 3300053153 Bacteria 232610
555 Ga0500616_0008535 3300053153 Bacteria 6352
556 Ga0500619_022571 3300053154 Bacteria 1828
557 Ga0500622_0000145 3300053156 Bacteria 75417
558 Ga0500636_0002811 3300053177 Bacteria 9719
559 Ga0500637_0005234 3300053178 Bacteria 6263
560 Ga0500645_000237 3300053730 Bacteria 41544
561 Ga0500645_002010 3300053730 Bacteria 9526
562 Ga0500596_000903 3300053735 Bacteria 5929
563 Ga0500587_001316 3300053739 Bacteria 3486
564 Ga0500661_008186 3300055283 Bacteria 1923
565 Ga0587090_004550 3300059510 Bacteria 1688
566 Ga0587094_004794 3300059513 Bacteria 1554
567 Ga0587071_012130 3300060344 Bacteria 1466

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0061599 Ga0495625_0061599_1895_2632 212
2 3300050496 nmdc:mga07m45_247207_c1 nmdc:mga07m45_247207_c1_286_1023 215
3 3300048921 Ga0496118_0071311 Ga0496118_0071311_20_781 251
4 3300005289 Ga0065704_10095203 Ga0065704_100952031 257
5 3300005347 Ga0070668_100246265 Ga0070668_1002462652 257
6 3300025972 Ga0207668_10152673 Ga0207668_101526731 257
7 3300015261 Ga0182006_1040282 Ga0182006_10402821 258
8 3300053156 Ga0500622_0000145 Ga0500622_0000145_18799_19686 261
9 3300046530 Ga0495654_0078414 Ga0495654_0078414_518_1411 263
10 3300053087 Ga0500643_009896 Ga0500643_009896_2534_3427 263
11 3300002737 JGI25162J39368_1000036 JGI25162J39368_1000036131 265
12 3300003214 JGI25165J46597_1000022 JGI25165J46597_1000022228 265
13 3300003751 Ga0055538_1000011 Ga0055538_1000011129 265
14 3300003752 Ga0055539_1000016 Ga0055539_1000016228 265
15 3300003756 Ga0055533_1000019 Ga0055533_1000019228 265
16 3300003759 Ga0055525_1000042 Ga0055525_1000042131 265
17 3300003841 Ga0055541_1000017 Ga0055541_1000017163 265
18 3300025224 Ga0209784_100019 Ga0209784_100019306 265
19 3300025225 Ga0209566_100017 Ga0209566_100017306 265
20 3300025226 Ga0209674_100031 Ga0209674_100031306 265
21 3300025230 Ga0209563_100035 Ga0209563_100035306 265
22 3300025231 Ga0207427_100315 Ga0207427_10031526 265
23 3300025233 Ga0209437_100038 Ga0209437_100038306 265
24 3300025253 Ga0209677_100020 Ga0209677_100020306 265
25 3300025261 Ga0209233_1000049 Ga0209233_1000049306 265
26 3300005546 Ga0070696_100122140 Ga0070696_1001221402 266
27 3300031548 Ga0307408_100114422 Ga0307408_1001144222 267
28 3300031731 Ga0307405_10183562 Ga0307405_101835622 267
29 3300031824 Ga0307413_10028544 Ga0307413_100285444 267
30 3300031824 Ga0307413_10244290 Ga0307413_102442902 267
31 3300031852 Ga0307410_10013226 Ga0307410_100132262 267
32 3300031901 Ga0307406_10091615 Ga0307406_100916151 267
33 3300031903 Ga0307407_10010715 Ga0307407_100107154 267
34 3300031911 Ga0307412_10008404 Ga0307412_100084042 267
35 3300031995 Ga0307409_100563254 Ga0307409_1005632541 267
36 3300032004 Ga0307414_10468601 Ga0307414_104686011 267
37 3300032005 Ga0307411_10032907 Ga0307411_100329074 267
38 3300032126 Ga0307415_100127655 Ga0307415_1001276552 267
39 3300044842 Ga0466957_0416805 Ga0466957_0416805_74_877 267
40 3300046518 Ga0495631_0029181 Ga0495631_0029181_47_850 267
41 3300048926 Ga0496123_0008374 Ga0496123_0008374_8693_9496 267
42 3300049665 Ga0501227_021106 Ga0501227_021106_34_837 267
43 3300049665 Ga0501227_059446 Ga0501227_059446_152_955 267
44 3300049705 Ga0501225_0001875 Ga0501225_0001875_93_896 267
45 3300053134 Ga0500658_0002518 Ga0500658_0002518_6254_7057 267
46 3300015265 Ga0182005_1000741 Ga0182005_10007419 270
47 3300031824 Ga0307413_10119061 Ga0307413_101190611 275
48 3300032005 Ga0307411_10125970 Ga0307411_101259702 275
49 3300039437 Ga0436365_1020809 Ga0436365_1020809_414_1313 282
50 3300048916 Ga0496113_0552921 Ga0496113_0552921_48_899 283
51 3300032002 Ga0307416_100242577 Ga0307416_1002425772 285
52 3300053136 Ga0500559_0000693 Ga0500559_0000693_9157_10074 285
53 3300005327 Ga0070658_10003103 Ga0070658_1000310314 286
54 3300005339 Ga0070660_100005129 Ga0070660_1000051294 286
55 3300025919 Ga0207657_10002530 Ga0207657_1000253025 286
56 iso_pu_bacteria 2818991436 2819542504 286
57 3300005355 Ga0070671_100078861 Ga0070671_1000788611 287
58 3300005364 Ga0070673_100264447 Ga0070673_1002644471 287
59 3300005367 Ga0070667_100157929 Ga0070667_1001579293 287
60 3300005458 Ga0070681_10033653 Ga0070681_100336532 287
61 3300005530 Ga0070679_100003301 Ga0070679_1000033016 287
62 3300005563 Ga0068855_100035561 Ga0068855_1000355613 287
63 3300005983 Ga0081540_1053900 Ga0081540_10539003 287
64 3300006358 Ga0068871_100275909 Ga0068871_1002759092 287
65 3300006881 Ga0068865_100005493 Ga0068865_1000054933 287
66 3300009093 Ga0105240_10796791 Ga0105240_107967912 287
67 3300009545 Ga0105237_10184536 Ga0105237_101845362 287
68 3300010375 Ga0105239_10015330 Ga0105239_100153309 287
69 3300014325 Ga0163163_10230617 Ga0163163_102306173 287
70 3300014968 Ga0157379_10122315 Ga0157379_101223152 287
71 3300025903 Ga0207680_10122525 Ga0207680_101225251 287
72 3300025917 Ga0207660_10042947 Ga0207660_100429472 287
73 3300025921 Ga0207652_10424916 Ga0207652_104249162 287
74 3300025931 Ga0207644_10146352 Ga0207644_101463523 287
75 3300025945 Ga0207679_10023810 Ga0207679_100238102 287
76 3300025960 Ga0207651_10461627 Ga0207651_104616271 287
77 3300026095 Ga0207676_10149427 Ga0207676_101494271 287
78 3300005439 Ga0070711_100033863 Ga0070711_1000338633 288
79 3300005466 Ga0070685_10096336 Ga0070685_100963363 288
80 3300013296 Ga0157374_10224964 Ga0157374_102249642 288
81 3300013307 Ga0157372_10613801 Ga0157372_106138012 288
82 3300015262 Ga0182007_10009847 Ga0182007_100098473 288
83 3300025916 Ga0207663_10021822 Ga0207663_100218222 288
84 3300028379 Ga0268266_10013743 Ga0268266_100137435 288
85 3300031903 Ga0307407_10007202 Ga0307407_100072022 288
86 3300041512 Ga0451853_0802417 Ga0451853_0802417_837_1721 288
87 3300046454 Ga0495592_0001831 Ga0495592_0001831_14060_14932 288
88 3300046462 Ga0495651_0004314 Ga0495651_0004314_407_1291 288
89 3300046462 Ga0495651_0049989 Ga0495651_0049989_2133_3005 288
90 3300046463 Ga0495653_0002503 Ga0495653_0002503_8315_9187 288
91 3300046511 Ga0495608_0001267 Ga0495608_0001267_12065_12937 288
92 3300046514 Ga0495618_0052065 Ga0495618_0052065_550_1422 288
93 3300046516 Ga0495628_0001337 Ga0495628_0001337_20745_21617 288
94 3300046529 Ga0495652_0112562 Ga0495652_0112562_1035_1919 288
95 3300046529 Ga0495652_0147328 Ga0495652_0147328_188_1060 288
96 3300046543 Ga0495645_0288700 Ga0495645_0288700_37_921 288
97 3300046557 Ga0495622_0129464 Ga0495622_0129464_262_1137 288
98 3300046678 Ga0495599_0002386 Ga0495599_0002386_9827_10699 288
99 3300046680 Ga0495646_0004343 Ga0495646_0004343_504_1388 288
100 3300046680 Ga0495646_0010710 Ga0495646_0010710_1313_2185 288
101 3300046691 Ga0495670_0056147 Ga0495670_0056147_416_1315 288
102 3300048088 Ga0495602_0063131 Ga0495602_0063131_1926_2798 288
103 3300049574 Ga0501038_0050628 Ga0501038_0050628_1807_2685 288
104 3300049742 Ga0501080_0108079 Ga0501080_0108079_1278_2153 288
105 3300049823 Ga0501044_0540519 Ga0501044_0540519_124_999 288
106 3300053119 Ga0500595_002209 Ga0500595_002209_5463_6335 288
107 3300053154 Ga0500619_022571 Ga0500619_022571_337_1209 288
108 3300055283 Ga0500661_008186 Ga0500661_008186_255_1169 288
109 3300025901 Ga0207688_10026501 Ga0207688_100265014 289
110 3300003759 Ga0055525_1000070 Ga0055525_1000070188 290
111 3300003762 Ga0055542_1000402 Ga0055542_10004028 290
112 3300003763 Ga0055529_1000439 Ga0055529_10004398 290
113 3300003791 Ga0055530_10026435 Ga0055530_100264352 290
114 3300005328 Ga0070676_10125271 Ga0070676_101252712 290
115 3300005356 Ga0070674_100004595 Ga0070674_1000045956 290
116 3300006358 Ga0068871_100007771 Ga0068871_1000077717 290
117 3300006881 Ga0068865_100099200 Ga0068865_1000992002 290
118 3300009148 Ga0105243_10001935 Ga0105243_1000193514 290
119 3300025230 Ga0209563_100053 Ga0209563_1000538 290
120 3300025254 Ga0209148_1000008 Ga0209148_10000081387 290
121 3300025272 Ga0209455_1000002 Ga0209455_100000239 290
122 3300025292 Ga0209676_1013921 Ga0209676_10139212 290
123 3300025298 Ga0209050_1001812 Ga0209050_100181221 290
124 3300025907 Ga0207645_10099315 Ga0207645_100993153 290
125 3300025935 Ga0207709_10000047 Ga0207709_10000047232 290
126 3300025937 Ga0207669_10000038 Ga0207669_1000003885 290
127 3300025938 Ga0207704_10070010 Ga0207704_100700103 290
128 3300025960 Ga0207651_10021974 Ga0207651_100219744 290
129 3300026089 Ga0207648_10067850 Ga0207648_100678502 290
130 3300026121 Ga0207683_10000100 Ga0207683_1000010080 290
131 3300028786 Ga0307517_10138967 Ga0307517_101389673 290
132 3300031456 Ga0307513_10057007 Ga0307513_100570073 290
133 3300031911 Ga0307412_10000748 Ga0307412_100007483 290
134 3300046471 Ga0495650_0000290 Ga0495650_0000290_2235_3137 290
135 3300046557 Ga0495622_0005748 Ga0495622_0005748_4681_5583 290
136 3300046809 Ga0495600_0015093 Ga0495600_0015093_1439_2341 290
137 3300048919 Ga0496116_0015362 Ga0496116_0015362_4498_5403 290
138 3300048919 Ga0496116_0158836 Ga0496116_0158836_248_1153 290
139 3300048921 Ga0496118_0049413 Ga0496118_0049413_2048_2953 290
140 3300048922 Ga0496119_0116690 Ga0496119_0116690_260_1165 290
141 3300048923 Ga0496120_0014422 Ga0496120_0014422_853_1758 290
142 3300048924 Ga0496121_0000200 Ga0496121_0000200_26927_27832 290
143 3300048925 Ga0496122_0000021 Ga0496122_0000021_115915_116820 290
144 3300048926 Ga0496123_0000382 Ga0496123_0000382_62033_62938 290
145 3300048927 Ga0496124_0082792 Ga0496124_0082792_653_1558 290
146 3300048928 Ga0496125_0000005 Ga0496125_0000005_388310_389215 290
147 3300048928 Ga0496125_0015489 Ga0496125_0015489_6118_7023 290
148 3300053119 Ga0500595_001136 Ga0500595_001136_9154_10056 290
149 3300053735 Ga0500596_000903 Ga0500596_000903_2276_3178 290
150 iso_pu_bacteria 2599185292 2599902264 290
151 iso_pu_bacteria 2643221569 2643859654 290
152 iso_pu_bacteria 2643221594 2643978953 290
153 iso_pu_bacteria 2643221621 2644120398 290
154 iso_pu_bacteria 2808606395 2809036290 290
155 iso_pu_bacteria 2857537821 2857541367 290
156 iso_pu_bacteria 2858950400 2858951683 290
157 iso_pu_bacteria 2941479691 2941483168 290
158 3300003215 JGI25153J46596_10048176 JGI25153J46596_100481761 291
159 3300003773 Ga0055537_1001707 Ga0055537_10017078 291
160 3300003775 Ga0055524_1000226 Ga0055524_100022626 291
161 3300003794 Ga0055531_10007290 Ga0055531_100072903 291
162 3300005262 Ga0065165_1012591 Ga0065165_10125912 291
163 3300005564 Ga0070664_100240533 Ga0070664_1002405332 291
164 3300009177 Ga0105248_10143362 Ga0105248_101433623 291
165 3300025245 Ga0207425_1015084 Ga0207425_10150842 291
166 3300025263 Ga0209565_1000007 Ga0209565_1000007233 291
167 3300025273 Ga0209673_1001068 Ga0209673_100106827 291
168 3300025291 Ga0209675_1006849 Ga0209675_10068492 291
169 3300025299 Ga0209256_1000008 Ga0209256_100000875 291
170 3300025304 Ga0209257_1002047 Ga0209257_100204713 291
171 3300025931 Ga0207644_10023982 Ga0207644_100239825 291
172 3300025933 Ga0207706_10033408 Ga0207706_100334086 291
173 3300026095 Ga0207676_10305615 Ga0207676_103056151 291
174 iso_pu_bacteria 2855730933 2855731537 291
175 iso_pu_bacteria 2855767633 2855768243 291
176 iso_pu_bacteria 2881412998 2881413587 291
177 3300005366 Ga0070659_100286137 Ga0070659_1002861372 292
178 3300031731 Ga0307405_10016845 Ga0307405_100168457 293
179 3300031901 Ga0307406_10395872 Ga0307406_103958722 293
180 3300031911 Ga0307412_10061202 Ga0307412_100612023 293
181 3300031995 Ga0307409_100185748 Ga0307409_1001857482 293
182 3300031995 Ga0307409_100437037 Ga0307409_1004370372 293
183 3300032002 Ga0307416_100024444 Ga0307416_1000244442 293
184 3300032002 Ga0307416_100053637 Ga0307416_1000536374 293
185 3300032004 Ga0307414_10254903 Ga0307414_102549031 293
186 3300046684 Ga0495669_0011004 Ga0495669_0011004_695_1576 293
187 3300049668 Ga0501233_024172 Ga0501233_024172_97_978 293
188 3300027111 Ga0209281_1011408 Ga0209281_10114082 295
189 3300053121 Ga0500607_000007 Ga0500607_000007_116300_117217 295
190 3300053136 Ga0500559_0001181 Ga0500559_0001181_8898_9815 295
191 3300053148 Ga0500590_130387 Ga0500590_130387_152_1069 295
192 3300053178 Ga0500637_0005234 Ga0500637_0005234_1127_2044 295
193 3300053730 Ga0500645_002010 Ga0500645_002010_6575_7492 295
194 iso_pu_bacteria 2599185354 2600202790 295
195 iso_pu_bacteria 2599185359 2600228266 295
196 iso_pu_bacteria 2643221622 2644125699 295
197 iso_pu_bacteria 2751185897 2753767137 295
198 iso_pu_bacteria 2818991466 2819716312 295
199 iso_pu_bacteria 2830075706 2830079118 295
200 iso_pu_bacteria 2879163058 2879165358 295
201 iso_pu_bacteria 2885429604 2885430999 295
202 iso_pu_bacteria 2928526807 2928528885 295
203 iso_pu_bacteria 2928968154 2928970436 295
204 iso_pu_bacteria 2946787523 2946789968 295
205 3300005262 Ga0065165_1023529 Ga0065165_10235292 296
206 3300025909 Ga0207705_10025963 Ga0207705_100259634 296
207 3300026067 Ga0207678_10103986 Ga0207678_101039861 296
208 3300037466 Ga0395898_0227941 Ga0395898_0227941_196_1092 296
209 3300038443 Ga0395901_0223175 Ga0395901_0223175_31_927 296
210 2162886011 MRS1b_contig_299100 MRS1b_0022.00001440 297
211 3300001915 JGI24741J21665_1001690 JGI24741J21665_10016908 297
212 3300001979 JGI24740J21852_10004410 JGI24740J21852_100044108 297
213 3300001989 JGI24739J22299_10011758 JGI24739J22299_100117583 297
214 3300001990 JGI24737J22298_10004273 JGI24737J22298_100042737 297
215 3300001990 JGI24737J22298_10028180 JGI24737J22298_100281803 297
216 3300002774 JGI25150J39212_1000081 JGI25150J39212_100008128 297
217 3300003214 JGI25165J46597_1000138 JGI25165J46597_100013816 297
218 3300003215 JGI25153J46596_10000080 JGI25153J46596_1000008019 297
219 3300003215 JGI25153J46596_10000112 JGI25153J46596_1000011241 297
220 3300003771 Ga0055526_1001589 Ga0055526_100158914 297
221 3300003791 Ga0055530_10000049 Ga0055530_1000004991 297
222 3300003791 Ga0055530_10000073 Ga0055530_1000007360 297
223 3300003792 Ga0055540_1000940 Ga0055540_100094010 297
224 3300003794 Ga0055531_10000017 Ga0055531_10000017159 297
225 3300004625 Ga0055543_1027234 Ga0055543_10272341 297
226 3300005262 Ga0065165_1003945 Ga0065165_100394510 297
227 3300005262 Ga0065165_1006038 Ga0065165_10060384 297
228 3300005290 Ga0065712_10071677 Ga0065712_100716773 297
229 3300005290 Ga0065712_10154066 Ga0065712_101540662 297
230 3300005293 Ga0065715_10130889 Ga0065715_101308893 297
231 3300005327 Ga0070658_10000209 Ga0070658_1000020939 297
232 3300005329 Ga0070683_100322930 Ga0070683_1003229301 297
233 3300005331 Ga0070670_100001575 Ga0070670_10000157511 297
234 3300005333 Ga0070677_10001952 Ga0070677_100019525 297
235 3300005336 Ga0070680_100029357 Ga0070680_1000293572 297
236 3300005338 Ga0068868_100000020 Ga0068868_10000002051 297
237 3300005339 Ga0070660_100000381 Ga0070660_10000038113 297
238 3300005339 Ga0070660_100000567 Ga0070660_10000056717 297
239 3300005339 Ga0070660_100002485 Ga0070660_1000024854 297
240 3300005339 Ga0070660_100058373 Ga0070660_1000583733 297
241 3300005339 Ga0070660_100131205 Ga0070660_1001312052 297
242 3300005339 Ga0070660_100141087 Ga0070660_1001410872 297
243 3300005344 Ga0070661_100000764 Ga0070661_10000076412 297
244 3300005344 Ga0070661_100018324 Ga0070661_1000183241 297
245 3300005345 Ga0070692_10020062 Ga0070692_100200622 297
246 3300005353 Ga0070669_100053605 Ga0070669_1000536052 297
247 3300005353 Ga0070669_100089304 Ga0070669_1000893042 297
248 3300005354 Ga0070675_100002279 Ga0070675_1000022799 297
249 3300005354 Ga0070675_100006097 Ga0070675_1000060974 297
250 3300005354 Ga0070675_100075309 Ga0070675_1000753092 297
251 3300005354 Ga0070675_100082466 Ga0070675_1000824662 297
252 3300005355 Ga0070671_100009594 Ga0070671_1000095949 297
253 3300005355 Ga0070671_100010401 Ga0070671_1000104015 297
254 3300005355 Ga0070671_100066255 Ga0070671_1000662553 297
255 3300005356 Ga0070674_100035505 Ga0070674_1000355054 297
256 3300005364 Ga0070673_100007210 Ga0070673_1000072105 297
257 3300005366 Ga0070659_100000017 Ga0070659_10000001794 297
258 3300005366 Ga0070659_100119248 Ga0070659_1001192481 297
259 3300005367 Ga0070667_100009793 Ga0070667_1000097933 297
260 3300005367 Ga0070667_100085908 Ga0070667_1000859082 297
261 3300005367 Ga0070667_100359883 Ga0070667_1003598832 297
262 3300005455 Ga0070663_100015279 Ga0070663_1000152794 297
263 3300005458 Ga0070681_10067145 Ga0070681_100671455 297
264 3300005530 Ga0070679_100000001 Ga0070679_100000001474 297
265 3300005543 Ga0070672_100120811 Ga0070672_1001208112 297
266 3300005544 Ga0070686_100000056 Ga0070686_10000005667 297
267 3300005548 Ga0070665_100000021 Ga0070665_100000021395 297
268 3300005548 Ga0070665_100000497 Ga0070665_10000049753 297
269 3300005548 Ga0070665_100101657 Ga0070665_1001016572 297
270 3300005548 Ga0070665_100185476 Ga0070665_1001854763 297
271 3300005563 Ga0068855_100147957 Ga0068855_1001479572 297
272 3300005564 Ga0070664_100004202 Ga0070664_1000042027 297
273 3300005564 Ga0070664_100063823 Ga0070664_1000638233 297
274 3300005577 Ga0068857_100009009 Ga0068857_1000090093 297
275 3300005578 Ga0068854_100034554 Ga0068854_1000345544 297
276 3300005578 Ga0068854_100366004 Ga0068854_1003660041 297
277 3300005616 Ga0068852_100533106 Ga0068852_1005331061 297
278 3300005617 Ga0068859_100015698 Ga0068859_1000156982 297
279 3300005618 Ga0068864_100000870 Ga0068864_10000087023 297
280 3300005618 Ga0068864_100134875 Ga0068864_1001348752 297
281 3300005719 Ga0068861_100000271 Ga0068861_10000027112 297
282 3300005834 Ga0068851_10010027 Ga0068851_100100273 297
283 3300005841 Ga0068863_100000186 Ga0068863_10000018671 297
284 3300005841 Ga0068863_100025592 Ga0068863_1000255925 297
285 3300005842 Ga0068858_100000022 Ga0068858_100000022137 297
286 3300005842 Ga0068858_100000318 Ga0068858_10000031837 297
287 3300005985 Ga0081539_10026431 Ga0081539_100264312 297
288 3300006195 Ga0075366_10038523 Ga0075366_100385234 297
289 3300006846 Ga0075430_100256079 Ga0075430_1002560792 297
290 3300006931 Ga0097620_100015698 Ga0097620_1000156982 297
291 3300009098 Ga0105245_10001471 Ga0105245_100014715 297
292 3300009098 Ga0105245_10076742 Ga0105245_100767424 297
293 3300009148 Ga0105243_10134584 Ga0105243_101345843 297
294 3300009174 Ga0105241_10010947 Ga0105241_100109475 297
295 3300009177 Ga0105248_10003753 Ga0105248_1000375312 297
296 3300009177 Ga0105248_10052245 Ga0105248_100522454 297
297 3300009177 Ga0105248_10067604 Ga0105248_100676043 297
298 3300009545 Ga0105237_10014154 Ga0105237_100141543 297
299 3300009551 Ga0105238_10009972 Ga0105238_1000997211 297
300 3300009553 Ga0105249_10011955 Ga0105249_100119558 297
301 3300013100 Ga0157373_10138777 Ga0157373_101387772 297
302 3300013102 Ga0157371_10000066 Ga0157371_10000066146 297
303 3300013104 Ga0157370_10042974 Ga0157370_100429748 297
304 3300013105 Ga0157369_10005411 Ga0157369_1000541114 297
305 3300013306 Ga0163162_10001728 Ga0163162_1000172816 297
306 3300014968 Ga0157379_10128443 Ga0157379_101284432 297
307 3300020082 Ga0206353_10341789 Ga0206353_103417895 297
308 3300021358 Ga0213873_10000023 Ga0213873_1000002372 297
309 3300021384 Ga0213876_10000091 Ga0213876_1000009128 297
310 3300025245 Ga0207425_1000019 Ga0207425_1000019254 297
311 3300025250 Ga0209026_1009440 Ga0209026_10094403 297
312 3300025258 Ga0209129_1000951 Ga0209129_100095113 297
313 3300025261 Ga0209233_1000182 Ga0209233_100018226 297
314 3300025263 Ga0209565_1000089 Ga0209565_1000089124 297
315 3300025263 Ga0209565_1008886 Ga0209565_10088863 297
316 3300025272 Ga0209455_1007590 Ga0209455_10075904 297
317 3300025292 Ga0209676_1008871 Ga0209676_10088716 297
318 3300025294 Ga0209025_1000268 Ga0209025_100026885 297
319 3300025295 Ga0209564_1001376 Ga0209564_100137616 297
320 3300025297 Ga0209758_1000019 Ga0209758_1000019333 297
321 3300025297 Ga0209758_1000023 Ga0209758_1000023321 297
322 3300025298 Ga0209050_1000001 Ga0209050_10000011420 297
323 3300025298 Ga0209050_1000102 Ga0209050_1000102158 297
324 3300025303 Ga0209051_1000304 Ga0209051_100030450 297
325 3300025304 Ga0209257_1000112 Ga0209257_1000112158 297
326 3300025304 Ga0209257_1020279 Ga0209257_10202792 297
327 3300025315 Ga0207697_10070312 Ga0207697_100703123 297
328 3300025321 Ga0207656_10002461 Ga0207656_100024619 297
329 3300025893 Ga0207682_10000829 Ga0207682_1000082912 297
330 3300025893 Ga0207682_10003840 Ga0207682_100038407 297
331 3300025901 Ga0207688_10175415 Ga0207688_101754152 297
332 3300025904 Ga0207647_10019765 Ga0207647_100197655 297
333 3300025904 Ga0207647_10199358 Ga0207647_101993582 297
334 3300025909 Ga0207705_10000005 Ga0207705_10000005558 297
335 3300025909 Ga0207705_10000618 Ga0207705_100006185 297
336 3300025909 Ga0207705_10038288 Ga0207705_100382882 297
337 3300025911 Ga0207654_10008597 Ga0207654_100085976 297
338 3300025912 Ga0207707_10051512 Ga0207707_100515122 297
339 3300025913 Ga0207695_10013348 Ga0207695_100133484 297
340 3300025914 Ga0207671_10006249 Ga0207671_100062498 297
341 3300025917 Ga0207660_10004252 Ga0207660_1000425210 297
342 3300025919 Ga0207657_10000800 Ga0207657_100008002 297
343 3300025919 Ga0207657_10001546 Ga0207657_100015463 297
344 3300025919 Ga0207657_10010024 Ga0207657_100100242 297
345 3300025919 Ga0207657_10011474 Ga0207657_100114749 297
346 3300025919 Ga0207657_10062430 Ga0207657_100624302 297
347 3300025920 Ga0207649_10000027 Ga0207649_1000002744 297
348 3300025920 Ga0207649_10000471 Ga0207649_100004714 297
349 3300025921 Ga0207652_10000003 Ga0207652_1000000371 297
350 3300025923 Ga0207681_10006740 Ga0207681_100067406 297
351 3300025923 Ga0207681_10043833 Ga0207681_100438333 297
352 3300025924 Ga0207694_10011586 Ga0207694_100115869 297
353 3300025924 Ga0207694_10355888 Ga0207694_103558882 297
354 3300025925 Ga0207650_10037118 Ga0207650_100371184 297
355 3300025926 Ga0207659_10002718 Ga0207659_100027189 297
356 3300025926 Ga0207659_10086574 Ga0207659_100865743 297
357 3300025927 Ga0207687_10034874 Ga0207687_100348745 297
358 3300025931 Ga0207644_10000032 Ga0207644_1000003273 297
359 3300025931 Ga0207644_10014887 Ga0207644_100148874 297
360 3300025932 Ga0207690_10000035 Ga0207690_1000003598 297
361 3300025932 Ga0207690_10000868 Ga0207690_1000086813 297
362 3300025932 Ga0207690_10035119 Ga0207690_100351192 297
363 3300025932 Ga0207690_10110891 Ga0207690_101108912 297
364 3300025933 Ga0207706_10007371 Ga0207706_100073712 297
365 3300025933 Ga0207706_10072327 Ga0207706_100723272 297
366 3300025935 Ga0207709_10140645 Ga0207709_101406452 297
367 3300025937 Ga0207669_10062519 Ga0207669_100625192 297
368 3300025940 Ga0207691_10006900 Ga0207691_1000690012 297
369 3300025940 Ga0207691_10182738 Ga0207691_101827382 297
370 3300025941 Ga0207711_10007985 Ga0207711_1000798510 297
371 3300025941 Ga0207711_10029889 Ga0207711_100298894 297
372 3300025945 Ga0207679_10203901 Ga0207679_102039011 297
373 3300025949 Ga0207667_10000001 Ga0207667_10000001179 297
374 3300025961 Ga0207712_10024593 Ga0207712_100245934 297
375 3300025972 Ga0207668_10000034 Ga0207668_1000003470 297
376 3300025981 Ga0207640_10015362 Ga0207640_100153623 297
377 3300025981 Ga0207640_10025108 Ga0207640_100251084 297
378 3300025981 Ga0207640_10484559 Ga0207640_104845591 297
379 3300026023 Ga0207677_10000071 Ga0207677_100000719 297
380 3300026023 Ga0207677_10510683 Ga0207677_105106831 297
381 3300026035 Ga0207703_10000048 Ga0207703_1000004876 297
382 3300026041 Ga0207639_10025577 Ga0207639_100255772 297
383 3300026041 Ga0207639_10101014 Ga0207639_101010142 297
384 3300026067 Ga0207678_10009241 Ga0207678_100092414 297
385 3300026078 Ga0207702_10004316 Ga0207702_1000431615 297
386 3300026088 Ga0207641_10000031 Ga0207641_10000031158 297
387 3300026088 Ga0207641_10004526 Ga0207641_100045266 297
388 3300026095 Ga0207676_10000270 Ga0207676_1000027012 297
389 3300026095 Ga0207676_10081571 Ga0207676_100815713 297
390 3300026116 Ga0207674_10053276 Ga0207674_100532763 297
391 3300026116 Ga0207674_10054927 Ga0207674_100549275 297
392 3300026116 Ga0207674_10109871 Ga0207674_101098713 297
393 3300026118 Ga0207675_100000038 Ga0207675_10000003878 297
394 3300026142 Ga0207698_10097414 Ga0207698_100974142 297
395 3300026142 Ga0207698_10616177 Ga0207698_106161772 297
396 3300027876 Ga0209974_10010519 Ga0209974_100105191 297
397 3300028379 Ga0268266_10000015 Ga0268266_1000001559 297
398 3300028379 Ga0268266_10000294 Ga0268266_1000029423 297
399 3300028379 Ga0268266_10007596 Ga0268266_100075964 297
400 3300028381 Ga0268264_10020145 Ga0268264_100201454 297
401 3300028786 Ga0307517_10009422 Ga0307517_1000942212 297
402 3300031456 Ga0307513_10106571 Ga0307513_101065712 297
403 3300031507 Ga0307509_10379440 Ga0307509_103794402 297
404 3300031548 Ga0307408_100192243 Ga0307408_1001922432 297
405 3300031548 Ga0307408_100200798 Ga0307408_1002007982 297
406 3300031548 Ga0307408_100214980 Ga0307408_1002149802 297
407 3300031616 Ga0307508_10000550 Ga0307508_1000055028 297
408 3300031731 Ga0307405_10233130 Ga0307405_102331302 297
409 3300031824 Ga0307413_10238472 Ga0307413_102384721 297
410 3300031824 Ga0307413_10245410 Ga0307413_102454102 297
411 3300031852 Ga0307410_10000178 Ga0307410_100001786 297
412 3300031852 Ga0307410_10013007 Ga0307410_100130073 297
413 3300031852 Ga0307410_10117314 Ga0307410_101173143 297
414 3300031852 Ga0307410_10155448 Ga0307410_101554482 297
415 3300031852 Ga0307410_10228140 Ga0307410_102281402 297
416 3300031852 Ga0307410_10230356 Ga0307410_102303563 297
417 3300031852 Ga0307410_10315201 Ga0307410_103152011 297
418 3300031903 Ga0307407_10018363 Ga0307407_100183633 297
419 3300031903 Ga0307407_10041543 Ga0307407_100415434 297
420 3300031911 Ga0307412_10001148 Ga0307412_100011482 297
421 3300031911 Ga0307412_10072047 Ga0307412_100720474 297
422 3300031995 Ga0307409_100000947 Ga0307409_1000009475 297
423 3300031995 Ga0307409_100002166 Ga0307409_1000021662 297
424 3300031995 Ga0307409_100022765 Ga0307409_1000227656 297
425 3300031995 Ga0307409_100027349 Ga0307409_1000273494 297
426 3300031995 Ga0307409_100106575 Ga0307409_1001065752 297
427 3300031995 Ga0307409_100428986 Ga0307409_1004289861 297
428 3300032002 Ga0307416_100008752 Ga0307416_1000087525 297
429 3300032002 Ga0307416_100017891 Ga0307416_1000178913 297
430 3300032002 Ga0307416_100039405 Ga0307416_1000394055 297
431 3300032002 Ga0307416_100130377 Ga0307416_1001303771 297
432 3300032002 Ga0307416_100276642 Ga0307416_1002766422 297
433 3300032002 Ga0307416_100765232 Ga0307416_1007652321 297
434 3300032004 Ga0307414_10032682 Ga0307414_100326822 297
435 3300032004 Ga0307414_10152630 Ga0307414_101526302 297
436 3300032004 Ga0307414_10284496 Ga0307414_102844962 297
437 3300032005 Ga0307411_10001198 Ga0307411_100011982 297
438 3300032005 Ga0307411_10019714 Ga0307411_100197142 297
439 3300032005 Ga0307411_10044462 Ga0307411_100444622 297
440 3300032005 Ga0307411_10051868 Ga0307411_100518683 297
441 3300032005 Ga0307411_10127002 Ga0307411_101270022 297
442 3300032005 Ga0307411_10251359 Ga0307411_102513592 297
443 3300032126 Ga0307415_100010658 Ga0307415_1000106585 297
444 3300032126 Ga0307415_100248318 Ga0307415_1002483182 297
445 3300033180 Ga0307510_10002463 Ga0307510_100024637 297
446 3300037418 Ga0395900_0074842 Ga0395900_0074842_767_1666 297
447 3300038443 Ga0395901_0078048 Ga0395901_0078048_2410_3309 297
448 3300038443 Ga0395901_0140808 Ga0395901_0140808_310_1212 297
449 3300038705 Ga0237819_01122 Ga0237819_01122_5672_6571 297
450 3300039437 Ga0436365_0598248 Ga0436365_0598248_31114_32016 297
451 3300039437 Ga0436365_1404021 Ga0436365_1404021_589_1491 297
452 3300039453 Ga0436362_0265247 Ga0436362_0265247_30591_31493 297
453 3300041410 Ga0439461_0000038 Ga0439461_0000038_7771_8670 297
454 3300041411 Ga0439466_0047431 Ga0439466_0047431_190_1089 297
455 3300041413 Ga0439465_0001902 Ga0439465_0001902_21_1010 297
456 3300041413 Ga0439465_0020138 Ga0439465_0020138_200_1099 297
457 3300041486 Ga0451807_0677377 Ga0451807_0677377_467_1369 297
458 3300041997 Ga0439431_0000211 Ga0439431_0000211_7784_8683 297
459 3300041997 Ga0439431_0048756 Ga0439431_0048756_41_940 297
460 3300042002 Ga0439442_000860 Ga0439442_000860_1534_2433 297
461 3300042004 Ga0439445_0000068 Ga0439445_0000068_1622_2521 297
462 3300042004 Ga0439445_0002914 Ga0439445_0002914_59_958 297
463 3300042006 Ga0439432_000877 Ga0439432_000877_2877_3776 297
464 3300042006 Ga0439432_051651 Ga0439432_051651_316_1209 297
465 3300042122 Ga0450920_013992 Ga0450920_013992_515_1411 297
466 3300042435 Ga0439434_0002135 Ga0439434_0002135_280_1179 297
467 3300046452 Ga0495617_049090 Ga0495617_049090_249_1151 297
468 3300046453 Ga0495627_012247 Ga0495627_012247_319_1218 297
469 3300046460 Ga0495638_0000012 Ga0495638_0000012_145266_146168 297
470 3300046460 Ga0495638_0002975 Ga0495638_0002975_7704_8603 297
471 3300046492 Ga0495585_0002773 Ga0495585_0002773_5292_6194 297
472 3300046492 Ga0495585_0020405 Ga0495585_0020405_2020_2913 297
473 3300046492 Ga0495585_0126023 Ga0495585_0126023_417_1319 297
474 3300046501 Ga0495607_0016870 Ga0495607_0016870_2429_3328 297
475 3300046506 Ga0495583_0000411 Ga0495583_0000411_18897_19799 297
476 3300046506 Ga0495583_0001065 Ga0495583_0001065_29046_29948 297
477 3300046506 Ga0495583_0003000 Ga0495583_0003000_2418_3332 297
478 3300046506 Ga0495583_0013953 Ga0495583_0013953_2627_3529 297
479 3300046507 Ga0495606_0000383 Ga0495606_0000383_5775_6677 297
480 3300046518 Ga0495631_0031426 Ga0495631_0031426_1218_2120 297
481 3300046519 Ga0495632_0000832 Ga0495632_0000832_3731_4633 297
482 3300046522 Ga0495643_0000556 Ga0495643_0000556_41208_42110 297
483 3300046522 Ga0495643_0006292 Ga0495643_0006292_5300_6202 297
484 3300046522 Ga0495643_0031650 Ga0495643_0031650_334_1236 297
485 3300046522 Ga0495643_0050076 Ga0495643_0050076_1105_2007 297
486 3300046523 Ga0495644_0044850 Ga0495644_0044850_494_1387 297
487 3300046524 Ga0495648_0000038 Ga0495648_0000038_45445_46347 297
488 3300046524 Ga0495648_0000901 Ga0495648_0000901_26475_27377 297
489 3300046524 Ga0495648_0013015 Ga0495648_0013015_3764_4678 297
490 3300046529 Ga0495652_0031929 Ga0495652_0031929_1928_2827 297
491 3300046537 Ga0495598_0001525 Ga0495598_0001525_3303_4196 297
492 3300046539 Ga0495621_0002891 Ga0495621_0002891_3116_4009 297
493 3300046542 Ga0495597_0026834 Ga0495597_0026834_192_1094 297
494 3300046558 Ga0495633_0002232 Ga0495633_0002232_5698_6600 297
495 3300046558 Ga0495633_0013935 Ga0495633_0013935_2347_3240 297
496 3300046558 Ga0495633_0015028 Ga0495633_0015028_687_1589 297
497 3300046558 Ga0495633_0016871 Ga0495633_0016871_699_1601 297
498 3300046616 Ga0495668_0000218 Ga0495668_0000218_32878_33780 297
499 3300046648 Ga0495611_0005427 Ga0495611_0005427_2453_3355 297
500 3300046648 Ga0495611_0035355 Ga0495611_0035355_52_954 297
501 3300046660 Ga0495625_0000496 Ga0495625_0000496_5687_6589 297
502 3300046660 Ga0495625_0001098 Ga0495625_0001098_26669_27568 297
503 3300046660 Ga0495625_0028736 Ga0495625_0028736_2352_3254 297
504 3300046660 Ga0495625_0040485 Ga0495625_0040485_1337_2239 297
505 3300046665 Ga0495661_0116386 Ga0495661_0116386_554_1447 297
506 3300046684 Ga0495669_0000241 Ga0495669_0000241_5793_6695 297
507 3300046684 Ga0495669_0002156 Ga0495669_0002156_4425_5318 297
508 3300046684 Ga0495669_0015695 Ga0495669_0015695_1044_1937 297
509 3300046691 Ga0495670_0000104 Ga0495670_0000104_29212_30111 297
510 3300046691 Ga0495670_0027119 Ga0495670_0027119_1409_2311 297
511 3300046691 Ga0495670_0054457 Ga0495670_0054457_128_1030 297
512 3300046692 Ga0495671_0000034 Ga0495671_0000034_45221_46123 297
513 3300046694 Ga0495649_0035817 Ga0495649_0035817_1205_2104 297
514 3300047323 Ga0495683_0002703 Ga0495683_0002703_7623_8525 297
515 3300047443 Ga0495687_000082 Ga0495687_000082_19216_20118 297
516 3300047443 Ga0495687_000472 Ga0495687_000472_40716_41618 297
517 3300047469 Ga0495673_0000013 Ga0495673_0000013_117922_118824 297
518 3300047469 Ga0495673_0050588 Ga0495673_0050588_732_1634 297
519 3300047470 Ga0495681_0002528 Ga0495681_0002528_8538_9440 297
520 3300047470 Ga0495681_0039186 Ga0495681_0039186_1310_2212 297
521 3300047472 Ga0495686_0000602 Ga0495686_0000602_7909_8811 297
522 3300047472 Ga0495686_0099947 Ga0495686_0099947_654_1553 297
523 3300048905 Ga0496102_0000930 Ga0496102_0000930_17014_17916 297
524 3300048906 Ga0496103_0001181 Ga0496103_0001181_11311_12213 297
525 3300048907 Ga0496104_0003538 Ga0496104_0003538_8530_9432 297
526 3300048908 Ga0496105_0001238 Ga0496105_0001238_11090_11992 297
527 3300048913 Ga0496110_0005603 Ga0496110_0005603_8769_9662 297
528 3300048913 Ga0496110_0016383 Ga0496110_0016383_969_1871 297
529 3300048914 Ga0496111_0001589 Ga0496111_0001589_7620_8513 297
530 3300048914 Ga0496111_0025686 Ga0496111_0025686_1276_2178 297
531 3300048918 Ga0496115_0000339 Ga0496115_0000339_33177_34079 297
532 3300048918 Ga0496115_0009842 Ga0496115_0009842_538_1437 297
533 3300048919 Ga0496116_0006574 Ga0496116_0006574_7356_8258 297
534 3300048920 Ga0496117_0003623 Ga0496117_0003623_11076_11978 297
535 3300048921 Ga0496118_0002640 Ga0496118_0002640_17044_17946 297
536 3300048923 Ga0496120_0018434 Ga0496120_0018434_3033_3932 297
537 3300048924 Ga0496121_0000128 Ga0496121_0000128_73706_74605 297
538 3300048924 Ga0496121_0004809 Ga0496121_0004809_11097_11999 297
539 3300048925 Ga0496122_0182792 Ga0496122_0182792_170_1069 297
540 3300048926 Ga0496123_0008086 Ga0496123_0008086_8571_9473 297
541 3300048926 Ga0496123_0057905 Ga0496123_0057905_782_1681 297
542 3300048926 Ga0496123_0086142 Ga0496123_0086142_793_1692 297
543 3300048927 Ga0496124_0000761 Ga0496124_0000761_14819_15718 297
544 3300048927 Ga0496124_0001474 Ga0496124_0001474_27863_28765 297
545 3300048927 Ga0496124_0003074 Ga0496124_0003074_12682_13581 297
546 3300048927 Ga0496124_0040880 Ga0496124_0040880_699_1598 297
547 3300048928 Ga0496125_0004606 Ga0496125_0004606_4092_4994 297
548 3300048929 Ga0496126_0000467 Ga0496126_0000467_62368_63270 297
549 3300049513 Ga0501290_000033 Ga0501290_000033_8689_9588 297
550 3300049515 Ga0501292_000026 Ga0501292_000026_12050_12949 297
551 3300049517 Ga0501294_001219 Ga0501294_001219_1263_2162 297
552 3300049571 Ga0501034_0143067 Ga0501034_0143067_1108_2007 297
553 3300049653 Ga0501206_002038 Ga0501206_002038_71_970 297
554 3300049662 Ga0501222_000164 Ga0501222_000164_6969_7868 297
555 3300049663 Ga0501223_000934 Ga0501223_000934_4213_5112 297
556 3300049686 Ga0501257_000093 Ga0501257_000093_2798_3697 297
557 3300049686 Ga0501257_022339 Ga0501257_022339_384_1283 297
558 3300049690 Ga0501261_000055 Ga0501261_000055_9368_10267 297
559 3300049704 Ga0501221_004751 Ga0501221_004751_650_1549 297
560 3300049708 Ga0501245_000201 Ga0501245_000201_455_1354 297
561 3300049775 Ga0501279_000066 Ga0501279_000066_12015_12914 297
562 3300049776 Ga0501280_000428 Ga0501280_000428_4872_5771 297
563 3300049777 Ga0501281_00046 Ga0501281_00046_1856_2755 297
564 3300049778 Ga0501282_001783 Ga0501282_001783_1351_2250 297
565 3300049779 Ga0501283_004254 Ga0501283_004254_397_1296 297
566 3300050493 nmdc:mga0k408_46010_c1 nmdc:mga0k408_46010_c1_1558_2460 297
567 3300050509 nmdc:mga0qj67_77037_c1 nmdc:mga0qj67_77037_c1_1550_2446 297
568 3300053079 Ga0500610_0001098 Ga0500610_0001098_2201_3103 297
569 3300053087 Ga0500643_000292 Ga0500643_000292_40097_40996 297
570 3300053087 Ga0500643_001429 Ga0500643_001429_5710_6609 297
571 3300053087 Ga0500643_014938 Ga0500643_014938_607_1506 297
572 3300053090 Ga0500646_0041121 Ga0500646_0041121_154_1053 297
573 3300053094 Ga0500566_0003208 Ga0500566_0003208_128_1027 297
574 3300053104 Ga0500556_0033203 Ga0500556_0033203_236_1135 297
575 3300053134 Ga0500658_0006669 Ga0500658_0006669_48_947 297
576 3300053134 Ga0500658_0010916 Ga0500658_0010916_1211_2110 297
577 3300053136 Ga0500559_0004787 Ga0500559_0004787_3374_4273 297
578 3300053136 Ga0500559_0134924 Ga0500559_0134924_110_1009 297
579 3300053139 Ga0500568_0002185 Ga0500568_0002185_6934_7833 297
580 3300053140 Ga0500573_0000030 Ga0500573_0000030_20649_21548 297
581 3300053151 Ga0500604_0000001 Ga0500604_0000001_167473_168372 297
582 3300053151 Ga0500604_0031722 Ga0500604_0031722_147_1043 297
583 3300053153 Ga0500616_0000070 Ga0500616_0000070_225898_226797 297
584 3300053153 Ga0500616_0008535 Ga0500616_0008535_1648_2547 297
585 3300053177 Ga0500636_0002811 Ga0500636_0002811_5710_6612 297
586 3300053730 Ga0500645_000237 Ga0500645_000237_14718_15620 297
587 3300053739 Ga0500587_001316 Ga0500587_001316_535_1434 297
588 3300059510 Ga0587090_004550 Ga0587090_004550_355_1257 297
589 3300059513 Ga0587094_004794 Ga0587094_004794_430_1332 297
590 3300060344 Ga0587071_012130 Ga0587071_012130_434_1336 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05726

Pirin_C

Pirin C-terminal cupin domain

208

307

0.98

PF02678

Pirin

Pirin

49

155

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tfq-assembly1.cif.gz_A crystal structure of the pirin family protein redox-sensitive bicupin yhak bound to copper ion from yersinia pestis 0.9372 1 274
6d0p-assembly4.cif.gz_D 1.88 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii 0.9348 1 276
6d0g-assembly1.cif.gz_A 1.78 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii 0.926 2 294
6d0g-assembly1.cif.gz_A 1.78 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii 0.908 2 294
7tfq-assembly1.cif.gz_A crystal structure of the pirin family protein redox-sensitive bicupin yhak bound to copper ion from yersinia pestis 0.9024 1 274
ID Description Score Start End Superfamily
af_Q9SR06_19_98_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.9173 176 240 2.60.120.1030
af_C0P2Q1_61_325_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9092 11 272 2.60.120.10
af_Q5M827_137_273_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9032 143 270 2.60.120.10
af_Q9D711_137_245_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8951 143 243 2.60.120.10
4oi2A01 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.8946 176 238 2.60.120.1030
ID Description Score Start End GO Terms
AF-A0A5E6QY55-F1-model_v4 Pirin N-terminal domain-containing protein 0.9964 44 145
AF-A0A6L3ZQX3-F1-model_v4 deleted 0.9915 8 136
AF-A0A4Q2YVQ3-F1-model_v4 Pirin family protein 0.9902 6 223 GO:0046872
AF-A0A536TC78-F1-model_v4 Pirin family protein 0.99 31 290 GO:0046872
AF-A0A2N7XTZ3-F1-model_v4 Pirin N-terminal domain-containing protein 0.9895 54 147

Feature Viewer

pLDDT pTM Quality
93.58 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map