F466987
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 590 | 342 | 567 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300041413|Ga0439465_0001902|Ga0439465_0001902_21_1010 |
| Length | 329 |
| Sequence | MRPDRKITLSKLWLSRPAPTGYFDGRTEGRMTEDLIIQTIEPVTHDLGGFKVHRTLPSRPRTMVGPFIFFDQMGPAHLDVGTGIDVRPHPXINLATVTYLYAGAIDHRDSLGTFATIEPGAVNLMTAGNGIVHSERSPSAERARGPELSGIQTWLALPEADEEIDPAFEHVAAADLPVIEAGGATARVIMGSLWDAAAPTTTYAGTIYADIALAPGGSIPVDAEADERAVYVSMGEASLDGLRLEPMTLYVLRPGTAATLRSERGGRVMLCGGEAFKTPRHVWWNFVSSSRDRINQAKQDWQAGNFAKVPGDDKEWIPIPEVPKTVSYP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 3 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 4 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 5 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 6 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 7 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 8 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 9 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 10 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 11 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 12 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 13 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 14 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 15 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 16 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 17 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 18 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 19 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 20 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 21 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 22 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 23 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 24 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 25 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 26 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 27 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 28 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 29 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 30 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 46 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 47 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 49 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 57 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 192 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 203 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 204 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 209 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 218 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 219 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 220 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 221 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 223 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 224 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 225 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 226 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 227 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 228 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 229 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 230 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 282 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 283 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 284 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 285 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 286 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 287 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 288 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 289 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 290 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 291 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 292 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 293 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 294 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 295 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 296 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 299 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 300 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 301 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 304 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 305 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 306 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 308 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 310 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 311 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 312 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 313 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 314 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 316 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 319 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 320 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 321 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 322 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 323 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 324 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 325 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 327 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 328 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 329 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 330 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 331 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 332 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 333 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 334 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 335 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 336 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 337 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 338 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 339 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 340 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.42 |
| Metatranscriptomes | 0.68 |
| Isolates | 3.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.12 |
| Nodule | 0.51 |
| Rhizoplane | 2.54 |
| Rhizosphere | 70.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_299100 | 2162886011 | Bacteria | 3052 |
| 2 | JGI24741J21665_1001690 | 3300001915 | Bacteria | 6110 |
| 3 | JGI24740J21852_10004410 | 3300001979 | Bacteria | 6048 |
| 4 | JGI24739J22299_10011758 | 3300001989 | Bacteria | 3225 |
| 5 | JGI24737J22298_10004273 | 3300001990 | Bacteria | 4989 |
| 6 | JGI24737J22298_10028180 | 3300001990 | Bacteria | 1767 |
| 7 | JGI25162J39368_1000036 | 3300002737 | Bacteria | 180433 |
| 8 | JGI25150J39212_1000081 | 3300002774 | Bacteria | 58313 |
| 9 | JGI25165J46597_1000022 | 3300003214 | Bacteria | 357959 |
| 10 | JGI25165J46597_1000138 | 3300003214 | Bacteria | 121773 |
| 11 | JGI25153J46596_10000080 | 3300003215 | Bacteria | 113263 |
| 12 | JGI25153J46596_10000112 | 3300003215 | Bacteria | 92578 |
| 13 | JGI25153J46596_10048176 | 3300003215 | Bacteria | 1247 |
| 14 | Ga0055538_1000011 | 3300003751 | Bacteria | 357959 |
| 15 | Ga0055539_1000016 | 3300003752 | Bacteria | 358248 |
| 16 | Ga0055533_1000019 | 3300003756 | Bacteria | 357959 |
| 17 | Ga0055525_1000042 | 3300003759 | Bacteria | 279804 |
| 18 | Ga0055525_1000070 | 3300003759 | Bacteria | 183047 |
| 19 | Ga0055542_1000402 | 3300003762 | Bacteria | 42527 |
| 20 | Ga0055529_1000439 | 3300003763 | Bacteria | 41829 |
| 21 | Ga0055526_1001589 | 3300003771 | Bacteria | 15946 |
| 22 | Ga0055537_1001707 | 3300003773 | Bacteria | 8124 |
| 23 | Ga0055524_1000226 | 3300003775 | Bacteria | 59950 |
| 24 | Ga0055530_10000049 | 3300003791 | Bacteria | 107051 |
| 25 | Ga0055530_10000073 | 3300003791 | Bacteria | 85352 |
| 26 | Ga0055530_10026435 | 3300003791 | Bacteria | 1604 |
| 27 | Ga0055540_1000940 | 3300003792 | Bacteria | 18931 |
| 28 | Ga0055531_10000017 | 3300003794 | Bacteria | 177036 |
| 29 | Ga0055531_10007290 | 3300003794 | Bacteria | 6066 |
| 30 | Ga0055541_1000017 | 3300003841 | Bacteria | 286811 |
| 31 | Ga0055543_1027234 | 3300004625 | Bacteria | 1013 |
| 32 | Ga0065165_1003945 | 3300005262 | Bacteria | 9759 |
| 33 | Ga0065165_1006038 | 3300005262 | Bacteria | 6510 |
| 34 | Ga0065165_1012591 | 3300005262 | Bacteria | 3431 |
| 35 | Ga0065165_1023529 | 3300005262 | Bacteria | 2087 |
| 36 | Ga0065704_10095203 | 3300005289 | Bacteria | 2499 |
| 37 | Ga0065712_10071677 | 3300005290 | Bacteria | 5119 |
| 38 | Ga0065712_10154066 | 3300005290 | Bacteria | 1348 |
| 39 | Ga0065715_10130889 | 3300005293 | Bacteria | 2018 |
| 40 | Ga0070658_10000209 | 3300005327 | Bacteria | 51813 |
| 41 | Ga0070658_10003103 | 3300005327 | Bacteria | 13704 |
| 42 | Ga0070676_10125271 | 3300005328 | Bacteria | 1618 |
| 43 | Ga0070683_100322930 | 3300005329 | Bacteria | 1469 |
| 44 | Ga0070670_100001575 | 3300005331 | Bacteria | 18384 |
| 45 | Ga0070677_10001952 | 3300005333 | Bacteria | 6539 |
| 46 | Ga0070680_100029357 | 3300005336 | Bacteria | 4417 |
| 47 | Ga0068868_100000020 | 3300005338 | Bacteria | 92590 |
| 48 | Ga0070660_100000381 | 3300005339 | Bacteria | 29499 |
| 49 | Ga0070660_100000567 | 3300005339 | Bacteria | 24778 |
| 50 | Ga0070660_100002485 | 3300005339 | Bacteria | 12648 |
| 51 | Ga0070660_100005129 | 3300005339 | Bacteria | 9051 |
| 52 | Ga0070660_100058373 | 3300005339 | Bacteria | 2991 |
| 53 | Ga0070660_100131205 | 3300005339 | Bacteria | 2005 |
| 54 | Ga0070660_100141087 | 3300005339 | Bacteria | 1933 |
| 55 | Ga0070661_100000764 | 3300005344 | Bacteria | 23216 |
| 56 | Ga0070661_100018324 | 3300005344 | Bacteria | 4977 |
| 57 | Ga0070692_10020062 | 3300005345 | Bacteria | 3235 |
| 58 | Ga0070668_100246265 | 3300005347 | Bacteria | 1482 |
| 59 | Ga0070669_100053605 | 3300005353 | Bacteria | 2952 |
| 60 | Ga0070669_100089304 | 3300005353 | Bacteria | 2308 |
| 61 | Ga0070675_100002279 | 3300005354 | Bacteria | 14247 |
| 62 | Ga0070675_100006097 | 3300005354 | Bacteria | 9244 |
| 63 | Ga0070675_100075309 | 3300005354 | Bacteria | 2805 |
| 64 | Ga0070675_100082466 | 3300005354 | Bacteria | 2683 |
| 65 | Ga0070671_100009594 | 3300005355 | Bacteria | 7777 |
| 66 | Ga0070671_100010401 | 3300005355 | Bacteria | 7463 |
| 67 | Ga0070671_100066255 | 3300005355 | Bacteria | 3009 |
| 68 | Ga0070671_100078861 | 3300005355 | Bacteria | 2752 |
| 69 | Ga0070674_100004595 | 3300005356 | Bacteria | 7891 |
| 70 | Ga0070674_100035505 | 3300005356 | Bacteria | 3339 |
| 71 | Ga0070673_100007210 | 3300005364 | Bacteria | 7310 |
| 72 | Ga0070673_100264447 | 3300005364 | Bacteria | 1504 |
| 73 | Ga0070659_100000017 | 3300005366 | Bacteria | 163966 |
| 74 | Ga0070659_100119248 | 3300005366 | Bacteria | 2135 |
| 75 | Ga0070659_100286137 | 3300005366 | Bacteria | 1372 |
| 76 | Ga0070667_100009793 | 3300005367 | Bacteria | 7947 |
| 77 | Ga0070667_100085908 | 3300005367 | Bacteria | 2699 |
| 78 | Ga0070667_100157929 | 3300005367 | Bacteria | 1996 |
| 79 | Ga0070667_100359883 | 3300005367 | Bacteria | 1319 |
| 80 | Ga0070711_100033863 | 3300005439 | Bacteria | 3404 |
| 81 | Ga0070663_100015279 | 3300005455 | Bacteria | 4951 |
| 82 | Ga0070681_10033653 | 3300005458 | Bacteria | 5145 |
| 83 | Ga0070681_10067145 | 3300005458 | Bacteria | 3555 |
| 84 | Ga0070685_10096336 | 3300005466 | Bacteria | 1800 |
| 85 | Ga0070679_100000001 | 3300005530 | Bacteria | 764811 |
| 86 | Ga0070679_100003301 | 3300005530 | Bacteria | 14768 |
| 87 | Ga0070672_100120811 | 3300005543 | Bacteria | 2144 |
| 88 | Ga0070686_100000056 | 3300005544 | Bacteria | 87537 |
| 89 | Ga0070696_100122140 | 3300005546 | Bacteria | 1886 |
| 90 | Ga0070665_100000021 | 3300005548 | Bacteria | 389668 |
| 91 | Ga0070665_100000497 | 3300005548 | Bacteria | 56270 |
| 92 | Ga0070665_100101657 | 3300005548 | Bacteria | 2879 |
| 93 | Ga0070665_100185476 | 3300005548 | Bacteria | 2081 |
| 94 | Ga0068855_100035561 | 3300005563 | Bacteria | 5933 |
| 95 | Ga0068855_100147957 | 3300005563 | Bacteria | 2672 |
| 96 | Ga0070664_100004202 | 3300005564 | Bacteria | 11571 |
| 97 | Ga0070664_100063823 | 3300005564 | Bacteria | 3140 |
| 98 | Ga0070664_100240533 | 3300005564 | Bacteria | 1625 |
| 99 | Ga0068857_100009009 | 3300005577 | Bacteria | 8652 |
| 100 | Ga0068854_100034554 | 3300005578 | Bacteria | 3533 |
| 101 | Ga0068854_100366004 | 3300005578 | Bacteria | 1184 |
| 102 | Ga0068852_100533106 | 3300005616 | Bacteria | 1173 |
| 103 | Ga0068859_100015698 | 3300005617 | Bacteria | 7610 |
| 104 | Ga0068864_100000870 | 3300005618 | Bacteria | 25428 |
| 105 | Ga0068864_100134875 | 3300005618 | Bacteria | 2222 |
| 106 | Ga0068861_100000271 | 3300005719 | Bacteria | 28950 |
| 107 | Ga0068851_10010027 | 3300005834 | Bacteria | 4412 |
| 108 | Ga0068863_100000186 | 3300005841 | Bacteria | 65963 |
| 109 | Ga0068863_100025592 | 3300005841 | Bacteria | 5627 |
| 110 | Ga0068858_100000022 | 3300005842 | Bacteria | 169718 |
| 111 | Ga0068858_100000318 | 3300005842 | Bacteria | 51170 |
| 112 | Ga0081540_1053900 | 3300005983 | Bacteria | 1969 |
| 113 | Ga0081539_10026431 | 3300005985 | Bacteria | 3704 |
| 114 | Ga0075366_10038523 | 3300006195 | Bacteria | 2823 |
| 115 | Ga0068871_100007771 | 3300006358 | Bacteria | 7678 |
| 116 | Ga0068871_100275909 | 3300006358 | Bacteria | 1469 |
| 117 | Ga0075430_100256079 | 3300006846 | Bacteria | 1450 |
| 118 | Ga0068865_100005493 | 3300006881 | Bacteria | 7691 |
| 119 | Ga0068865_100099200 | 3300006881 | Bacteria | 2129 |
| 120 | Ga0097620_100015698 | 3300006931 | Bacteria | 7610 |
| 121 | Ga0105240_10796791 | 3300009093 | Bacteria | 1024 |
| 122 | Ga0105245_10001471 | 3300009098 | Bacteria | 21285 |
| 123 | Ga0105245_10076742 | 3300009098 | Bacteria | 3045 |
| 124 | Ga0105243_10001935 | 3300009148 | Bacteria | 17641 |
| 125 | Ga0105243_10134584 | 3300009148 | Bacteria | 2101 |
| 126 | Ga0105241_10010947 | 3300009174 | Bacteria | 6653 |
| 127 | Ga0105248_10003753 | 3300009177 | Bacteria | 16834 |
| 128 | Ga0105248_10052245 | 3300009177 | Bacteria | 4586 |
| 129 | Ga0105248_10067604 | 3300009177 | Bacteria | 4012 |
| 130 | Ga0105248_10143362 | 3300009177 | Bacteria | 2696 |
| 131 | Ga0105237_10014154 | 3300009545 | Bacteria | 8350 |
| 132 | Ga0105237_10184536 | 3300009545 | Bacteria | 2086 |
| 133 | Ga0105238_10009972 | 3300009551 | Bacteria | 9525 |
| 134 | Ga0105249_10011955 | 3300009553 | Bacteria | 7636 |
| 135 | Ga0105239_10015330 | 3300010375 | Bacteria | 8492 |
| 136 | Ga0157373_10138777 | 3300013100 | Bacteria | 1709 |
| 137 | Ga0157371_10000066 | 3300013102 | Bacteria | 168406 |
| 138 | Ga0157370_10042974 | 3300013104 | Bacteria | 4352 |
| 139 | Ga0157369_10005411 | 3300013105 | Bacteria | 14863 |
| 140 | Ga0157374_10224964 | 3300013296 | Bacteria | 1842 |
| 141 | Ga0163162_10001728 | 3300013306 | Bacteria | 20466 |
| 142 | Ga0157372_10613801 | 3300013307 | Bacteria | 1268 |
| 143 | Ga0163163_10230617 | 3300014325 | Bacteria | 1901 |
| 144 | Ga0157379_10122315 | 3300014968 | Bacteria | 2342 |
| 145 | Ga0157379_10128443 | 3300014968 | Bacteria | 2281 |
| 146 | Ga0182006_1040282 | 3300015261 | Bacteria | 1839 |
| 147 | Ga0182007_10009847 | 3300015262 | Bacteria | 3814 |
| 148 | Ga0182005_1000741 | 3300015265 | Bacteria | 14944 |
| 149 | Ga0206353_10341789 | 3300020082 | Bacteria | 7854 |
| 150 | Ga0213873_10000023 | 3300021358 | Bacteria | 102573 |
| 151 | Ga0213876_10000091 | 3300021384 | Bacteria | 102527 |
| 152 | Ga0209784_100019 | 3300025224 | Bacteria | 453558 |
| 153 | Ga0209566_100017 | 3300025225 | Bacteria | 453558 |
| 154 | Ga0209674_100031 | 3300025226 | Bacteria | 453558 |
| 155 | Ga0209563_100035 | 3300025230 | Bacteria | 453558 |
| 156 | Ga0209563_100053 | 3300025230 | Bacteria | 332370 |
| 157 | Ga0207427_100315 | 3300025231 | Bacteria | 32969 |
| 158 | Ga0209437_100038 | 3300025233 | Bacteria | 453558 |
| 159 | Ga0207425_1000019 | 3300025245 | Bacteria | 399942 |
| 160 | Ga0207425_1015084 | 3300025245 | Bacteria | 1741 |
| 161 | Ga0209026_1009440 | 3300025250 | Bacteria | 1916 |
| 162 | Ga0209677_100020 | 3300025253 | Bacteria | 453558 |
| 163 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 164 | Ga0209129_1000951 | 3300025258 | Bacteria | 17420 |
| 165 | Ga0209233_1000049 | 3300025261 | Bacteria | 453558 |
| 166 | Ga0209233_1000182 | 3300025261 | Bacteria | 137671 |
| 167 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 168 | Ga0209565_1000089 | 3300025263 | Bacteria | 150511 |
| 169 | Ga0209565_1008886 | 3300025263 | Bacteria | 2598 |
| 170 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 171 | Ga0209455_1007590 | 3300025272 | Bacteria | 3041 |
| 172 | Ga0209673_1001068 | 3300025273 | Bacteria | 31210 |
| 173 | Ga0209675_1006849 | 3300025291 | Bacteria | 4493 |
| 174 | Ga0209676_1008871 | 3300025292 | Bacteria | 4421 |
| 175 | Ga0209676_1013921 | 3300025292 | Bacteria | 3061 |
| 176 | Ga0209025_1000268 | 3300025294 | Bacteria | 121656 |
| 177 | Ga0209564_1001376 | 3300025295 | Bacteria | 25390 |
| 178 | Ga0209758_1000019 | 3300025297 | Bacteria | 743682 |
| 179 | Ga0209758_1000023 | 3300025297 | Bacteria | 612453 |
| 180 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 181 | Ga0209050_1000102 | 3300025298 | Bacteria | 229971 |
| 182 | Ga0209050_1001812 | 3300025298 | Bacteria | 20909 |
| 183 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 184 | Ga0209051_1000304 | 3300025303 | Bacteria | 77336 |
| 185 | Ga0209257_1000112 | 3300025304 | Bacteria | 234058 |
| 186 | Ga0209257_1002047 | 3300025304 | Bacteria | 21436 |
| 187 | Ga0209257_1020279 | 3300025304 | Bacteria | 2464 |
| 188 | Ga0207697_10070312 | 3300025315 | Bacteria | 1466 |
| 189 | Ga0207656_10002461 | 3300025321 | Bacteria | 6248 |
| 190 | Ga0207682_10000829 | 3300025893 | Bacteria | 14296 |
| 191 | Ga0207682_10003840 | 3300025893 | Bacteria | 6450 |
| 192 | Ga0207688_10026501 | 3300025901 | Bacteria | 3187 |
| 193 | Ga0207688_10175415 | 3300025901 | Bacteria | 1276 |
| 194 | Ga0207680_10122525 | 3300025903 | Bacteria | 1702 |
| 195 | Ga0207647_10019765 | 3300025904 | Bacteria | 4525 |
| 196 | Ga0207647_10199358 | 3300025904 | Bacteria | 1158 |
| 197 | Ga0207645_10099315 | 3300025907 | Bacteria | 1877 |
| 198 | Ga0207705_10000005 | 3300025909 | Bacteria | 673478 |
| 199 | Ga0207705_10000618 | 3300025909 | Bacteria | 29682 |
| 200 | Ga0207705_10025963 | 3300025909 | Bacteria | 4180 |
| 201 | Ga0207705_10038288 | 3300025909 | Bacteria | 3433 |
| 202 | Ga0207654_10008597 | 3300025911 | Bacteria | 5171 |
| 203 | Ga0207707_10051512 | 3300025912 | Bacteria | 3585 |
| 204 | Ga0207695_10013348 | 3300025913 | Bacteria | 9804 |
| 205 | Ga0207671_10006249 | 3300025914 | Bacteria | 10674 |
| 206 | Ga0207663_10021822 | 3300025916 | Bacteria | 3651 |
| 207 | Ga0207660_10004252 | 3300025917 | Bacteria | 9334 |
| 208 | Ga0207660_10042947 | 3300025917 | Bacteria | 3175 |
| 209 | Ga0207657_10000800 | 3300025919 | Bacteria | 33315 |
| 210 | Ga0207657_10001546 | 3300025919 | Bacteria | 24651 |
| 211 | Ga0207657_10002530 | 3300025919 | Bacteria | 19780 |
| 212 | Ga0207657_10010024 | 3300025919 | Bacteria | 9479 |
| 213 | Ga0207657_10011474 | 3300025919 | Bacteria | 8796 |
| 214 | Ga0207657_10062430 | 3300025919 | Bacteria | 3190 |
| 215 | Ga0207649_10000027 | 3300025920 | Bacteria | 161926 |
| 216 | Ga0207649_10000471 | 3300025920 | Bacteria | 28765 |
| 217 | Ga0207652_10000003 | 3300025921 | Bacteria | 502441 |
| 218 | Ga0207652_10424916 | 3300025921 | Bacteria | 1198 |
| 219 | Ga0207681_10006740 | 3300025923 | Bacteria | 7048 |
| 220 | Ga0207681_10043833 | 3300025923 | Bacteria | 2996 |
| 221 | Ga0207694_10011586 | 3300025924 | Bacteria | 6653 |
| 222 | Ga0207694_10355888 | 3300025924 | Bacteria | 1212 |
| 223 | Ga0207650_10037118 | 3300025925 | Bacteria | 3549 |
| 224 | Ga0207659_10002718 | 3300025926 | Bacteria | 10545 |
| 225 | Ga0207659_10086574 | 3300025926 | Bacteria | 2330 |
| 226 | Ga0207687_10034874 | 3300025927 | Bacteria | 3420 |
| 227 | Ga0207644_10000032 | 3300025931 | Bacteria | 133759 |
| 228 | Ga0207644_10014887 | 3300025931 | Bacteria | 5214 |
| 229 | Ga0207644_10023982 | 3300025931 | Bacteria | 4184 |
| 230 | Ga0207644_10146352 | 3300025931 | Bacteria | 1824 |
| 231 | Ga0207690_10000035 | 3300025932 | Bacteria | 149201 |
| 232 | Ga0207690_10000868 | 3300025932 | Bacteria | 19312 |
| 233 | Ga0207690_10035119 | 3300025932 | Bacteria | 3235 |
| 234 | Ga0207690_10110891 | 3300025932 | Bacteria | 1976 |
| 235 | Ga0207706_10007371 | 3300025933 | Bacteria | 10166 |
| 236 | Ga0207706_10033408 | 3300025933 | Bacteria | 4580 |
| 237 | Ga0207706_10072327 | 3300025933 | Bacteria | 3033 |
| 238 | Ga0207709_10000047 | 3300025935 | Bacteria | 238649 |
| 239 | Ga0207709_10140645 | 3300025935 | Bacteria | 1658 |
| 240 | Ga0207669_10000038 | 3300025937 | Bacteria | 74003 |
| 241 | Ga0207669_10062519 | 3300025937 | Bacteria | 2293 |
| 242 | Ga0207704_10070010 | 3300025938 | Bacteria | 2219 |
| 243 | Ga0207691_10006900 | 3300025940 | Bacteria | 10952 |
| 244 | Ga0207691_10182738 | 3300025940 | Bacteria | 1832 |
| 245 | Ga0207711_10007985 | 3300025941 | Bacteria | 8853 |
| 246 | Ga0207711_10029889 | 3300025941 | Bacteria | 4596 |
| 247 | Ga0207679_10023810 | 3300025945 | Bacteria | 4192 |
| 248 | Ga0207679_10203901 | 3300025945 | Bacteria | 1654 |
| 249 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 250 | Ga0207651_10021974 | 3300025960 | Bacteria | 3890 |
| 251 | Ga0207651_10461627 | 3300025960 | Bacteria | 1091 |
| 252 | Ga0207712_10024593 | 3300025961 | Bacteria | 3991 |
| 253 | Ga0207668_10000034 | 3300025972 | Bacteria | 119274 |
| 254 | Ga0207668_10152673 | 3300025972 | Bacteria | 1790 |
| 255 | Ga0207640_10015362 | 3300025981 | Bacteria | 4430 |
| 256 | Ga0207640_10025108 | 3300025981 | Bacteria | 3603 |
| 257 | Ga0207640_10484559 | 3300025981 | Bacteria | 1027 |
| 258 | Ga0207677_10000071 | 3300026023 | Bacteria | 84386 |
| 259 | Ga0207677_10510683 | 3300026023 | Bacteria | 1041 |
| 260 | Ga0207703_10000048 | 3300026035 | Bacteria | 151143 |
| 261 | Ga0207639_10025577 | 3300026041 | Bacteria | 4280 |
| 262 | Ga0207639_10101014 | 3300026041 | Bacteria | 2331 |
| 263 | Ga0207678_10009241 | 3300026067 | Bacteria | 8675 |
| 264 | Ga0207678_10103986 | 3300026067 | Bacteria | 2423 |
| 265 | Ga0207702_10004316 | 3300026078 | Bacteria | 12679 |
| 266 | Ga0207641_10000031 | 3300026088 | Bacteria | 224320 |
| 267 | Ga0207641_10004526 | 3300026088 | Bacteria | 12021 |
| 268 | Ga0207648_10067850 | 3300026089 | Bacteria | 3109 |
| 269 | Ga0207676_10000270 | 3300026095 | Bacteria | 44974 |
| 270 | Ga0207676_10081571 | 3300026095 | Bacteria | 2628 |
| 271 | Ga0207676_10149427 | 3300026095 | Bacteria | 2010 |
| 272 | Ga0207676_10305615 | 3300026095 | Bacteria | 1454 |
| 273 | Ga0207674_10053276 | 3300026116 | Bacteria | 4124 |
| 274 | Ga0207674_10054927 | 3300026116 | Bacteria | 4052 |
| 275 | Ga0207674_10109871 | 3300026116 | Bacteria | 2733 |
| 276 | Ga0207675_100000038 | 3300026118 | Bacteria | 93037 |
| 277 | Ga0207683_10000100 | 3300026121 | Bacteria | 71364 |
| 278 | Ga0207698_10097414 | 3300026142 | Bacteria | 2427 |
| 279 | Ga0207698_10616177 | 3300026142 | Bacteria | 1072 |
| 280 | Ga0209281_1011408 | 3300027111 | Bacteria | 1992 |
| 281 | Ga0209974_10010519 | 3300027876 | Bacteria | 3122 |
| 282 | Ga0268266_10000015 | 3300028379 | Bacteria | 630629 |
| 283 | Ga0268266_10000294 | 3300028379 | Bacteria | 81573 |
| 284 | Ga0268266_10007596 | 3300028379 | Bacteria | 9763 |
| 285 | Ga0268266_10013743 | 3300028379 | Bacteria | 6972 |
| 286 | Ga0268264_10020145 | 3300028381 | Bacteria | 5450 |
| 287 | Ga0307517_10009422 | 3300028786 | Bacteria | 13832 |
| 288 | Ga0307517_10138967 | 3300028786 | Bacteria | 1714 |
| 289 | Ga0307513_10057007 | 3300031456 | Bacteria | 4166 |
| 290 | Ga0307513_10106571 | 3300031456 | Bacteria | 2808 |
| 291 | Ga0307509_10379440 | 3300031507 | Bacteria | 1127 |
| 292 | Ga0307408_100114422 | 3300031548 | Bacteria | 2078 |
| 293 | Ga0307408_100192243 | 3300031548 | Bacteria | 1645 |
| 294 | Ga0307408_100200798 | 3300031548 | Bacteria | 1614 |
| 295 | Ga0307408_100214980 | 3300031548 | Bacteria | 1565 |
| 296 | Ga0307508_10000550 | 3300031616 | Bacteria | 44447 |
| 297 | Ga0307405_10016845 | 3300031731 | Bacteria | 3995 |
| 298 | Ga0307405_10183562 | 3300031731 | Bacteria | 1504 |
| 299 | Ga0307405_10233130 | 3300031731 | Bacteria | 1358 |
| 300 | Ga0307413_10028544 | 3300031824 | Bacteria | 3109 |
| 301 | Ga0307413_10119061 | 3300031824 | Bacteria | 1784 |
| 302 | Ga0307413_10238472 | 3300031824 | Bacteria | 1341 |
| 303 | Ga0307413_10244290 | 3300031824 | Bacteria | 1327 |
| 304 | Ga0307413_10245410 | 3300031824 | Bacteria | 1325 |
| 305 | Ga0307410_10000178 | 3300031852 | Bacteria | 23344 |
| 306 | Ga0307410_10013007 | 3300031852 | Bacteria | 4837 |
| 307 | Ga0307410_10013226 | 3300031852 | Bacteria | 4805 |
| 308 | Ga0307410_10117314 | 3300031852 | Bacteria | 1935 |
| 309 | Ga0307410_10155448 | 3300031852 | Bacteria | 1708 |
| 310 | Ga0307410_10228140 | 3300031852 | Bacteria | 1436 |
| 311 | Ga0307410_10230356 | 3300031852 | Bacteria | 1430 |
| 312 | Ga0307410_10315201 | 3300031852 | Bacteria | 1239 |
| 313 | Ga0307406_10091615 | 3300031901 | Bacteria | 2048 |
| 314 | Ga0307406_10395872 | 3300031901 | Bacteria | 1093 |
| 315 | Ga0307407_10007202 | 3300031903 | Bacteria | 5021 |
| 316 | Ga0307407_10010715 | 3300031903 | Bacteria | 4333 |
| 317 | Ga0307407_10018363 | 3300031903 | Bacteria | 3536 |
| 318 | Ga0307407_10041543 | 3300031903 | Bacteria | 2572 |
| 319 | Ga0307412_10000748 | 3300031911 | Bacteria | 18824 |
| 320 | Ga0307412_10001148 | 3300031911 | Bacteria | 15196 |
| 321 | Ga0307412_10008404 | 3300031911 | Bacteria | 5890 |
| 322 | Ga0307412_10061202 | 3300031911 | Bacteria | 2530 |
| 323 | Ga0307412_10072047 | 3300031911 | Bacteria | 2360 |
| 324 | Ga0307409_100000947 | 3300031995 | Bacteria | 13532 |
| 325 | Ga0307409_100002166 | 3300031995 | Bacteria | 10126 |
| 326 | Ga0307409_100022765 | 3300031995 | Bacteria | 4325 |
| 327 | Ga0307409_100027349 | 3300031995 | Bacteria | 4040 |
| 328 | Ga0307409_100106575 | 3300031995 | Bacteria | 2339 |
| 329 | Ga0307409_100185748 | 3300031995 | Bacteria | 1845 |
| 330 | Ga0307409_100428986 | 3300031995 | Bacteria | 1270 |
| 331 | Ga0307409_100437037 | 3300031995 | Bacteria | 1259 |
| 332 | Ga0307409_100563254 | 3300031995 | Bacteria | 1120 |
| 333 | Ga0307416_100008752 | 3300032002 | Bacteria | 6559 |
| 334 | Ga0307416_100017891 | 3300032002 | Bacteria | 4976 |
| 335 | Ga0307416_100024444 | 3300032002 | Bacteria | 4410 |
| 336 | Ga0307416_100039405 | 3300032002 | Bacteria | 3658 |
| 337 | Ga0307416_100053637 | 3300032002 | Bacteria | 3236 |
| 338 | Ga0307416_100130377 | 3300032002 | Bacteria | 2262 |
| 339 | Ga0307416_100242577 | 3300032002 | Bacteria | 1747 |
| 340 | Ga0307416_100276642 | 3300032002 | Bacteria | 1652 |
| 341 | Ga0307416_100765232 | 3300032002 | Bacteria | 1059 |
| 342 | Ga0307414_10032682 | 3300032004 | Bacteria | 3429 |
| 343 | Ga0307414_10152630 | 3300032004 | Bacteria | 1824 |
| 344 | Ga0307414_10254903 | 3300032004 | Bacteria | 1460 |
| 345 | Ga0307414_10284496 | 3300032004 | Bacteria | 1391 |
| 346 | Ga0307414_10468601 | 3300032004 | Bacteria | 1108 |
| 347 | Ga0307411_10001198 | 3300032005 | Bacteria | 10265 |
| 348 | Ga0307411_10019714 | 3300032005 | Bacteria | 3903 |
| 349 | Ga0307411_10032907 | 3300032005 | Bacteria | 3209 |
| 350 | Ga0307411_10044462 | 3300032005 | Bacteria | 2849 |
| 351 | Ga0307411_10051868 | 3300032005 | Bacteria | 2679 |
| 352 | Ga0307411_10125970 | 3300032005 | Bacteria | 1863 |
| 353 | Ga0307411_10127002 | 3300032005 | Bacteria | 1856 |
| 354 | Ga0307411_10251359 | 3300032005 | Bacteria | 1390 |
| 355 | Ga0307415_100010658 | 3300032126 | Bacteria | 5216 |
| 356 | Ga0307415_100127655 | 3300032126 | Bacteria | 1919 |
| 357 | Ga0307415_100248318 | 3300032126 | Bacteria | 1444 |
| 358 | Ga0307510_10002463 | 3300033180 | Bacteria | 21035 |
| 359 | Ga0395900_0074842 | 3300037418 | Bacteria | 3481 |
| 360 | Ga0395898_0227941 | 3300037466 | Bacteria | 1777 |
| 361 | Ga0395901_0078048 | 3300038443 | Bacteria | 3457 |
| 362 | Ga0395901_0140808 | 3300038443 | Bacteria | 2535 |
| 363 | Ga0395901_0223175 | 3300038443 | Bacteria | 1969 |
| 364 | Ga0237819_01122 | 3300038705 | Bacteria | 7796 |
| 365 | Ga0436365_0598248 | 3300039437 | Bacteria | 40283 |
| 366 | Ga0436365_1020809 | 3300039437 | Bacteria | 10139 |
| 367 | Ga0436365_1404021 | 3300039437 | Bacteria | 6837 |
| 368 | Ga0436362_0265247 | 3300039453 | Bacteria | 102026 |
| 369 | Ga0439461_0000038 | 3300041410 | Bacteria | 16271 |
| 370 | Ga0439466_0047431 | 3300041411 | Bacteria | 1416 |
| 371 | Ga0439465_0001902 | 3300041413 | Bacteria | 6836 |
| 372 | Ga0439465_0020138 | 3300041413 | Bacteria | 2087 |
| 373 | Ga0451807_0677377 | 3300041486 | Bacteria | 2187 |
| 374 | Ga0451853_0802417 | 3300041512 | Bacteria | 1910 |
| 375 | Ga0439431_0000211 | 3300041997 | Bacteria | 11608 |
| 376 | Ga0439431_0048756 | 3300041997 | Bacteria | 1094 |
| 377 | Ga0439442_000860 | 3300042002 | Bacteria | 6251 |
| 378 | Ga0439445_0000068 | 3300042004 | Bacteria | 15640 |
| 379 | Ga0439445_0002914 | 3300042004 | Bacteria | 3821 |
| 380 | Ga0439432_000877 | 3300042006 | Bacteria | 11269 |
| 381 | Ga0439432_051651 | 3300042006 | Bacteria | 1281 |
| 382 | Ga0450920_013992 | 3300042122 | Bacteria | 1514 |
| 383 | Ga0439434_0002135 | 3300042435 | Bacteria | 5723 |
| 384 | Ga0466957_0416805 | 3300044842 | Bacteria | 921 |
| 385 | Ga0495617_049090 | 3300046452 | Bacteria | 1405 |
| 386 | Ga0495627_012247 | 3300046453 | Bacteria | 3051 |
| 387 | Ga0495592_0001831 | 3300046454 | Bacteria | 14948 |
| 388 | Ga0495638_0000012 | 3300046460 | Bacteria | 435577 |
| 389 | Ga0495638_0002975 | 3300046460 | Bacteria | 13525 |
| 390 | Ga0495651_0004314 | 3300046462 | Bacteria | 10896 |
| 391 | Ga0495651_0049989 | 3300046462 | Bacteria | 3226 |
| 392 | Ga0495653_0002503 | 3300046463 | Bacteria | 14634 |
| 393 | Ga0495650_0000290 | 3300046471 | Bacteria | 93004 |
| 394 | Ga0495585_0002773 | 3300046492 | Bacteria | 12212 |
| 395 | Ga0495585_0020405 | 3300046492 | Bacteria | 3812 |
| 396 | Ga0495585_0126023 | 3300046492 | Bacteria | 1351 |
| 397 | Ga0495607_0016870 | 3300046501 | Bacteria | 4702 |
| 398 | Ga0495583_0000411 | 3300046506 | Bacteria | 65040 |
| 399 | Ga0495583_0001065 | 3300046506 | Bacteria | 30658 |
| 400 | Ga0495583_0003000 | 3300046506 | Bacteria | 13518 |
| 401 | Ga0495583_0013953 | 3300046506 | Bacteria | 4452 |
| 402 | Ga0495606_0000383 | 3300046507 | Bacteria | 75070 |
| 403 | Ga0495608_0001267 | 3300046511 | Bacteria | 17938 |
| 404 | Ga0495618_0052065 | 3300046514 | Bacteria | 2587 |
| 405 | Ga0495628_0001337 | 3300046516 | Bacteria | 22626 |
| 406 | Ga0495631_0029181 | 3300046518 | Bacteria | 2512 |
| 407 | Ga0495631_0031426 | 3300046518 | Bacteria | 2402 |
| 408 | Ga0495632_0000832 | 3300046519 | Bacteria | 27194 |
| 409 | Ga0495643_0000556 | 3300046522 | Bacteria | 46207 |
| 410 | Ga0495643_0006292 | 3300046522 | Bacteria | 7853 |
| 411 | Ga0495643_0031650 | 3300046522 | Bacteria | 2943 |
| 412 | Ga0495643_0050076 | 3300046522 | Bacteria | 2250 |
| 413 | Ga0495644_0044850 | 3300046523 | Bacteria | 1663 |
| 414 | Ga0495648_0000038 | 3300046524 | Bacteria | 191612 |
| 415 | Ga0495648_0000901 | 3300046524 | Bacteria | 31037 |
| 416 | Ga0495648_0013015 | 3300046524 | Bacteria | 6174 |
| 417 | Ga0495652_0031929 | 3300046529 | Bacteria | 4609 |
| 418 | Ga0495652_0112562 | 3300046529 | Bacteria | 2186 |
| 419 | Ga0495652_0147328 | 3300046529 | Bacteria | 1843 |
| 420 | Ga0495654_0078414 | 3300046530 | Bacteria | 1553 |
| 421 | Ga0495598_0001525 | 3300046537 | Bacteria | 4625 |
| 422 | Ga0495621_0002891 | 3300046539 | Bacteria | 4678 |
| 423 | Ga0495597_0026834 | 3300046542 | Bacteria | 2645 |
| 424 | Ga0495645_0288700 | 3300046543 | Bacteria | 1076 |
| 425 | Ga0495622_0005748 | 3300046557 | Bacteria | 5751 |
| 426 | Ga0495622_0129464 | 3300046557 | Bacteria | 1150 |
| 427 | Ga0495633_0002232 | 3300046558 | Bacteria | 13853 |
| 428 | Ga0495633_0013935 | 3300046558 | Bacteria | 4215 |
| 429 | Ga0495633_0015028 | 3300046558 | Bacteria | 4024 |
| 430 | Ga0495633_0016871 | 3300046558 | Bacteria | 3749 |
| 431 | Ga0495668_0000218 | 3300046616 | Bacteria | 83540 |
| 432 | Ga0495611_0005427 | 3300046648 | Bacteria | 5451 |
| 433 | Ga0495611_0035355 | 3300046648 | Bacteria | 2213 |
| 434 | Ga0495625_0000496 | 3300046660 | Bacteria | 58853 |
| 435 | Ga0495625_0001098 | 3300046660 | Bacteria | 35115 |
| 436 | Ga0495625_0028736 | 3300046660 | Bacteria | 4166 |
| 437 | Ga0495625_0040485 | 3300046660 | Bacteria | 3398 |
| 438 | Ga0495625_0061599 | 3300046660 | Bacteria | 2655 |
| 439 | Ga0495661_0116386 | 3300046665 | Bacteria | 1483 |
| 440 | Ga0495599_0002386 | 3300046678 | Bacteria | 10924 |
| 441 | Ga0495646_0004343 | 3300046680 | Bacteria | 8932 |
| 442 | Ga0495646_0010710 | 3300046680 | Bacteria | 5826 |
| 443 | Ga0495669_0000241 | 3300046684 | Bacteria | 32038 |
| 444 | Ga0495669_0002156 | 3300046684 | Bacteria | 8083 |
| 445 | Ga0495669_0011004 | 3300046684 | Bacteria | 3831 |
| 446 | Ga0495669_0015695 | 3300046684 | Bacteria | 3243 |
| 447 | Ga0495670_0000104 | 3300046691 | Bacteria | 37290 |
| 448 | Ga0495670_0027119 | 3300046691 | Bacteria | 2836 |
| 449 | Ga0495670_0054457 | 3300046691 | Bacteria | 2004 |
| 450 | Ga0495670_0056147 | 3300046691 | Bacteria | 1975 |
| 451 | Ga0495671_0000034 | 3300046692 | Bacteria | 195385 |
| 452 | Ga0495649_0035817 | 3300046694 | Bacteria | 2729 |
| 453 | Ga0495600_0015093 | 3300046809 | Bacteria | 4879 |
| 454 | Ga0495683_0002703 | 3300047323 | Bacteria | 10584 |
| 455 | Ga0495687_000082 | 3300047443 | Bacteria | 147137 |
| 456 | Ga0495687_000472 | 3300047443 | Bacteria | 48797 |
| 457 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 458 | Ga0495673_0050588 | 3300047469 | Bacteria | 1823 |
| 459 | Ga0495681_0002528 | 3300047470 | Bacteria | 13027 |
| 460 | Ga0495681_0039186 | 3300047470 | Bacteria | 2316 |
| 461 | Ga0495686_0000602 | 3300047472 | Bacteria | 50008 |
| 462 | Ga0495686_0099947 | 3300047472 | Bacteria | 1750 |
| 463 | Ga0495602_0063131 | 3300048088 | Bacteria | 3210 |
| 464 | Ga0496102_0000930 | 3300048905 | Bacteria | 27582 |
| 465 | Ga0496103_0001181 | 3300048906 | Bacteria | 17921 |
| 466 | Ga0496104_0003538 | 3300048907 | Bacteria | 13471 |
| 467 | Ga0496105_0001238 | 3300048908 | Bacteria | 17814 |
| 468 | Ga0496110_0005603 | 3300048913 | Bacteria | 9856 |
| 469 | Ga0496110_0016383 | 3300048913 | Bacteria | 6189 |
| 470 | Ga0496111_0001589 | 3300048914 | Bacteria | 13126 |
| 471 | Ga0496111_0025686 | 3300048914 | Bacteria | 4156 |
| 472 | Ga0496113_0552921 | 3300048916 | Bacteria | 923 |
| 473 | Ga0496115_0000339 | 3300048918 | Bacteria | 39809 |
| 474 | Ga0496115_0009842 | 3300048918 | Bacteria | 7117 |
| 475 | Ga0496116_0006574 | 3300048919 | Bacteria | 10525 |
| 476 | Ga0496116_0015362 | 3300048919 | Bacteria | 6054 |
| 477 | Ga0496116_0158836 | 3300048919 | Bacteria | 1243 |
| 478 | Ga0496117_0003623 | 3300048920 | Bacteria | 17798 |
| 479 | Ga0496118_0002640 | 3300048921 | Bacteria | 23762 |
| 480 | Ga0496118_0049413 | 3300048921 | Bacteria | 3239 |
| 481 | Ga0496118_0071311 | 3300048921 | Bacteria | 2502 |
| 482 | Ga0496119_0116690 | 3300048922 | Bacteria | 1473 |
| 483 | Ga0496120_0014422 | 3300048923 | Bacteria | 5267 |
| 484 | Ga0496120_0018434 | 3300048923 | Bacteria | 4500 |
| 485 | Ga0496121_0000128 | 3300048924 | Bacteria | 168457 |
| 486 | Ga0496121_0000200 | 3300048924 | Bacteria | 131314 |
| 487 | Ga0496121_0004809 | 3300048924 | Bacteria | 17800 |
| 488 | Ga0496122_0000021 | 3300048925 | Bacteria | 391363 |
| 489 | Ga0496122_0182792 | 3300048925 | Bacteria | 1248 |
| 490 | Ga0496123_0000382 | 3300048926 | Bacteria | 83286 |
| 491 | Ga0496123_0008086 | 3300048926 | Bacteria | 9727 |
| 492 | Ga0496123_0008374 | 3300048926 | Bacteria | 9506 |
| 493 | Ga0496123_0057905 | 3300048926 | Bacteria | 2518 |
| 494 | Ga0496123_0086142 | 3300048926 | Bacteria | 1886 |
| 495 | Ga0496124_0000761 | 3300048927 | Bacteria | 52586 |
| 496 | Ga0496124_0001474 | 3300048927 | Bacteria | 34588 |
| 497 | Ga0496124_0003074 | 3300048927 | Bacteria | 20784 |
| 498 | Ga0496124_0040880 | 3300048927 | Bacteria | 4006 |
| 499 | Ga0496124_0082792 | 3300048927 | Bacteria | 2633 |
| 500 | Ga0496125_0000005 | 3300048928 | Bacteria | 827598 |
| 501 | Ga0496125_0004606 | 3300048928 | Bacteria | 15755 |
| 502 | Ga0496125_0015489 | 3300048928 | Bacteria | 7369 |
| 503 | Ga0496126_0000467 | 3300048929 | Bacteria | 80295 |
| 504 | Ga0501290_000033 | 3300049513 | Bacteria | 18347 |
| 505 | Ga0501292_000026 | 3300049515 | Bacteria | 42153 |
| 506 | Ga0501294_001219 | 3300049517 | Bacteria | 2658 |
| 507 | Ga0501034_0143067 | 3300049571 | Bacteria | 2370 |
| 508 | Ga0501038_0050628 | 3300049574 | Bacteria | 3588 |
| 509 | Ga0501206_002038 | 3300049653 | Bacteria | 2549 |
| 510 | Ga0501222_000164 | 3300049662 | Bacteria | 13081 |
| 511 | Ga0501223_000934 | 3300049663 | Bacteria | 6908 |
| 512 | Ga0501227_021106 | 3300049665 | Bacteria | 1499 |
| 513 | Ga0501227_059446 | 3300049665 | Bacteria | 977 |
| 514 | Ga0501233_024172 | 3300049668 | Bacteria | 1327 |
| 515 | Ga0501257_000093 | 3300049686 | Bacteria | 21754 |
| 516 | Ga0501257_022339 | 3300049686 | Bacteria | 1497 |
| 517 | Ga0501261_000055 | 3300049690 | Bacteria | 21300 |
| 518 | Ga0501221_004751 | 3300049704 | Bacteria | 2255 |
| 519 | Ga0501225_0001875 | 3300049705 | Bacteria | 6601 |
| 520 | Ga0501245_000201 | 3300049708 | Bacteria | 6667 |
| 521 | Ga0501080_0108079 | 3300049742 | Bacteria | 2578 |
| 522 | Ga0501279_000066 | 3300049775 | Bacteria | 18226 |
| 523 | Ga0501280_000428 | 3300049776 | Bacteria | 10089 |
| 524 | Ga0501281_00046 | 3300049777 | Bacteria | 14598 |
| 525 | Ga0501282_001783 | 3300049778 | Bacteria | 2367 |
| 526 | Ga0501283_004254 | 3300049779 | Bacteria | 1928 |
| 527 | Ga0501044_0540519 | 3300049823 | Bacteria | 1063 |
| 528 | nmdc:mga0k408_46010_c1 | 3300050493 | Bacteria | 2519 |
| 529 | nmdc:mga07m45_247207_c1 | 3300050496 | Bacteria | 1038 |
| 530 | nmdc:mga0qj67_77037_c1 | 3300050509 | Bacteria | 2668 |
| 531 | Ga0500610_0001098 | 3300053079 | Bacteria | 8897 |
| 532 | Ga0500643_000292 | 3300053087 | Bacteria | 43095 |
| 533 | Ga0500643_001429 | 3300053087 | Bacteria | 13765 |
| 534 | Ga0500643_009896 | 3300053087 | Bacteria | 3600 |
| 535 | Ga0500643_014938 | 3300053087 | Bacteria | 2678 |
| 536 | Ga0500646_0041121 | 3300053090 | Bacteria | 1302 |
| 537 | Ga0500566_0003208 | 3300053094 | Bacteria | 9779 |
| 538 | Ga0500556_0033203 | 3300053104 | Bacteria | 1769 |
| 539 | Ga0500595_001136 | 3300053119 | Bacteria | 14745 |
| 540 | Ga0500595_002209 | 3300053119 | Bacteria | 9883 |
| 541 | Ga0500607_000007 | 3300053121 | Bacteria | 134097 |
| 542 | Ga0500658_0002518 | 3300053134 | Bacteria | 7098 |
| 543 | Ga0500658_0006669 | 3300053134 | Bacteria | 4278 |
| 544 | Ga0500658_0010916 | 3300053134 | Bacteria | 3351 |
| 545 | Ga0500559_0000693 | 3300053136 | Bacteria | 22159 |
| 546 | Ga0500559_0001181 | 3300053136 | Bacteria | 15619 |
| 547 | Ga0500559_0004787 | 3300053136 | Bacteria | 6339 |
| 548 | Ga0500559_0134924 | 3300053136 | Bacteria | 1154 |
| 549 | Ga0500568_0002185 | 3300053139 | Bacteria | 11770 |
| 550 | Ga0500573_0000030 | 3300053140 | Bacteria | 135037 |
| 551 | Ga0500590_130387 | 3300053148 | Bacteria | 1164 |
| 552 | Ga0500604_0000001 | 3300053151 | Bacteria | 174619 |
| 553 | Ga0500604_0031722 | 3300053151 | Bacteria | 1553 |
| 554 | Ga0500616_0000070 | 3300053153 | Bacteria | 232610 |
| 555 | Ga0500616_0008535 | 3300053153 | Bacteria | 6352 |
| 556 | Ga0500619_022571 | 3300053154 | Bacteria | 1828 |
| 557 | Ga0500622_0000145 | 3300053156 | Bacteria | 75417 |
| 558 | Ga0500636_0002811 | 3300053177 | Bacteria | 9719 |
| 559 | Ga0500637_0005234 | 3300053178 | Bacteria | 6263 |
| 560 | Ga0500645_000237 | 3300053730 | Bacteria | 41544 |
| 561 | Ga0500645_002010 | 3300053730 | Bacteria | 9526 |
| 562 | Ga0500596_000903 | 3300053735 | Bacteria | 5929 |
| 563 | Ga0500587_001316 | 3300053739 | Bacteria | 3486 |
| 564 | Ga0500661_008186 | 3300055283 | Bacteria | 1923 |
| 565 | Ga0587090_004550 | 3300059510 | Bacteria | 1688 |
| 566 | Ga0587094_004794 | 3300059513 | Bacteria | 1554 |
| 567 | Ga0587071_012130 | 3300060344 | Bacteria | 1466 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046660 | Ga0495625_0061599 | Ga0495625_0061599_1895_2632 | 212 |
| 2 | 3300050496 | nmdc:mga07m45_247207_c1 | nmdc:mga07m45_247207_c1_286_1023 | 215 |
| 3 | 3300048921 | Ga0496118_0071311 | Ga0496118_0071311_20_781 | 251 |
| 4 | 3300005289 | Ga0065704_10095203 | Ga0065704_100952031 | 257 |
| 5 | 3300005347 | Ga0070668_100246265 | Ga0070668_1002462652 | 257 |
| 6 | 3300025972 | Ga0207668_10152673 | Ga0207668_101526731 | 257 |
| 7 | 3300015261 | Ga0182006_1040282 | Ga0182006_10402821 | 258 |
| 8 | 3300053156 | Ga0500622_0000145 | Ga0500622_0000145_18799_19686 | 261 |
| 9 | 3300046530 | Ga0495654_0078414 | Ga0495654_0078414_518_1411 | 263 |
| 10 | 3300053087 | Ga0500643_009896 | Ga0500643_009896_2534_3427 | 263 |
| 11 | 3300002737 | JGI25162J39368_1000036 | JGI25162J39368_1000036131 | 265 |
| 12 | 3300003214 | JGI25165J46597_1000022 | JGI25165J46597_1000022228 | 265 |
| 13 | 3300003751 | Ga0055538_1000011 | Ga0055538_1000011129 | 265 |
| 14 | 3300003752 | Ga0055539_1000016 | Ga0055539_1000016228 | 265 |
| 15 | 3300003756 | Ga0055533_1000019 | Ga0055533_1000019228 | 265 |
| 16 | 3300003759 | Ga0055525_1000042 | Ga0055525_1000042131 | 265 |
| 17 | 3300003841 | Ga0055541_1000017 | Ga0055541_1000017163 | 265 |
| 18 | 3300025224 | Ga0209784_100019 | Ga0209784_100019306 | 265 |
| 19 | 3300025225 | Ga0209566_100017 | Ga0209566_100017306 | 265 |
| 20 | 3300025226 | Ga0209674_100031 | Ga0209674_100031306 | 265 |
| 21 | 3300025230 | Ga0209563_100035 | Ga0209563_100035306 | 265 |
| 22 | 3300025231 | Ga0207427_100315 | Ga0207427_10031526 | 265 |
| 23 | 3300025233 | Ga0209437_100038 | Ga0209437_100038306 | 265 |
| 24 | 3300025253 | Ga0209677_100020 | Ga0209677_100020306 | 265 |
| 25 | 3300025261 | Ga0209233_1000049 | Ga0209233_1000049306 | 265 |
| 26 | 3300005546 | Ga0070696_100122140 | Ga0070696_1001221402 | 266 |
| 27 | 3300031548 | Ga0307408_100114422 | Ga0307408_1001144222 | 267 |
| 28 | 3300031731 | Ga0307405_10183562 | Ga0307405_101835622 | 267 |
| 29 | 3300031824 | Ga0307413_10028544 | Ga0307413_100285444 | 267 |
| 30 | 3300031824 | Ga0307413_10244290 | Ga0307413_102442902 | 267 |
| 31 | 3300031852 | Ga0307410_10013226 | Ga0307410_100132262 | 267 |
| 32 | 3300031901 | Ga0307406_10091615 | Ga0307406_100916151 | 267 |
| 33 | 3300031903 | Ga0307407_10010715 | Ga0307407_100107154 | 267 |
| 34 | 3300031911 | Ga0307412_10008404 | Ga0307412_100084042 | 267 |
| 35 | 3300031995 | Ga0307409_100563254 | Ga0307409_1005632541 | 267 |
| 36 | 3300032004 | Ga0307414_10468601 | Ga0307414_104686011 | 267 |
| 37 | 3300032005 | Ga0307411_10032907 | Ga0307411_100329074 | 267 |
| 38 | 3300032126 | Ga0307415_100127655 | Ga0307415_1001276552 | 267 |
| 39 | 3300044842 | Ga0466957_0416805 | Ga0466957_0416805_74_877 | 267 |
| 40 | 3300046518 | Ga0495631_0029181 | Ga0495631_0029181_47_850 | 267 |
| 41 | 3300048926 | Ga0496123_0008374 | Ga0496123_0008374_8693_9496 | 267 |
| 42 | 3300049665 | Ga0501227_021106 | Ga0501227_021106_34_837 | 267 |
| 43 | 3300049665 | Ga0501227_059446 | Ga0501227_059446_152_955 | 267 |
| 44 | 3300049705 | Ga0501225_0001875 | Ga0501225_0001875_93_896 | 267 |
| 45 | 3300053134 | Ga0500658_0002518 | Ga0500658_0002518_6254_7057 | 267 |
| 46 | 3300015265 | Ga0182005_1000741 | Ga0182005_10007419 | 270 |
| 47 | 3300031824 | Ga0307413_10119061 | Ga0307413_101190611 | 275 |
| 48 | 3300032005 | Ga0307411_10125970 | Ga0307411_101259702 | 275 |
| 49 | 3300039437 | Ga0436365_1020809 | Ga0436365_1020809_414_1313 | 282 |
| 50 | 3300048916 | Ga0496113_0552921 | Ga0496113_0552921_48_899 | 283 |
| 51 | 3300032002 | Ga0307416_100242577 | Ga0307416_1002425772 | 285 |
| 52 | 3300053136 | Ga0500559_0000693 | Ga0500559_0000693_9157_10074 | 285 |
| 53 | 3300005327 | Ga0070658_10003103 | Ga0070658_1000310314 | 286 |
| 54 | 3300005339 | Ga0070660_100005129 | Ga0070660_1000051294 | 286 |
| 55 | 3300025919 | Ga0207657_10002530 | Ga0207657_1000253025 | 286 |
| 56 | iso_pu_bacteria | 2818991436 | 2819542504 | 286 |
| 57 | 3300005355 | Ga0070671_100078861 | Ga0070671_1000788611 | 287 |
| 58 | 3300005364 | Ga0070673_100264447 | Ga0070673_1002644471 | 287 |
| 59 | 3300005367 | Ga0070667_100157929 | Ga0070667_1001579293 | 287 |
| 60 | 3300005458 | Ga0070681_10033653 | Ga0070681_100336532 | 287 |
| 61 | 3300005530 | Ga0070679_100003301 | Ga0070679_1000033016 | 287 |
| 62 | 3300005563 | Ga0068855_100035561 | Ga0068855_1000355613 | 287 |
| 63 | 3300005983 | Ga0081540_1053900 | Ga0081540_10539003 | 287 |
| 64 | 3300006358 | Ga0068871_100275909 | Ga0068871_1002759092 | 287 |
| 65 | 3300006881 | Ga0068865_100005493 | Ga0068865_1000054933 | 287 |
| 66 | 3300009093 | Ga0105240_10796791 | Ga0105240_107967912 | 287 |
| 67 | 3300009545 | Ga0105237_10184536 | Ga0105237_101845362 | 287 |
| 68 | 3300010375 | Ga0105239_10015330 | Ga0105239_100153309 | 287 |
| 69 | 3300014325 | Ga0163163_10230617 | Ga0163163_102306173 | 287 |
| 70 | 3300014968 | Ga0157379_10122315 | Ga0157379_101223152 | 287 |
| 71 | 3300025903 | Ga0207680_10122525 | Ga0207680_101225251 | 287 |
| 72 | 3300025917 | Ga0207660_10042947 | Ga0207660_100429472 | 287 |
| 73 | 3300025921 | Ga0207652_10424916 | Ga0207652_104249162 | 287 |
| 74 | 3300025931 | Ga0207644_10146352 | Ga0207644_101463523 | 287 |
| 75 | 3300025945 | Ga0207679_10023810 | Ga0207679_100238102 | 287 |
| 76 | 3300025960 | Ga0207651_10461627 | Ga0207651_104616271 | 287 |
| 77 | 3300026095 | Ga0207676_10149427 | Ga0207676_101494271 | 287 |
| 78 | 3300005439 | Ga0070711_100033863 | Ga0070711_1000338633 | 288 |
| 79 | 3300005466 | Ga0070685_10096336 | Ga0070685_100963363 | 288 |
| 80 | 3300013296 | Ga0157374_10224964 | Ga0157374_102249642 | 288 |
| 81 | 3300013307 | Ga0157372_10613801 | Ga0157372_106138012 | 288 |
| 82 | 3300015262 | Ga0182007_10009847 | Ga0182007_100098473 | 288 |
| 83 | 3300025916 | Ga0207663_10021822 | Ga0207663_100218222 | 288 |
| 84 | 3300028379 | Ga0268266_10013743 | Ga0268266_100137435 | 288 |
| 85 | 3300031903 | Ga0307407_10007202 | Ga0307407_100072022 | 288 |
| 86 | 3300041512 | Ga0451853_0802417 | Ga0451853_0802417_837_1721 | 288 |
| 87 | 3300046454 | Ga0495592_0001831 | Ga0495592_0001831_14060_14932 | 288 |
| 88 | 3300046462 | Ga0495651_0004314 | Ga0495651_0004314_407_1291 | 288 |
| 89 | 3300046462 | Ga0495651_0049989 | Ga0495651_0049989_2133_3005 | 288 |
| 90 | 3300046463 | Ga0495653_0002503 | Ga0495653_0002503_8315_9187 | 288 |
| 91 | 3300046511 | Ga0495608_0001267 | Ga0495608_0001267_12065_12937 | 288 |
| 92 | 3300046514 | Ga0495618_0052065 | Ga0495618_0052065_550_1422 | 288 |
| 93 | 3300046516 | Ga0495628_0001337 | Ga0495628_0001337_20745_21617 | 288 |
| 94 | 3300046529 | Ga0495652_0112562 | Ga0495652_0112562_1035_1919 | 288 |
| 95 | 3300046529 | Ga0495652_0147328 | Ga0495652_0147328_188_1060 | 288 |
| 96 | 3300046543 | Ga0495645_0288700 | Ga0495645_0288700_37_921 | 288 |
| 97 | 3300046557 | Ga0495622_0129464 | Ga0495622_0129464_262_1137 | 288 |
| 98 | 3300046678 | Ga0495599_0002386 | Ga0495599_0002386_9827_10699 | 288 |
| 99 | 3300046680 | Ga0495646_0004343 | Ga0495646_0004343_504_1388 | 288 |
| 100 | 3300046680 | Ga0495646_0010710 | Ga0495646_0010710_1313_2185 | 288 |
| 101 | 3300046691 | Ga0495670_0056147 | Ga0495670_0056147_416_1315 | 288 |
| 102 | 3300048088 | Ga0495602_0063131 | Ga0495602_0063131_1926_2798 | 288 |
| 103 | 3300049574 | Ga0501038_0050628 | Ga0501038_0050628_1807_2685 | 288 |
| 104 | 3300049742 | Ga0501080_0108079 | Ga0501080_0108079_1278_2153 | 288 |
| 105 | 3300049823 | Ga0501044_0540519 | Ga0501044_0540519_124_999 | 288 |
| 106 | 3300053119 | Ga0500595_002209 | Ga0500595_002209_5463_6335 | 288 |
| 107 | 3300053154 | Ga0500619_022571 | Ga0500619_022571_337_1209 | 288 |
| 108 | 3300055283 | Ga0500661_008186 | Ga0500661_008186_255_1169 | 288 |
| 109 | 3300025901 | Ga0207688_10026501 | Ga0207688_100265014 | 289 |
| 110 | 3300003759 | Ga0055525_1000070 | Ga0055525_1000070188 | 290 |
| 111 | 3300003762 | Ga0055542_1000402 | Ga0055542_10004028 | 290 |
| 112 | 3300003763 | Ga0055529_1000439 | Ga0055529_10004398 | 290 |
| 113 | 3300003791 | Ga0055530_10026435 | Ga0055530_100264352 | 290 |
| 114 | 3300005328 | Ga0070676_10125271 | Ga0070676_101252712 | 290 |
| 115 | 3300005356 | Ga0070674_100004595 | Ga0070674_1000045956 | 290 |
| 116 | 3300006358 | Ga0068871_100007771 | Ga0068871_1000077717 | 290 |
| 117 | 3300006881 | Ga0068865_100099200 | Ga0068865_1000992002 | 290 |
| 118 | 3300009148 | Ga0105243_10001935 | Ga0105243_1000193514 | 290 |
| 119 | 3300025230 | Ga0209563_100053 | Ga0209563_1000538 | 290 |
| 120 | 3300025254 | Ga0209148_1000008 | Ga0209148_10000081387 | 290 |
| 121 | 3300025272 | Ga0209455_1000002 | Ga0209455_100000239 | 290 |
| 122 | 3300025292 | Ga0209676_1013921 | Ga0209676_10139212 | 290 |
| 123 | 3300025298 | Ga0209050_1001812 | Ga0209050_100181221 | 290 |
| 124 | 3300025907 | Ga0207645_10099315 | Ga0207645_100993153 | 290 |
| 125 | 3300025935 | Ga0207709_10000047 | Ga0207709_10000047232 | 290 |
| 126 | 3300025937 | Ga0207669_10000038 | Ga0207669_1000003885 | 290 |
| 127 | 3300025938 | Ga0207704_10070010 | Ga0207704_100700103 | 290 |
| 128 | 3300025960 | Ga0207651_10021974 | Ga0207651_100219744 | 290 |
| 129 | 3300026089 | Ga0207648_10067850 | Ga0207648_100678502 | 290 |
| 130 | 3300026121 | Ga0207683_10000100 | Ga0207683_1000010080 | 290 |
| 131 | 3300028786 | Ga0307517_10138967 | Ga0307517_101389673 | 290 |
| 132 | 3300031456 | Ga0307513_10057007 | Ga0307513_100570073 | 290 |
| 133 | 3300031911 | Ga0307412_10000748 | Ga0307412_100007483 | 290 |
| 134 | 3300046471 | Ga0495650_0000290 | Ga0495650_0000290_2235_3137 | 290 |
| 135 | 3300046557 | Ga0495622_0005748 | Ga0495622_0005748_4681_5583 | 290 |
| 136 | 3300046809 | Ga0495600_0015093 | Ga0495600_0015093_1439_2341 | 290 |
| 137 | 3300048919 | Ga0496116_0015362 | Ga0496116_0015362_4498_5403 | 290 |
| 138 | 3300048919 | Ga0496116_0158836 | Ga0496116_0158836_248_1153 | 290 |
| 139 | 3300048921 | Ga0496118_0049413 | Ga0496118_0049413_2048_2953 | 290 |
| 140 | 3300048922 | Ga0496119_0116690 | Ga0496119_0116690_260_1165 | 290 |
| 141 | 3300048923 | Ga0496120_0014422 | Ga0496120_0014422_853_1758 | 290 |
| 142 | 3300048924 | Ga0496121_0000200 | Ga0496121_0000200_26927_27832 | 290 |
| 143 | 3300048925 | Ga0496122_0000021 | Ga0496122_0000021_115915_116820 | 290 |
| 144 | 3300048926 | Ga0496123_0000382 | Ga0496123_0000382_62033_62938 | 290 |
| 145 | 3300048927 | Ga0496124_0082792 | Ga0496124_0082792_653_1558 | 290 |
| 146 | 3300048928 | Ga0496125_0000005 | Ga0496125_0000005_388310_389215 | 290 |
| 147 | 3300048928 | Ga0496125_0015489 | Ga0496125_0015489_6118_7023 | 290 |
| 148 | 3300053119 | Ga0500595_001136 | Ga0500595_001136_9154_10056 | 290 |
| 149 | 3300053735 | Ga0500596_000903 | Ga0500596_000903_2276_3178 | 290 |
| 150 | iso_pu_bacteria | 2599185292 | 2599902264 | 290 |
| 151 | iso_pu_bacteria | 2643221569 | 2643859654 | 290 |
| 152 | iso_pu_bacteria | 2643221594 | 2643978953 | 290 |
| 153 | iso_pu_bacteria | 2643221621 | 2644120398 | 290 |
| 154 | iso_pu_bacteria | 2808606395 | 2809036290 | 290 |
| 155 | iso_pu_bacteria | 2857537821 | 2857541367 | 290 |
| 156 | iso_pu_bacteria | 2858950400 | 2858951683 | 290 |
| 157 | iso_pu_bacteria | 2941479691 | 2941483168 | 290 |
| 158 | 3300003215 | JGI25153J46596_10048176 | JGI25153J46596_100481761 | 291 |
| 159 | 3300003773 | Ga0055537_1001707 | Ga0055537_10017078 | 291 |
| 160 | 3300003775 | Ga0055524_1000226 | Ga0055524_100022626 | 291 |
| 161 | 3300003794 | Ga0055531_10007290 | Ga0055531_100072903 | 291 |
| 162 | 3300005262 | Ga0065165_1012591 | Ga0065165_10125912 | 291 |
| 163 | 3300005564 | Ga0070664_100240533 | Ga0070664_1002405332 | 291 |
| 164 | 3300009177 | Ga0105248_10143362 | Ga0105248_101433623 | 291 |
| 165 | 3300025245 | Ga0207425_1015084 | Ga0207425_10150842 | 291 |
| 166 | 3300025263 | Ga0209565_1000007 | Ga0209565_1000007233 | 291 |
| 167 | 3300025273 | Ga0209673_1001068 | Ga0209673_100106827 | 291 |
| 168 | 3300025291 | Ga0209675_1006849 | Ga0209675_10068492 | 291 |
| 169 | 3300025299 | Ga0209256_1000008 | Ga0209256_100000875 | 291 |
| 170 | 3300025304 | Ga0209257_1002047 | Ga0209257_100204713 | 291 |
| 171 | 3300025931 | Ga0207644_10023982 | Ga0207644_100239825 | 291 |
| 172 | 3300025933 | Ga0207706_10033408 | Ga0207706_100334086 | 291 |
| 173 | 3300026095 | Ga0207676_10305615 | Ga0207676_103056151 | 291 |
| 174 | iso_pu_bacteria | 2855730933 | 2855731537 | 291 |
| 175 | iso_pu_bacteria | 2855767633 | 2855768243 | 291 |
| 176 | iso_pu_bacteria | 2881412998 | 2881413587 | 291 |
| 177 | 3300005366 | Ga0070659_100286137 | Ga0070659_1002861372 | 292 |
| 178 | 3300031731 | Ga0307405_10016845 | Ga0307405_100168457 | 293 |
| 179 | 3300031901 | Ga0307406_10395872 | Ga0307406_103958722 | 293 |
| 180 | 3300031911 | Ga0307412_10061202 | Ga0307412_100612023 | 293 |
| 181 | 3300031995 | Ga0307409_100185748 | Ga0307409_1001857482 | 293 |
| 182 | 3300031995 | Ga0307409_100437037 | Ga0307409_1004370372 | 293 |
| 183 | 3300032002 | Ga0307416_100024444 | Ga0307416_1000244442 | 293 |
| 184 | 3300032002 | Ga0307416_100053637 | Ga0307416_1000536374 | 293 |
| 185 | 3300032004 | Ga0307414_10254903 | Ga0307414_102549031 | 293 |
| 186 | 3300046684 | Ga0495669_0011004 | Ga0495669_0011004_695_1576 | 293 |
| 187 | 3300049668 | Ga0501233_024172 | Ga0501233_024172_97_978 | 293 |
| 188 | 3300027111 | Ga0209281_1011408 | Ga0209281_10114082 | 295 |
| 189 | 3300053121 | Ga0500607_000007 | Ga0500607_000007_116300_117217 | 295 |
| 190 | 3300053136 | Ga0500559_0001181 | Ga0500559_0001181_8898_9815 | 295 |
| 191 | 3300053148 | Ga0500590_130387 | Ga0500590_130387_152_1069 | 295 |
| 192 | 3300053178 | Ga0500637_0005234 | Ga0500637_0005234_1127_2044 | 295 |
| 193 | 3300053730 | Ga0500645_002010 | Ga0500645_002010_6575_7492 | 295 |
| 194 | iso_pu_bacteria | 2599185354 | 2600202790 | 295 |
| 195 | iso_pu_bacteria | 2599185359 | 2600228266 | 295 |
| 196 | iso_pu_bacteria | 2643221622 | 2644125699 | 295 |
| 197 | iso_pu_bacteria | 2751185897 | 2753767137 | 295 |
| 198 | iso_pu_bacteria | 2818991466 | 2819716312 | 295 |
| 199 | iso_pu_bacteria | 2830075706 | 2830079118 | 295 |
| 200 | iso_pu_bacteria | 2879163058 | 2879165358 | 295 |
| 201 | iso_pu_bacteria | 2885429604 | 2885430999 | 295 |
| 202 | iso_pu_bacteria | 2928526807 | 2928528885 | 295 |
| 203 | iso_pu_bacteria | 2928968154 | 2928970436 | 295 |
| 204 | iso_pu_bacteria | 2946787523 | 2946789968 | 295 |
| 205 | 3300005262 | Ga0065165_1023529 | Ga0065165_10235292 | 296 |
| 206 | 3300025909 | Ga0207705_10025963 | Ga0207705_100259634 | 296 |
| 207 | 3300026067 | Ga0207678_10103986 | Ga0207678_101039861 | 296 |
| 208 | 3300037466 | Ga0395898_0227941 | Ga0395898_0227941_196_1092 | 296 |
| 209 | 3300038443 | Ga0395901_0223175 | Ga0395901_0223175_31_927 | 296 |
| 210 | 2162886011 | MRS1b_contig_299100 | MRS1b_0022.00001440 | 297 |
| 211 | 3300001915 | JGI24741J21665_1001690 | JGI24741J21665_10016908 | 297 |
| 212 | 3300001979 | JGI24740J21852_10004410 | JGI24740J21852_100044108 | 297 |
| 213 | 3300001989 | JGI24739J22299_10011758 | JGI24739J22299_100117583 | 297 |
| 214 | 3300001990 | JGI24737J22298_10004273 | JGI24737J22298_100042737 | 297 |
| 215 | 3300001990 | JGI24737J22298_10028180 | JGI24737J22298_100281803 | 297 |
| 216 | 3300002774 | JGI25150J39212_1000081 | JGI25150J39212_100008128 | 297 |
| 217 | 3300003214 | JGI25165J46597_1000138 | JGI25165J46597_100013816 | 297 |
| 218 | 3300003215 | JGI25153J46596_10000080 | JGI25153J46596_1000008019 | 297 |
| 219 | 3300003215 | JGI25153J46596_10000112 | JGI25153J46596_1000011241 | 297 |
| 220 | 3300003771 | Ga0055526_1001589 | Ga0055526_100158914 | 297 |
| 221 | 3300003791 | Ga0055530_10000049 | Ga0055530_1000004991 | 297 |
| 222 | 3300003791 | Ga0055530_10000073 | Ga0055530_1000007360 | 297 |
| 223 | 3300003792 | Ga0055540_1000940 | Ga0055540_100094010 | 297 |
| 224 | 3300003794 | Ga0055531_10000017 | Ga0055531_10000017159 | 297 |
| 225 | 3300004625 | Ga0055543_1027234 | Ga0055543_10272341 | 297 |
| 226 | 3300005262 | Ga0065165_1003945 | Ga0065165_100394510 | 297 |
| 227 | 3300005262 | Ga0065165_1006038 | Ga0065165_10060384 | 297 |
| 228 | 3300005290 | Ga0065712_10071677 | Ga0065712_100716773 | 297 |
| 229 | 3300005290 | Ga0065712_10154066 | Ga0065712_101540662 | 297 |
| 230 | 3300005293 | Ga0065715_10130889 | Ga0065715_101308893 | 297 |
| 231 | 3300005327 | Ga0070658_10000209 | Ga0070658_1000020939 | 297 |
| 232 | 3300005329 | Ga0070683_100322930 | Ga0070683_1003229301 | 297 |
| 233 | 3300005331 | Ga0070670_100001575 | Ga0070670_10000157511 | 297 |
| 234 | 3300005333 | Ga0070677_10001952 | Ga0070677_100019525 | 297 |
| 235 | 3300005336 | Ga0070680_100029357 | Ga0070680_1000293572 | 297 |
| 236 | 3300005338 | Ga0068868_100000020 | Ga0068868_10000002051 | 297 |
| 237 | 3300005339 | Ga0070660_100000381 | Ga0070660_10000038113 | 297 |
| 238 | 3300005339 | Ga0070660_100000567 | Ga0070660_10000056717 | 297 |
| 239 | 3300005339 | Ga0070660_100002485 | Ga0070660_1000024854 | 297 |
| 240 | 3300005339 | Ga0070660_100058373 | Ga0070660_1000583733 | 297 |
| 241 | 3300005339 | Ga0070660_100131205 | Ga0070660_1001312052 | 297 |
| 242 | 3300005339 | Ga0070660_100141087 | Ga0070660_1001410872 | 297 |
| 243 | 3300005344 | Ga0070661_100000764 | Ga0070661_10000076412 | 297 |
| 244 | 3300005344 | Ga0070661_100018324 | Ga0070661_1000183241 | 297 |
| 245 | 3300005345 | Ga0070692_10020062 | Ga0070692_100200622 | 297 |
| 246 | 3300005353 | Ga0070669_100053605 | Ga0070669_1000536052 | 297 |
| 247 | 3300005353 | Ga0070669_100089304 | Ga0070669_1000893042 | 297 |
| 248 | 3300005354 | Ga0070675_100002279 | Ga0070675_1000022799 | 297 |
| 249 | 3300005354 | Ga0070675_100006097 | Ga0070675_1000060974 | 297 |
| 250 | 3300005354 | Ga0070675_100075309 | Ga0070675_1000753092 | 297 |
| 251 | 3300005354 | Ga0070675_100082466 | Ga0070675_1000824662 | 297 |
| 252 | 3300005355 | Ga0070671_100009594 | Ga0070671_1000095949 | 297 |
| 253 | 3300005355 | Ga0070671_100010401 | Ga0070671_1000104015 | 297 |
| 254 | 3300005355 | Ga0070671_100066255 | Ga0070671_1000662553 | 297 |
| 255 | 3300005356 | Ga0070674_100035505 | Ga0070674_1000355054 | 297 |
| 256 | 3300005364 | Ga0070673_100007210 | Ga0070673_1000072105 | 297 |
| 257 | 3300005366 | Ga0070659_100000017 | Ga0070659_10000001794 | 297 |
| 258 | 3300005366 | Ga0070659_100119248 | Ga0070659_1001192481 | 297 |
| 259 | 3300005367 | Ga0070667_100009793 | Ga0070667_1000097933 | 297 |
| 260 | 3300005367 | Ga0070667_100085908 | Ga0070667_1000859082 | 297 |
| 261 | 3300005367 | Ga0070667_100359883 | Ga0070667_1003598832 | 297 |
| 262 | 3300005455 | Ga0070663_100015279 | Ga0070663_1000152794 | 297 |
| 263 | 3300005458 | Ga0070681_10067145 | Ga0070681_100671455 | 297 |
| 264 | 3300005530 | Ga0070679_100000001 | Ga0070679_100000001474 | 297 |
| 265 | 3300005543 | Ga0070672_100120811 | Ga0070672_1001208112 | 297 |
| 266 | 3300005544 | Ga0070686_100000056 | Ga0070686_10000005667 | 297 |
| 267 | 3300005548 | Ga0070665_100000021 | Ga0070665_100000021395 | 297 |
| 268 | 3300005548 | Ga0070665_100000497 | Ga0070665_10000049753 | 297 |
| 269 | 3300005548 | Ga0070665_100101657 | Ga0070665_1001016572 | 297 |
| 270 | 3300005548 | Ga0070665_100185476 | Ga0070665_1001854763 | 297 |
| 271 | 3300005563 | Ga0068855_100147957 | Ga0068855_1001479572 | 297 |
| 272 | 3300005564 | Ga0070664_100004202 | Ga0070664_1000042027 | 297 |
| 273 | 3300005564 | Ga0070664_100063823 | Ga0070664_1000638233 | 297 |
| 274 | 3300005577 | Ga0068857_100009009 | Ga0068857_1000090093 | 297 |
| 275 | 3300005578 | Ga0068854_100034554 | Ga0068854_1000345544 | 297 |
| 276 | 3300005578 | Ga0068854_100366004 | Ga0068854_1003660041 | 297 |
| 277 | 3300005616 | Ga0068852_100533106 | Ga0068852_1005331061 | 297 |
| 278 | 3300005617 | Ga0068859_100015698 | Ga0068859_1000156982 | 297 |
| 279 | 3300005618 | Ga0068864_100000870 | Ga0068864_10000087023 | 297 |
| 280 | 3300005618 | Ga0068864_100134875 | Ga0068864_1001348752 | 297 |
| 281 | 3300005719 | Ga0068861_100000271 | Ga0068861_10000027112 | 297 |
| 282 | 3300005834 | Ga0068851_10010027 | Ga0068851_100100273 | 297 |
| 283 | 3300005841 | Ga0068863_100000186 | Ga0068863_10000018671 | 297 |
| 284 | 3300005841 | Ga0068863_100025592 | Ga0068863_1000255925 | 297 |
| 285 | 3300005842 | Ga0068858_100000022 | Ga0068858_100000022137 | 297 |
| 286 | 3300005842 | Ga0068858_100000318 | Ga0068858_10000031837 | 297 |
| 287 | 3300005985 | Ga0081539_10026431 | Ga0081539_100264312 | 297 |
| 288 | 3300006195 | Ga0075366_10038523 | Ga0075366_100385234 | 297 |
| 289 | 3300006846 | Ga0075430_100256079 | Ga0075430_1002560792 | 297 |
| 290 | 3300006931 | Ga0097620_100015698 | Ga0097620_1000156982 | 297 |
| 291 | 3300009098 | Ga0105245_10001471 | Ga0105245_100014715 | 297 |
| 292 | 3300009098 | Ga0105245_10076742 | Ga0105245_100767424 | 297 |
| 293 | 3300009148 | Ga0105243_10134584 | Ga0105243_101345843 | 297 |
| 294 | 3300009174 | Ga0105241_10010947 | Ga0105241_100109475 | 297 |
| 295 | 3300009177 | Ga0105248_10003753 | Ga0105248_1000375312 | 297 |
| 296 | 3300009177 | Ga0105248_10052245 | Ga0105248_100522454 | 297 |
| 297 | 3300009177 | Ga0105248_10067604 | Ga0105248_100676043 | 297 |
| 298 | 3300009545 | Ga0105237_10014154 | Ga0105237_100141543 | 297 |
| 299 | 3300009551 | Ga0105238_10009972 | Ga0105238_1000997211 | 297 |
| 300 | 3300009553 | Ga0105249_10011955 | Ga0105249_100119558 | 297 |
| 301 | 3300013100 | Ga0157373_10138777 | Ga0157373_101387772 | 297 |
| 302 | 3300013102 | Ga0157371_10000066 | Ga0157371_10000066146 | 297 |
| 303 | 3300013104 | Ga0157370_10042974 | Ga0157370_100429748 | 297 |
| 304 | 3300013105 | Ga0157369_10005411 | Ga0157369_1000541114 | 297 |
| 305 | 3300013306 | Ga0163162_10001728 | Ga0163162_1000172816 | 297 |
| 306 | 3300014968 | Ga0157379_10128443 | Ga0157379_101284432 | 297 |
| 307 | 3300020082 | Ga0206353_10341789 | Ga0206353_103417895 | 297 |
| 308 | 3300021358 | Ga0213873_10000023 | Ga0213873_1000002372 | 297 |
| 309 | 3300021384 | Ga0213876_10000091 | Ga0213876_1000009128 | 297 |
| 310 | 3300025245 | Ga0207425_1000019 | Ga0207425_1000019254 | 297 |
| 311 | 3300025250 | Ga0209026_1009440 | Ga0209026_10094403 | 297 |
| 312 | 3300025258 | Ga0209129_1000951 | Ga0209129_100095113 | 297 |
| 313 | 3300025261 | Ga0209233_1000182 | Ga0209233_100018226 | 297 |
| 314 | 3300025263 | Ga0209565_1000089 | Ga0209565_1000089124 | 297 |
| 315 | 3300025263 | Ga0209565_1008886 | Ga0209565_10088863 | 297 |
| 316 | 3300025272 | Ga0209455_1007590 | Ga0209455_10075904 | 297 |
| 317 | 3300025292 | Ga0209676_1008871 | Ga0209676_10088716 | 297 |
| 318 | 3300025294 | Ga0209025_1000268 | Ga0209025_100026885 | 297 |
| 319 | 3300025295 | Ga0209564_1001376 | Ga0209564_100137616 | 297 |
| 320 | 3300025297 | Ga0209758_1000019 | Ga0209758_1000019333 | 297 |
| 321 | 3300025297 | Ga0209758_1000023 | Ga0209758_1000023321 | 297 |
| 322 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000011420 | 297 |
| 323 | 3300025298 | Ga0209050_1000102 | Ga0209050_1000102158 | 297 |
| 324 | 3300025303 | Ga0209051_1000304 | Ga0209051_100030450 | 297 |
| 325 | 3300025304 | Ga0209257_1000112 | Ga0209257_1000112158 | 297 |
| 326 | 3300025304 | Ga0209257_1020279 | Ga0209257_10202792 | 297 |
| 327 | 3300025315 | Ga0207697_10070312 | Ga0207697_100703123 | 297 |
| 328 | 3300025321 | Ga0207656_10002461 | Ga0207656_100024619 | 297 |
| 329 | 3300025893 | Ga0207682_10000829 | Ga0207682_1000082912 | 297 |
| 330 | 3300025893 | Ga0207682_10003840 | Ga0207682_100038407 | 297 |
| 331 | 3300025901 | Ga0207688_10175415 | Ga0207688_101754152 | 297 |
| 332 | 3300025904 | Ga0207647_10019765 | Ga0207647_100197655 | 297 |
| 333 | 3300025904 | Ga0207647_10199358 | Ga0207647_101993582 | 297 |
| 334 | 3300025909 | Ga0207705_10000005 | Ga0207705_10000005558 | 297 |
| 335 | 3300025909 | Ga0207705_10000618 | Ga0207705_100006185 | 297 |
| 336 | 3300025909 | Ga0207705_10038288 | Ga0207705_100382882 | 297 |
| 337 | 3300025911 | Ga0207654_10008597 | Ga0207654_100085976 | 297 |
| 338 | 3300025912 | Ga0207707_10051512 | Ga0207707_100515122 | 297 |
| 339 | 3300025913 | Ga0207695_10013348 | Ga0207695_100133484 | 297 |
| 340 | 3300025914 | Ga0207671_10006249 | Ga0207671_100062498 | 297 |
| 341 | 3300025917 | Ga0207660_10004252 | Ga0207660_1000425210 | 297 |
| 342 | 3300025919 | Ga0207657_10000800 | Ga0207657_100008002 | 297 |
| 343 | 3300025919 | Ga0207657_10001546 | Ga0207657_100015463 | 297 |
| 344 | 3300025919 | Ga0207657_10010024 | Ga0207657_100100242 | 297 |
| 345 | 3300025919 | Ga0207657_10011474 | Ga0207657_100114749 | 297 |
| 346 | 3300025919 | Ga0207657_10062430 | Ga0207657_100624302 | 297 |
| 347 | 3300025920 | Ga0207649_10000027 | Ga0207649_1000002744 | 297 |
| 348 | 3300025920 | Ga0207649_10000471 | Ga0207649_100004714 | 297 |
| 349 | 3300025921 | Ga0207652_10000003 | Ga0207652_1000000371 | 297 |
| 350 | 3300025923 | Ga0207681_10006740 | Ga0207681_100067406 | 297 |
| 351 | 3300025923 | Ga0207681_10043833 | Ga0207681_100438333 | 297 |
| 352 | 3300025924 | Ga0207694_10011586 | Ga0207694_100115869 | 297 |
| 353 | 3300025924 | Ga0207694_10355888 | Ga0207694_103558882 | 297 |
| 354 | 3300025925 | Ga0207650_10037118 | Ga0207650_100371184 | 297 |
| 355 | 3300025926 | Ga0207659_10002718 | Ga0207659_100027189 | 297 |
| 356 | 3300025926 | Ga0207659_10086574 | Ga0207659_100865743 | 297 |
| 357 | 3300025927 | Ga0207687_10034874 | Ga0207687_100348745 | 297 |
| 358 | 3300025931 | Ga0207644_10000032 | Ga0207644_1000003273 | 297 |
| 359 | 3300025931 | Ga0207644_10014887 | Ga0207644_100148874 | 297 |
| 360 | 3300025932 | Ga0207690_10000035 | Ga0207690_1000003598 | 297 |
| 361 | 3300025932 | Ga0207690_10000868 | Ga0207690_1000086813 | 297 |
| 362 | 3300025932 | Ga0207690_10035119 | Ga0207690_100351192 | 297 |
| 363 | 3300025932 | Ga0207690_10110891 | Ga0207690_101108912 | 297 |
| 364 | 3300025933 | Ga0207706_10007371 | Ga0207706_100073712 | 297 |
| 365 | 3300025933 | Ga0207706_10072327 | Ga0207706_100723272 | 297 |
| 366 | 3300025935 | Ga0207709_10140645 | Ga0207709_101406452 | 297 |
| 367 | 3300025937 | Ga0207669_10062519 | Ga0207669_100625192 | 297 |
| 368 | 3300025940 | Ga0207691_10006900 | Ga0207691_1000690012 | 297 |
| 369 | 3300025940 | Ga0207691_10182738 | Ga0207691_101827382 | 297 |
| 370 | 3300025941 | Ga0207711_10007985 | Ga0207711_1000798510 | 297 |
| 371 | 3300025941 | Ga0207711_10029889 | Ga0207711_100298894 | 297 |
| 372 | 3300025945 | Ga0207679_10203901 | Ga0207679_102039011 | 297 |
| 373 | 3300025949 | Ga0207667_10000001 | Ga0207667_10000001179 | 297 |
| 374 | 3300025961 | Ga0207712_10024593 | Ga0207712_100245934 | 297 |
| 375 | 3300025972 | Ga0207668_10000034 | Ga0207668_1000003470 | 297 |
| 376 | 3300025981 | Ga0207640_10015362 | Ga0207640_100153623 | 297 |
| 377 | 3300025981 | Ga0207640_10025108 | Ga0207640_100251084 | 297 |
| 378 | 3300025981 | Ga0207640_10484559 | Ga0207640_104845591 | 297 |
| 379 | 3300026023 | Ga0207677_10000071 | Ga0207677_100000719 | 297 |
| 380 | 3300026023 | Ga0207677_10510683 | Ga0207677_105106831 | 297 |
| 381 | 3300026035 | Ga0207703_10000048 | Ga0207703_1000004876 | 297 |
| 382 | 3300026041 | Ga0207639_10025577 | Ga0207639_100255772 | 297 |
| 383 | 3300026041 | Ga0207639_10101014 | Ga0207639_101010142 | 297 |
| 384 | 3300026067 | Ga0207678_10009241 | Ga0207678_100092414 | 297 |
| 385 | 3300026078 | Ga0207702_10004316 | Ga0207702_1000431615 | 297 |
| 386 | 3300026088 | Ga0207641_10000031 | Ga0207641_10000031158 | 297 |
| 387 | 3300026088 | Ga0207641_10004526 | Ga0207641_100045266 | 297 |
| 388 | 3300026095 | Ga0207676_10000270 | Ga0207676_1000027012 | 297 |
| 389 | 3300026095 | Ga0207676_10081571 | Ga0207676_100815713 | 297 |
| 390 | 3300026116 | Ga0207674_10053276 | Ga0207674_100532763 | 297 |
| 391 | 3300026116 | Ga0207674_10054927 | Ga0207674_100549275 | 297 |
| 392 | 3300026116 | Ga0207674_10109871 | Ga0207674_101098713 | 297 |
| 393 | 3300026118 | Ga0207675_100000038 | Ga0207675_10000003878 | 297 |
| 394 | 3300026142 | Ga0207698_10097414 | Ga0207698_100974142 | 297 |
| 395 | 3300026142 | Ga0207698_10616177 | Ga0207698_106161772 | 297 |
| 396 | 3300027876 | Ga0209974_10010519 | Ga0209974_100105191 | 297 |
| 397 | 3300028379 | Ga0268266_10000015 | Ga0268266_1000001559 | 297 |
| 398 | 3300028379 | Ga0268266_10000294 | Ga0268266_1000029423 | 297 |
| 399 | 3300028379 | Ga0268266_10007596 | Ga0268266_100075964 | 297 |
| 400 | 3300028381 | Ga0268264_10020145 | Ga0268264_100201454 | 297 |
| 401 | 3300028786 | Ga0307517_10009422 | Ga0307517_1000942212 | 297 |
| 402 | 3300031456 | Ga0307513_10106571 | Ga0307513_101065712 | 297 |
| 403 | 3300031507 | Ga0307509_10379440 | Ga0307509_103794402 | 297 |
| 404 | 3300031548 | Ga0307408_100192243 | Ga0307408_1001922432 | 297 |
| 405 | 3300031548 | Ga0307408_100200798 | Ga0307408_1002007982 | 297 |
| 406 | 3300031548 | Ga0307408_100214980 | Ga0307408_1002149802 | 297 |
| 407 | 3300031616 | Ga0307508_10000550 | Ga0307508_1000055028 | 297 |
| 408 | 3300031731 | Ga0307405_10233130 | Ga0307405_102331302 | 297 |
| 409 | 3300031824 | Ga0307413_10238472 | Ga0307413_102384721 | 297 |
| 410 | 3300031824 | Ga0307413_10245410 | Ga0307413_102454102 | 297 |
| 411 | 3300031852 | Ga0307410_10000178 | Ga0307410_100001786 | 297 |
| 412 | 3300031852 | Ga0307410_10013007 | Ga0307410_100130073 | 297 |
| 413 | 3300031852 | Ga0307410_10117314 | Ga0307410_101173143 | 297 |
| 414 | 3300031852 | Ga0307410_10155448 | Ga0307410_101554482 | 297 |
| 415 | 3300031852 | Ga0307410_10228140 | Ga0307410_102281402 | 297 |
| 416 | 3300031852 | Ga0307410_10230356 | Ga0307410_102303563 | 297 |
| 417 | 3300031852 | Ga0307410_10315201 | Ga0307410_103152011 | 297 |
| 418 | 3300031903 | Ga0307407_10018363 | Ga0307407_100183633 | 297 |
| 419 | 3300031903 | Ga0307407_10041543 | Ga0307407_100415434 | 297 |
| 420 | 3300031911 | Ga0307412_10001148 | Ga0307412_100011482 | 297 |
| 421 | 3300031911 | Ga0307412_10072047 | Ga0307412_100720474 | 297 |
| 422 | 3300031995 | Ga0307409_100000947 | Ga0307409_1000009475 | 297 |
| 423 | 3300031995 | Ga0307409_100002166 | Ga0307409_1000021662 | 297 |
| 424 | 3300031995 | Ga0307409_100022765 | Ga0307409_1000227656 | 297 |
| 425 | 3300031995 | Ga0307409_100027349 | Ga0307409_1000273494 | 297 |
| 426 | 3300031995 | Ga0307409_100106575 | Ga0307409_1001065752 | 297 |
| 427 | 3300031995 | Ga0307409_100428986 | Ga0307409_1004289861 | 297 |
| 428 | 3300032002 | Ga0307416_100008752 | Ga0307416_1000087525 | 297 |
| 429 | 3300032002 | Ga0307416_100017891 | Ga0307416_1000178913 | 297 |
| 430 | 3300032002 | Ga0307416_100039405 | Ga0307416_1000394055 | 297 |
| 431 | 3300032002 | Ga0307416_100130377 | Ga0307416_1001303771 | 297 |
| 432 | 3300032002 | Ga0307416_100276642 | Ga0307416_1002766422 | 297 |
| 433 | 3300032002 | Ga0307416_100765232 | Ga0307416_1007652321 | 297 |
| 434 | 3300032004 | Ga0307414_10032682 | Ga0307414_100326822 | 297 |
| 435 | 3300032004 | Ga0307414_10152630 | Ga0307414_101526302 | 297 |
| 436 | 3300032004 | Ga0307414_10284496 | Ga0307414_102844962 | 297 |
| 437 | 3300032005 | Ga0307411_10001198 | Ga0307411_100011982 | 297 |
| 438 | 3300032005 | Ga0307411_10019714 | Ga0307411_100197142 | 297 |
| 439 | 3300032005 | Ga0307411_10044462 | Ga0307411_100444622 | 297 |
| 440 | 3300032005 | Ga0307411_10051868 | Ga0307411_100518683 | 297 |
| 441 | 3300032005 | Ga0307411_10127002 | Ga0307411_101270022 | 297 |
| 442 | 3300032005 | Ga0307411_10251359 | Ga0307411_102513592 | 297 |
| 443 | 3300032126 | Ga0307415_100010658 | Ga0307415_1000106585 | 297 |
| 444 | 3300032126 | Ga0307415_100248318 | Ga0307415_1002483182 | 297 |
| 445 | 3300033180 | Ga0307510_10002463 | Ga0307510_100024637 | 297 |
| 446 | 3300037418 | Ga0395900_0074842 | Ga0395900_0074842_767_1666 | 297 |
| 447 | 3300038443 | Ga0395901_0078048 | Ga0395901_0078048_2410_3309 | 297 |
| 448 | 3300038443 | Ga0395901_0140808 | Ga0395901_0140808_310_1212 | 297 |
| 449 | 3300038705 | Ga0237819_01122 | Ga0237819_01122_5672_6571 | 297 |
| 450 | 3300039437 | Ga0436365_0598248 | Ga0436365_0598248_31114_32016 | 297 |
| 451 | 3300039437 | Ga0436365_1404021 | Ga0436365_1404021_589_1491 | 297 |
| 452 | 3300039453 | Ga0436362_0265247 | Ga0436362_0265247_30591_31493 | 297 |
| 453 | 3300041410 | Ga0439461_0000038 | Ga0439461_0000038_7771_8670 | 297 |
| 454 | 3300041411 | Ga0439466_0047431 | Ga0439466_0047431_190_1089 | 297 |
| 455 | 3300041413 | Ga0439465_0001902 | Ga0439465_0001902_21_1010 | 297 |
| 456 | 3300041413 | Ga0439465_0020138 | Ga0439465_0020138_200_1099 | 297 |
| 457 | 3300041486 | Ga0451807_0677377 | Ga0451807_0677377_467_1369 | 297 |
| 458 | 3300041997 | Ga0439431_0000211 | Ga0439431_0000211_7784_8683 | 297 |
| 459 | 3300041997 | Ga0439431_0048756 | Ga0439431_0048756_41_940 | 297 |
| 460 | 3300042002 | Ga0439442_000860 | Ga0439442_000860_1534_2433 | 297 |
| 461 | 3300042004 | Ga0439445_0000068 | Ga0439445_0000068_1622_2521 | 297 |
| 462 | 3300042004 | Ga0439445_0002914 | Ga0439445_0002914_59_958 | 297 |
| 463 | 3300042006 | Ga0439432_000877 | Ga0439432_000877_2877_3776 | 297 |
| 464 | 3300042006 | Ga0439432_051651 | Ga0439432_051651_316_1209 | 297 |
| 465 | 3300042122 | Ga0450920_013992 | Ga0450920_013992_515_1411 | 297 |
| 466 | 3300042435 | Ga0439434_0002135 | Ga0439434_0002135_280_1179 | 297 |
| 467 | 3300046452 | Ga0495617_049090 | Ga0495617_049090_249_1151 | 297 |
| 468 | 3300046453 | Ga0495627_012247 | Ga0495627_012247_319_1218 | 297 |
| 469 | 3300046460 | Ga0495638_0000012 | Ga0495638_0000012_145266_146168 | 297 |
| 470 | 3300046460 | Ga0495638_0002975 | Ga0495638_0002975_7704_8603 | 297 |
| 471 | 3300046492 | Ga0495585_0002773 | Ga0495585_0002773_5292_6194 | 297 |
| 472 | 3300046492 | Ga0495585_0020405 | Ga0495585_0020405_2020_2913 | 297 |
| 473 | 3300046492 | Ga0495585_0126023 | Ga0495585_0126023_417_1319 | 297 |
| 474 | 3300046501 | Ga0495607_0016870 | Ga0495607_0016870_2429_3328 | 297 |
| 475 | 3300046506 | Ga0495583_0000411 | Ga0495583_0000411_18897_19799 | 297 |
| 476 | 3300046506 | Ga0495583_0001065 | Ga0495583_0001065_29046_29948 | 297 |
| 477 | 3300046506 | Ga0495583_0003000 | Ga0495583_0003000_2418_3332 | 297 |
| 478 | 3300046506 | Ga0495583_0013953 | Ga0495583_0013953_2627_3529 | 297 |
| 479 | 3300046507 | Ga0495606_0000383 | Ga0495606_0000383_5775_6677 | 297 |
| 480 | 3300046518 | Ga0495631_0031426 | Ga0495631_0031426_1218_2120 | 297 |
| 481 | 3300046519 | Ga0495632_0000832 | Ga0495632_0000832_3731_4633 | 297 |
| 482 | 3300046522 | Ga0495643_0000556 | Ga0495643_0000556_41208_42110 | 297 |
| 483 | 3300046522 | Ga0495643_0006292 | Ga0495643_0006292_5300_6202 | 297 |
| 484 | 3300046522 | Ga0495643_0031650 | Ga0495643_0031650_334_1236 | 297 |
| 485 | 3300046522 | Ga0495643_0050076 | Ga0495643_0050076_1105_2007 | 297 |
| 486 | 3300046523 | Ga0495644_0044850 | Ga0495644_0044850_494_1387 | 297 |
| 487 | 3300046524 | Ga0495648_0000038 | Ga0495648_0000038_45445_46347 | 297 |
| 488 | 3300046524 | Ga0495648_0000901 | Ga0495648_0000901_26475_27377 | 297 |
| 489 | 3300046524 | Ga0495648_0013015 | Ga0495648_0013015_3764_4678 | 297 |
| 490 | 3300046529 | Ga0495652_0031929 | Ga0495652_0031929_1928_2827 | 297 |
| 491 | 3300046537 | Ga0495598_0001525 | Ga0495598_0001525_3303_4196 | 297 |
| 492 | 3300046539 | Ga0495621_0002891 | Ga0495621_0002891_3116_4009 | 297 |
| 493 | 3300046542 | Ga0495597_0026834 | Ga0495597_0026834_192_1094 | 297 |
| 494 | 3300046558 | Ga0495633_0002232 | Ga0495633_0002232_5698_6600 | 297 |
| 495 | 3300046558 | Ga0495633_0013935 | Ga0495633_0013935_2347_3240 | 297 |
| 496 | 3300046558 | Ga0495633_0015028 | Ga0495633_0015028_687_1589 | 297 |
| 497 | 3300046558 | Ga0495633_0016871 | Ga0495633_0016871_699_1601 | 297 |
| 498 | 3300046616 | Ga0495668_0000218 | Ga0495668_0000218_32878_33780 | 297 |
| 499 | 3300046648 | Ga0495611_0005427 | Ga0495611_0005427_2453_3355 | 297 |
| 500 | 3300046648 | Ga0495611_0035355 | Ga0495611_0035355_52_954 | 297 |
| 501 | 3300046660 | Ga0495625_0000496 | Ga0495625_0000496_5687_6589 | 297 |
| 502 | 3300046660 | Ga0495625_0001098 | Ga0495625_0001098_26669_27568 | 297 |
| 503 | 3300046660 | Ga0495625_0028736 | Ga0495625_0028736_2352_3254 | 297 |
| 504 | 3300046660 | Ga0495625_0040485 | Ga0495625_0040485_1337_2239 | 297 |
| 505 | 3300046665 | Ga0495661_0116386 | Ga0495661_0116386_554_1447 | 297 |
| 506 | 3300046684 | Ga0495669_0000241 | Ga0495669_0000241_5793_6695 | 297 |
| 507 | 3300046684 | Ga0495669_0002156 | Ga0495669_0002156_4425_5318 | 297 |
| 508 | 3300046684 | Ga0495669_0015695 | Ga0495669_0015695_1044_1937 | 297 |
| 509 | 3300046691 | Ga0495670_0000104 | Ga0495670_0000104_29212_30111 | 297 |
| 510 | 3300046691 | Ga0495670_0027119 | Ga0495670_0027119_1409_2311 | 297 |
| 511 | 3300046691 | Ga0495670_0054457 | Ga0495670_0054457_128_1030 | 297 |
| 512 | 3300046692 | Ga0495671_0000034 | Ga0495671_0000034_45221_46123 | 297 |
| 513 | 3300046694 | Ga0495649_0035817 | Ga0495649_0035817_1205_2104 | 297 |
| 514 | 3300047323 | Ga0495683_0002703 | Ga0495683_0002703_7623_8525 | 297 |
| 515 | 3300047443 | Ga0495687_000082 | Ga0495687_000082_19216_20118 | 297 |
| 516 | 3300047443 | Ga0495687_000472 | Ga0495687_000472_40716_41618 | 297 |
| 517 | 3300047469 | Ga0495673_0000013 | Ga0495673_0000013_117922_118824 | 297 |
| 518 | 3300047469 | Ga0495673_0050588 | Ga0495673_0050588_732_1634 | 297 |
| 519 | 3300047470 | Ga0495681_0002528 | Ga0495681_0002528_8538_9440 | 297 |
| 520 | 3300047470 | Ga0495681_0039186 | Ga0495681_0039186_1310_2212 | 297 |
| 521 | 3300047472 | Ga0495686_0000602 | Ga0495686_0000602_7909_8811 | 297 |
| 522 | 3300047472 | Ga0495686_0099947 | Ga0495686_0099947_654_1553 | 297 |
| 523 | 3300048905 | Ga0496102_0000930 | Ga0496102_0000930_17014_17916 | 297 |
| 524 | 3300048906 | Ga0496103_0001181 | Ga0496103_0001181_11311_12213 | 297 |
| 525 | 3300048907 | Ga0496104_0003538 | Ga0496104_0003538_8530_9432 | 297 |
| 526 | 3300048908 | Ga0496105_0001238 | Ga0496105_0001238_11090_11992 | 297 |
| 527 | 3300048913 | Ga0496110_0005603 | Ga0496110_0005603_8769_9662 | 297 |
| 528 | 3300048913 | Ga0496110_0016383 | Ga0496110_0016383_969_1871 | 297 |
| 529 | 3300048914 | Ga0496111_0001589 | Ga0496111_0001589_7620_8513 | 297 |
| 530 | 3300048914 | Ga0496111_0025686 | Ga0496111_0025686_1276_2178 | 297 |
| 531 | 3300048918 | Ga0496115_0000339 | Ga0496115_0000339_33177_34079 | 297 |
| 532 | 3300048918 | Ga0496115_0009842 | Ga0496115_0009842_538_1437 | 297 |
| 533 | 3300048919 | Ga0496116_0006574 | Ga0496116_0006574_7356_8258 | 297 |
| 534 | 3300048920 | Ga0496117_0003623 | Ga0496117_0003623_11076_11978 | 297 |
| 535 | 3300048921 | Ga0496118_0002640 | Ga0496118_0002640_17044_17946 | 297 |
| 536 | 3300048923 | Ga0496120_0018434 | Ga0496120_0018434_3033_3932 | 297 |
| 537 | 3300048924 | Ga0496121_0000128 | Ga0496121_0000128_73706_74605 | 297 |
| 538 | 3300048924 | Ga0496121_0004809 | Ga0496121_0004809_11097_11999 | 297 |
| 539 | 3300048925 | Ga0496122_0182792 | Ga0496122_0182792_170_1069 | 297 |
| 540 | 3300048926 | Ga0496123_0008086 | Ga0496123_0008086_8571_9473 | 297 |
| 541 | 3300048926 | Ga0496123_0057905 | Ga0496123_0057905_782_1681 | 297 |
| 542 | 3300048926 | Ga0496123_0086142 | Ga0496123_0086142_793_1692 | 297 |
| 543 | 3300048927 | Ga0496124_0000761 | Ga0496124_0000761_14819_15718 | 297 |
| 544 | 3300048927 | Ga0496124_0001474 | Ga0496124_0001474_27863_28765 | 297 |
| 545 | 3300048927 | Ga0496124_0003074 | Ga0496124_0003074_12682_13581 | 297 |
| 546 | 3300048927 | Ga0496124_0040880 | Ga0496124_0040880_699_1598 | 297 |
| 547 | 3300048928 | Ga0496125_0004606 | Ga0496125_0004606_4092_4994 | 297 |
| 548 | 3300048929 | Ga0496126_0000467 | Ga0496126_0000467_62368_63270 | 297 |
| 549 | 3300049513 | Ga0501290_000033 | Ga0501290_000033_8689_9588 | 297 |
| 550 | 3300049515 | Ga0501292_000026 | Ga0501292_000026_12050_12949 | 297 |
| 551 | 3300049517 | Ga0501294_001219 | Ga0501294_001219_1263_2162 | 297 |
| 552 | 3300049571 | Ga0501034_0143067 | Ga0501034_0143067_1108_2007 | 297 |
| 553 | 3300049653 | Ga0501206_002038 | Ga0501206_002038_71_970 | 297 |
| 554 | 3300049662 | Ga0501222_000164 | Ga0501222_000164_6969_7868 | 297 |
| 555 | 3300049663 | Ga0501223_000934 | Ga0501223_000934_4213_5112 | 297 |
| 556 | 3300049686 | Ga0501257_000093 | Ga0501257_000093_2798_3697 | 297 |
| 557 | 3300049686 | Ga0501257_022339 | Ga0501257_022339_384_1283 | 297 |
| 558 | 3300049690 | Ga0501261_000055 | Ga0501261_000055_9368_10267 | 297 |
| 559 | 3300049704 | Ga0501221_004751 | Ga0501221_004751_650_1549 | 297 |
| 560 | 3300049708 | Ga0501245_000201 | Ga0501245_000201_455_1354 | 297 |
| 561 | 3300049775 | Ga0501279_000066 | Ga0501279_000066_12015_12914 | 297 |
| 562 | 3300049776 | Ga0501280_000428 | Ga0501280_000428_4872_5771 | 297 |
| 563 | 3300049777 | Ga0501281_00046 | Ga0501281_00046_1856_2755 | 297 |
| 564 | 3300049778 | Ga0501282_001783 | Ga0501282_001783_1351_2250 | 297 |
| 565 | 3300049779 | Ga0501283_004254 | Ga0501283_004254_397_1296 | 297 |
| 566 | 3300050493 | nmdc:mga0k408_46010_c1 | nmdc:mga0k408_46010_c1_1558_2460 | 297 |
| 567 | 3300050509 | nmdc:mga0qj67_77037_c1 | nmdc:mga0qj67_77037_c1_1550_2446 | 297 |
| 568 | 3300053079 | Ga0500610_0001098 | Ga0500610_0001098_2201_3103 | 297 |
| 569 | 3300053087 | Ga0500643_000292 | Ga0500643_000292_40097_40996 | 297 |
| 570 | 3300053087 | Ga0500643_001429 | Ga0500643_001429_5710_6609 | 297 |
| 571 | 3300053087 | Ga0500643_014938 | Ga0500643_014938_607_1506 | 297 |
| 572 | 3300053090 | Ga0500646_0041121 | Ga0500646_0041121_154_1053 | 297 |
| 573 | 3300053094 | Ga0500566_0003208 | Ga0500566_0003208_128_1027 | 297 |
| 574 | 3300053104 | Ga0500556_0033203 | Ga0500556_0033203_236_1135 | 297 |
| 575 | 3300053134 | Ga0500658_0006669 | Ga0500658_0006669_48_947 | 297 |
| 576 | 3300053134 | Ga0500658_0010916 | Ga0500658_0010916_1211_2110 | 297 |
| 577 | 3300053136 | Ga0500559_0004787 | Ga0500559_0004787_3374_4273 | 297 |
| 578 | 3300053136 | Ga0500559_0134924 | Ga0500559_0134924_110_1009 | 297 |
| 579 | 3300053139 | Ga0500568_0002185 | Ga0500568_0002185_6934_7833 | 297 |
| 580 | 3300053140 | Ga0500573_0000030 | Ga0500573_0000030_20649_21548 | 297 |
| 581 | 3300053151 | Ga0500604_0000001 | Ga0500604_0000001_167473_168372 | 297 |
| 582 | 3300053151 | Ga0500604_0031722 | Ga0500604_0031722_147_1043 | 297 |
| 583 | 3300053153 | Ga0500616_0000070 | Ga0500616_0000070_225898_226797 | 297 |
| 584 | 3300053153 | Ga0500616_0008535 | Ga0500616_0008535_1648_2547 | 297 |
| 585 | 3300053177 | Ga0500636_0002811 | Ga0500636_0002811_5710_6612 | 297 |
| 586 | 3300053730 | Ga0500645_000237 | Ga0500645_000237_14718_15620 | 297 |
| 587 | 3300053739 | Ga0500587_001316 | Ga0500587_001316_535_1434 | 297 |
| 588 | 3300059510 | Ga0587090_004550 | Ga0587090_004550_355_1257 | 297 |
| 589 | 3300059513 | Ga0587094_004794 | Ga0587094_004794_430_1332 | 297 |
| 590 | 3300060344 | Ga0587071_012130 | Ga0587071_012130_434_1336 | 297 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7tfq-assembly1.cif.gz_A | crystal structure of the pirin family protein redox-sensitive bicupin yhak bound to copper ion from yersinia pestis | 0.9372 | 1 | 274 |
| 6d0p-assembly4.cif.gz_D | 1.88 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii | 0.9348 | 1 | 276 |
| 6d0g-assembly1.cif.gz_A | 1.78 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii | 0.926 | 2 | 294 |
| 6d0g-assembly1.cif.gz_A | 1.78 angstrom resolution crystal structure of quercetin 2,3-dioxygenase from acinetobacter baumannii | 0.908 | 2 | 294 |
| 7tfq-assembly1.cif.gz_A | crystal structure of the pirin family protein redox-sensitive bicupin yhak bound to copper ion from yersinia pestis | 0.9024 | 1 | 274 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9SR06_19_98_2.60.120.1030 | Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain | 0.9173 | 176 | 240 | 2.60.120.1030 |
| af_C0P2Q1_61_325_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9092 | 11 | 272 | 2.60.120.10 |
| af_Q5M827_137_273_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9032 | 143 | 270 | 2.60.120.10 |
| af_Q9D711_137_245_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8951 | 143 | 243 | 2.60.120.10 |
| 4oi2A01 | Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain | 0.8946 | 176 | 238 | 2.60.120.1030 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5E6QY55-F1-model_v4 | Pirin N-terminal domain-containing protein | 0.9964 | 44 | 145 |
|
| AF-A0A6L3ZQX3-F1-model_v4 | deleted | 0.9915 | 8 | 136 |
|
| AF-A0A4Q2YVQ3-F1-model_v4 | Pirin family protein | 0.9902 | 6 | 223 |
GO:0046872
|
| AF-A0A536TC78-F1-model_v4 | Pirin family protein | 0.99 | 31 | 290 |
GO:0046872
|
| AF-A0A2N7XTZ3-F1-model_v4 | Pirin N-terminal domain-containing protein | 0.9895 | 54 | 147 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar