metagRoot

F466992

General Info

Members	Datasets	Scaffolds	Average Seq Length
590	325	1180	199

Family's Representative Sequence

Representative Sequence	3300044673\|Ga0453683_0179333\|Ga0453683_0179333_534_1235
Length	233
Sequence	MIALDSQEESGNTARRRRFGGVTCQASNNLTRSSTMAVLVGKAAPDFTATAVLGNNEIKNIKLSDYKGKHVVLFFYPLDFTFVCPSELIAFDHRLEDFQKRGVEVIGCSIDSQFTHLAWKNTPVNNGGIGQVKYPLVADINHAICQAYDVEATGGVAFRGSFLIDKAGIVQHQVVNNLPLGRNIDEMLRMVDALQFTEEHGEVCPAGWQKGKAGMQASPDGVAKYLASHAKEL

Samples

	Sample ID	Description	Type	Environment
1	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
2	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
3	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
4	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
5	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
6	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
7	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
8	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
9	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
10	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
11	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
12	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
13	3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
14	3300005272	Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1	Metagenome	Rhizosphere
15	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
16	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
17	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
18	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
19	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
20	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
21	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
22	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
23	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
24	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
25	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
26	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
27	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
28	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
29	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
30	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
31	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
32	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
33	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
34	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
35	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
36	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
37	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
38	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
39	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
40	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
41	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
42	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
43	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
44	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
45	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
46	3300015679	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08	Metagenome	Unclassified
47	3300015680	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03	Metagenome	Rhizosphere
48	3300015685	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12	Metagenome	Unclassified
49	3300015687	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08	Metagenome	Rhizosphere
50	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
51	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
52	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
53	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
54	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
55	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
56	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
57	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
58	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
59	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
60	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
61	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
62	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
63	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
64	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
65	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
66	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
67	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
68	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
69	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
70	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
71	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
72	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
73	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
74	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
75	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
76	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
77	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
78	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
79	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
80	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
81	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
82	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
83	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
84	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
85	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
86	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
87	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
88	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
89	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
90	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
91	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
92	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
93	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
94	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
95	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
96	3300033524	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
97	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
98	3300033529	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
99	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
100	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
101	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
102	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
103	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
104	3300038725	Seagrass microbial communities from Seahorse Key, FL, USA - HV0818	Metagenome	Unclassified
105	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
106	3300038727	Seagrass microbial communities from Seahorse Key, FL, USA - TV0818	Metagenome	Unclassified
107	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
108	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
109	3300038742	Seagrass microbial communities from Seahorse Key, FL, USA - SH0818	Metagenome	Unclassified
110	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
111	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
112	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
113	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
114	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
115	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
116	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
117	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
118	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
119	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
120	3300042136	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294	Metagenome	Rhizosphere
121	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
122	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
123	3300044669	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E	Metagenome	Unclassified
124	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
125	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
126	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
127	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
128	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
129	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
130	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
131	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
132	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
133	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
134	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
135	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
136	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
137	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
138	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
139	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
140	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
141	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
142	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
143	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
144	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
145	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
146	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
147	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
148	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
149	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
150	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
151	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
152	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
153	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
154	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
155	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
156	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
157	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
158	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
159	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
160	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
161	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
162	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
163	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
164	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
165	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
166	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
167	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
168	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
169	3300049551	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
170	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
171	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
172	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
173	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
174	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
175	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
176	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
177	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
178	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
179	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
180	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
181	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
182	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
183	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
184	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
185	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
186	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
187	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
188	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
189	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
190	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
191	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
192	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
193	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
194	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
195	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
196	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
197	2506520007	Serratia plymuthica AS9	Isolate	Rhizosphere
198	2506520008	Serratia plymuthica AS12	Isolate	Unclassified
199	2508501071	Serratia proteamaculans S4	Isolate	Rhizosphere
200	2526164512	Azovibrio restrictus DSM 23866	Isolate	Unclassified
201	2537561728	Pectobacterium wasabiae CFBP 3304	Isolate	Rhizoplane
202	2547132103	Chromobacterium sp. C-61	Isolate	Rhizosphere
203	2547132512	Azospira oryzae 6a3	Isolate	Unclassified
204	2554235234	Klebsiella michiganensis SA2	Isolate	Unclassified
205	2561511199	Enterobacter sp. R4-368	Isolate	Nodule
206	2585427591	Rahnella aquatilis OV744	Isolate	Rhizosphere
207	2585427592	Rahnella aquatilis OV588	Isolate	Rhizosphere
208	2599185169	Klebsiella quasipneumoniae NFPP35	Isolate	Rhizoplane
209	2600255254	Klebsiella quasipneumoniae NFIX15	Isolate	Rhizoplane
210	2600255255	Klebsiella quasipneumoniae NFIX23	Isolate	Rhizoplane
211	2600255256	Enterobacter sp. NFIX08	Isolate	Rhizoplane
212	2600255257	Enterobacter sp. NFIX03	Isolate	Rhizoplane
213	2600255280	Klebsiella quasipneumoniae NFIX42	Isolate	Rhizoplane
214	2600255281	Klebsiella quasipneumoniae NFIX43	Isolate	Rhizoplane
215	2600255287	Klebsiella quasipneumoniae NFIX11	Isolate	Rhizoplane
216	2600255288	Klebsiella quasipneumoniae NFIX14	Isolate	Rhizoplane
217	2600255289	Klebsiella quasipneumoniae NFIX16	Isolate	Rhizoplane
218	2600255290	Klebsiella quasipneumoniae NFIX17	Isolate	Rhizoplane
219	2600255291	Klebsiella quasipneumoniae NFIX19	Isolate	Rhizoplane
220	2600255298	Klebsiella quasipneumoniae NFIX21	Isolate	Rhizoplane
221	2600255299	Klebsiella quasipneumoniae NFIX22	Isolate	Rhizoplane
222	2600255300	Klebsiella quasipneumoniae NFIX30	Isolate	Rhizoplane
223	2600255301	Klebsiella quasipneumoniae NFIX33	Isolate	Rhizoplane
224	2600255302	Klebsiella quasipneumoniae NFIX35	Isolate	Rhizoplane
225	2600255303	Klebsiella quasipneumoniae NFIX36	Isolate	Rhizoplane
226	2600255304	Klebsiella quasipneumoniae NFIX37	Isolate	Rhizoplane
227	2600255305	Klebsiella quasipneumoniae NFIX41	Isolate	Rhizoplane
228	2600255306	Klebsiella quasipneumoniae NFIX44	Isolate	Rhizoplane
229	2600255307	Klebsiella quasipneumoniae NFIX56	Isolate	Rhizoplane
230	2600255309	Klebsiella sp. NFIX53	Isolate	Rhizoplane
231	2600255310	Enterobacter sp. NFIX06	Isolate	Rhizoplane
232	2600255311	Enterobacter sp. NFIX04	Isolate	Rhizoplane
233	2600255392	Klebsiella quasipneumoniae NFIX54	Isolate	Rhizoplane
234	2602042046	Enterobacter sp. NFIX09	Isolate	Rhizoplane
235	2602042047	Enterobacter sp. NFIX59	Isolate	Rhizoplane
236	2602042052	Klebsiella quasipneumoniae NFIX18	Isolate	Rhizoplane
237	2602042053	Klebsiella quasipneumoniae NFIX12	Isolate	Rhizoplane
238	2602042066	Enterobacter sp. NFIX45	Isolate	Rhizoplane
239	2602042067	Enterobacter sp. NFIX58	Isolate	Rhizoplane
240	2602042103	Klebsiella quasipneumoniae NFIX29	Isolate	Rhizoplane
241	2602042104	Klebsiella quasipneumoniae NFIX26	Isolate	Rhizoplane
242	2602042105	Klebsiella quasipneumoniae NFIX25	Isolate	Rhizoplane
243	2602042106	Klebsiella quasipneumoniae NFIX13	Isolate	Rhizoplane
244	2602042109	Klebsiella aerogenes NFIX39	Isolate	Rhizoplane
245	2602042110	Klebsiella quasipneumoniae NFIX40	Isolate	Rhizoplane
246	2602042111	Klebsiella quasipneumoniae NFIX20	Isolate	Rhizoplane
247	2603880178	Klebsiella quasipneumoniae NFIX34	Isolate	Rhizoplane
248	2603880184	Klebsiella quasipneumoniae NFIX27	Isolate	Rhizoplane
249	2603880202	Klebsiella quasipneumoniae NFIX38	Isolate	Rhizoplane
250	2603880211	Klebsiella quasipneumoniae NFIX24	Isolate	Rhizoplane
251	2636415599	Klebsiella variicola DX120E	Isolate	Unclassified
252	2654587920	Serratia plymuthica HRO-C48	Isolate	Rhizosphere
253	2667528172	Enterobacteriaceae bacterium NFIX31	Isolate	Rhizoplane
254	2667528173	Rahnella sp. NFIX50	Isolate	Rhizoplane
255	2671180115	Cedecea sp. NFIX57	Isolate	Rhizoplane
256	2675903046	Klebsiella quasipneumoniae NFIX52	Isolate	Rhizoplane
257	2681812866	Enterobacter asburiae NFIX55	Isolate	Rhizoplane
258	2681812869	Enterobacter ludwigii NFPP41	Isolate	Rhizoplane
259	2687453601	Serratia plymuthica 3Rp8	Isolate	Unclassified
260	2706794495	Dickeya zeae ZJU1202	Isolate	Unclassified
261	2711768156	Atlantibacter hermannii DDE1	Isolate	Unclassified
262	2751185917	Enterobacter sp. HK169	Isolate	Unclassified
263	2765235842	Enterobacter ludwigii AA4	Isolate	Unclassified
264	2772190666	Serratia surfactantfaciens YD25	Isolate	Unclassified
265	2775506706	Enterobacter asburiae 1216	Isolate	Unclassified
266	2775507074	Klebsiella sp. D5A	Isolate	Unclassified
267	2791355010	Kosakonia pseudosacchari NN143	Isolate	Unclassified
268	2791355275	Enterobacter sp. Sa187	Isolate	Unclassified
269	2806310673	Serratia quinivorans NCTC 13189	Isolate	Rhizosphere
270	2811995292	Kosakonia oryzae Ola 51	Isolate	Unclassified
271	2814123068	Kosakonia radicincitans GXGL-4A	Isolate	Rhizosphere
272	2821118458	Enterobacter asburiae 609	Isolate	Unclassified
273	2823373977	Enterobacter ludwigii NCR3	Isolate	Rhizosphere
274	2843690924	Chromobacterium rhizoryzae JP2-74	Isolate	Rhizosphere
275	2844425489	Enterobacter cloacae SBP-8	Isolate	Rhizosphere
276	2846033681	Chromobacterium sinusclupearum MWU13-2610	Isolate	Rhizosphere
277	2846037992	Chromobacterium alticapitis MWU14-2602	Isolate	Rhizosphere
278	2846540461	Photorhabdus luminescens HIM3	Isolate	Rhizosphere
279	2847085930	Erwinia persicina B64	Isolate	Bulb
280	2852103415	Edaphovirga cremea DSM 105170	Isolate	Rhizosphere
281	2854601825	Dickeya dianthicola SS70	Isolate	Stem Tuber
282	2855195626	Pectobacterium atrosepticum SS26	Isolate	Stem Tuber
283	2858466076	Pectobacterium polaris SS28	Isolate	Stem Tuber
284	2869551831	Serratia inhibens PRI-2C	Isolate	Rhizosphere
285	2871272651	Pectobacterium carotovorum SS96	Isolate	Stem Tuber
286	2871282230	Pectobacterium parmentieri SS90	Isolate	Stem Tuber
287	2884086401	Kluyvera sp. PO2S7	Isolate	Rhizosphere
288	2888366609	Serratia sp. NGAS9	Isolate	Rhizosphere
289	2888373701	Serratia rhizosphaerae KUDC3025	Isolate	Rhizosphere
290	2891670763	Buttiauxella sp. B2	Isolate	Rhizosphere
291	2900051742	Pectobacterium zantedeschiae 2M	Isolate	Stem Tuber
292	2904474040	Rahnella aquatilis 4485	Isolate	Rhizosphere
293	2904504865	Serratia marcescens 1822	Isolate	Unclassified
294	2904513164	Klebsiella variicola 1431	Isolate	Rhizosphere
295	2908669403	Pantoea coffeiphila 1480	Isolate	Rhizosphere
296	2919108558	Klebsiella sp. 1400	Isolate	Rhizosphere
297	2919150387	Rahnella aceris 1817	Isolate	Unclassified
298	2923634449	Enterobacter kobei SLBN-76	Isolate	Rhizosphere
299	2927143783	Rahnella sp. 2050	Isolate	Unclassified
300	2927833300	Enterobacter sp. SLBN-59	Isolate	Rhizosphere
301	2932406140	Serratia sp. 2723	Isolate	Rhizosphere
302	2937539931	Pantoea sp. LS15	Isolate	Unclassified
303	2937967321	Serratia sp. YC16	Isolate	Unclassified
304	2939568625	Lelliottia sp. 489	Isolate	Rhizosphere
305	2939573065	Citrobacter sp. 506	Isolate	Rhizosphere
306	2939577877	Serratia sp. 509	Isolate	Rhizosphere
307	2939607340	Leclercia sp. 1548	Isolate	Rhizosphere
308	2939642701	Lelliottia nimipressuralis 2756	Isolate	Rhizosphere
309	2969079654	Klebsiella variicola E57-7	Isolate	Unclassified
310	2971820967	Klebsiella sp. MPUS7	Isolate	Rhizosphere
311	2974310843	Enterobacter sp. SORGH_AS 287	Isolate	Unclassified
312	2984559226	Klebsiella variicola SORGH_AS834	Isolate	Aerial Root
313	2984595703	Klebsiella variicola SORGH_AS1070	Isolate	Aerial Root
314	2998344455	Vogesella urethralis SLBN-145	Isolate	Rhizosphere
315	640753048	Serratia proteamaculans 568	Isolate	Endosphere
316	8004592986	Serratia sp. S119	Isolate	Unclassified
317	8015394850	Serratia sp. PGPR-27	Isolate	Rhizosphere
318	8018221730	Enterobacter sp. CM29	Isolate	Unclassified
319	8018405270	Enterobacter sp. 198	Isolate	Rhizosphere
320	8054844752	Dryocola boscaweniae H18W14	Isolate	Rhizosphere
321	8054849141	Dryocola clanedunensis H11S18	Isolate	Rhizosphere
322	8055087960	Silvania hatchlandensis H19S6	Isolate	Rhizosphere
323	8055092621	Silvania confinis H4N4	Isolate	Rhizosphere
324	8055097453	Leclercia tamurae H6W5	Isolate	Rhizosphere
325	8057304971	Scandinavium manionii H17S15	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	72.37
Metatranscriptomes	5.76
Isolates	21.86

Biome Distribution

Category	Percentage (%)
Aerial Root	0.34
Bulb	0.17
Endosphere	6.1
Nodule	3.05
Rhizoplane	9.15
Rhizosphere	60.34
Stem	0
Stem Tuber	1.02
Unclassified	0.51

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0453683_0179333	3300044673	Bacteria	1343
2	JGI25162J39368_1000003	3300002737	Bacteria	575218
3	JGI25163J39215_1000062	3300002771	Bacteria	48435
4	JGI25164J39214_1000009	3300002772	Bacteria	303437
5	JGI25165J46597_1017328	3300003214	Bacteria	959
6	rootH2_10015620	3300003320	Bacteria	27832
7	Ga0055538_1000005	3300003751	Bacteria	575218
8	Ga0055539_1000007	3300003752	Bacteria	575218
9	Ga0055533_1000009	3300003756	Bacteria	575218
10	Ga0055525_1000010	3300003759	Bacteria	575218
11	Ga0055541_1000005	3300003841	Bacteria	575218
12	Ga0058692_1001175	3300003856	Bacteria	10057
13	Ga0058692_1031678	3300003856	Bacteria	993
14	Ga0058862_12009584	3300004803	Eukaryota	653
15	Ga0058862_12846961	3300004803	Eukaryota	805
16	Ga0065703_1019868	3300005272	Bacteria	2316
17	Ga0065704_10000444	3300005289	Bacteria	86255
18	Ga0065704_10000805	3300005289	Bacteria	22150
19	Ga0065704_10355730	3300005289	Bacteria	791
20	Ga0070660_100454887	3300005339	Bacteria	1062
21	Ga0070661_100690102	3300005344	Bacteria	831
22	Ga0070659_100605168	3300005366	Bacteria	942
23	Ga0070698_100204857	3300005471	Bacteria	1908
24	Ga0070665_100002124	3300005548	Bacteria	22143
25	Ga0068857_100035370	3300005577	Bacteria	4424
26	Ga0068851_10073993	3300005834	Bacteria	1767
27	Ga0081455_10419118	3300005937	Bacteria	924
28	Ga0075364_10001196	3300006051	Bacteria	13934
29	Ga0075364_10357735	3300006051	Bacteria	995
30	Ga0075364_10528249	3300006051	Bacteria	807
31	Ga0075367_10492900	3300006178	Bacteria	777
32	Ga0075366_10017456	3300006195	Bacteria	4130
33	Ga0075366_10038652	3300006195	Bacteria	2819
34	Ga0075428_100620870	3300006844	Bacteria	1154
35	Ga0075430_100032821	3300006846	Bacteria	4406
36	Ga0079104_1000166	3300006946	Bacteria	94027
37	Ga0079104_1000174	3300006946	Bacteria	91722
38	Ga0079104_1000192	3300006946	Bacteria	85695
39	Ga0079104_1000578	3300006946	Bacteria	36991
40	Ga0079104_1000845	3300006946	Bacteria	25452
41	Ga0079104_1001233	3300006946	Bacteria	17982
42	Ga0105251_10000254	3300009011	Bacteria	53726
43	Ga0105251_10000827	3300009011	Bacteria	27696
44	Ga0105251_10001719	3300009011	Bacteria	18320
45	Ga0105251_10001743	3300009011	Bacteria	18159
46	Ga0105251_10001955	3300009011	Bacteria	16844
47	Ga0105251_10003499	3300009011	Bacteria	11360
48	Ga0105251_10069159	3300009011	Bacteria	1647
49	Ga0105244_10000031	3300009036	Bacteria	177606
50	Ga0105244_10000041	3300009036	Bacteria	155525
51	Ga0105244_10000105	3300009036	Bacteria	86528
52	Ga0105244_10001211	3300009036	Bacteria	21159
53	Ga0105244_10002072	3300009036	Bacteria	15427
54	Ga0105244_10031954	3300009036	Bacteria	2792
55	Ga0105250_10000003	3300009092	Bacteria	547770
56	Ga0105250_10000052	3300009092	Bacteria	116382
57	Ga0105250_10000150	3300009092	Bacteria	61428
58	Ga0105250_10000320	3300009092	Bacteria	36962
59	Ga0105250_10003644	3300009092	Bacteria	7251
60	Ga0105250_10010479	3300009092	Bacteria	3863
61	Ga0105250_10097781	3300009092	Bacteria	1197
62	Ga0105240_10342309	3300009093	Bacteria	1698
63	Ga0105247_10000191	3300009101	Bacteria	60259
64	Ga0105243_10289713	3300009148	Bacteria	1479
65	Ga0105241_10000004	3300009174	Bacteria	803007
66	Ga0105237_10029153	3300009545	Bacteria	5614
67	Ga0105237_10618255	3300009545	Bacteria	1090
68	Ga0105239_10810406	3300010375	Bacteria	1073
69	Ga0105239_11499317	3300010375	Bacteria	779
70	Ga0157373_10030819	3300013100	Bacteria	3859
71	Ga0157373_10087601	3300013100	Bacteria	2194
72	Ga0157373_10116591	3300013100	Bacteria	1877
73	Ga0157371_10000007	3300013102	Bacteria	401847
74	Ga0157370_10000122	3300013104	Bacteria	91538
75	Ga0163162_10175717	3300013306	Bacteria	2267
76	Ga0157372_10006185	3300013307	Bacteria	12728
77	Ga0157372_10046090	3300013307	Bacteria	4839
78	Ga0157372_10347858	3300013307	Bacteria	1727
79	Ga0182008_10004036	3300014497	Bacteria	8665
80	Ga0182006_1000020	3300015261	Bacteria	285318
81	Ga0182006_1132128	3300015261	Bacteria	858
82	Ga0183366_1001	3300015679	Bacteria	2743932
83	Ga0183370_1001	3300015680	Bacteria	2743932
84	Ga0183369_1001	3300015685	Bacteria	2743932
85	Ga0183368_1001	3300015687	Bacteria	2743932
86	Ga0163161_10000004	3300017792	Bacteria	333149
87	Ga0163161_10033976	3300017792	Bacteria	3647
88	Ga0206354_11367514	3300020081	Bacteria	644
89	Ga0213872_10000414	3300021361	Bacteria	35013
90	Ga0213872_10000807	3300021361	Bacteria	22716
91	Ga0213872_10002543	3300021361	Bacteria	10633
92	Ga0213872_10006294	3300021361	Bacteria	5984
93	Ga0213876_10347102	3300021384	Bacteria	789
94	Ga0209760_100069	3300025207	Bacteria	83692
95	Ga0209784_100001	3300025224	Bacteria	3600592
96	Ga0209566_100001	3300025225	Bacteria	3600765
97	Ga0209674_100002	3300025226	Bacteria	3600592
98	Ga0209563_100008	3300025230	Bacteria	1554545
99	Ga0207427_100002	3300025231	Bacteria	1355321
100	Ga0209437_100007	3300025233	Bacteria	938377
101	Ga0209677_100004	3300025253	Bacteria	1554545
102	Ga0209233_1003111	3300025261	Bacteria	5898
103	Ga0207696_1000003	3300025711	Bacteria	860639
104	Ga0207696_1000004	3300025711	Bacteria	671626
105	Ga0207696_1000007	3300025711	Bacteria	578417
106	Ga0207696_1000033	3300025711	Bacteria	360689
107	Ga0207696_1000313	3300025711	Bacteria	54096
108	Ga0207696_1001321	3300025711	Bacteria	13708
109	Ga0207696_1017107	3300025711	Bacteria	2409
110	Ga0207696_1052151	3300025711	Bacteria	1167
111	Ga0207655_1000001	3300025728	Bacteria	1866413
112	Ga0207655_1000011	3300025728	Bacteria	643321
113	Ga0207655_1000029	3300025728	Bacteria	432187
114	Ga0207655_1000087	3300025728	Bacteria	205876
115	Ga0207655_1000121	3300025728	Bacteria	155535
116	Ga0207655_1000226	3300025728	Bacteria	94688
117	Ga0207655_1000404	3300025728	Bacteria	59563
118	Ga0207655_1000559	3300025728	Bacteria	46436
119	Ga0207655_1029382	3300025728	Bacteria	2574
120	Ga0207713_1000005	3300025735	Bacteria	649958
121	Ga0207713_1000038	3300025735	Bacteria	247609
122	Ga0207713_1000065	3300025735	Bacteria	196128
123	Ga0207713_1000108	3300025735	Bacteria	137268
124	Ga0207713_1000155	3300025735	Bacteria	102677
125	Ga0207713_1001769	3300025735	Bacteria	16551
126	Ga0207713_1006287	3300025735	Bacteria	7260
127	Ga0207713_1046152	3300025735	Bacteria	1774
128	Ga0207713_1118598	3300025735	Bacteria	890
129	Ga0207713_1139314	3300025735	Bacteria	794
130	Ga0207710_10000016	3300025900	Bacteria	388568
131	Ga0207654_10000006	3300025911	Bacteria	815027
132	Ga0207695_10218033	3300025913	Bacteria	1816
133	Ga0207657_10332546	3300025919	Bacteria	1200
134	Ga0207690_10533057	3300025932	Bacteria	953
135	Ga0207709_10007879	3300025935	Bacteria	5903
136	Ga0207674_10078122	3300026116	Bacteria	3315
137	Ga0209281_1000001	3300027111	Bacteria	1933496
138	Ga0209281_1000008	3300027111	Bacteria	867470
139	Ga0209281_1000021	3300027111	Bacteria	541033
140	Ga0209281_1000075	3300027111	Bacteria	267114
141	Ga0209281_1000093	3300027111	Bacteria	240724
142	Ga0209281_1000254	3300027111	Bacteria	105570
143	Ga0209281_1000480	3300027111	Bacteria	55767
144	Ga0209281_1000492	3300027111	Bacteria	53875
145	Ga0209281_1001723	3300027111	Bacteria	11282
146	Ga0209281_1002685	3300027111	Bacteria	6726
147	Ga0209281_1004290	3300027111	Bacteria	4314
148	Ga0209371_1000001	3300027312	Bacteria	2771503
149	Ga0209371_1000104	3300027312	Bacteria	148080
150	Ga0209371_1000946	3300027312	Bacteria	22605
151	Ga0209371_1001819	3300027312	Bacteria	13271
152	Ga0209371_1008692	3300027312	Bacteria	3329
153	Ga0268266_10000165	3300028379	Bacteria	122830
154	Ga0265323_10021331	3300028653	Bacteria	2483
155	Ga0265336_10000185	3300028666	Bacteria	43870
156	Ga0265338_10093790	3300028800	Bacteria	2472
157	Ga0265338_10519268	3300028800	Bacteria	837
158	Ga0265324_10000011	3300029957	Bacteria	218521
159	Ga0265324_10002330	3300029957	Bacteria	9829
160	Ga0265324_10008459	3300029957	Bacteria	4088
161	Ga0268256_1000001	3300030500	Bacteria	2771065
162	Ga0268256_1000017	3300030500	Bacteria	600718
163	Ga0268256_1001277	3300030500	Bacteria	15637
164	Ga0268256_1001587	3300030500	Bacteria	13271
165	Ga0265330_10002891	3300031235	Bacteria	9166
166	Ga0265332_10000039	3300031238	Bacteria	128373
167	Ga0265328_10000002	3300031239	Bacteria	275819
168	Ga0265328_10054967	3300031239	Bacteria	1461
169	Ga0265325_10001032	3300031241	Bacteria	20084
170	Ga0265325_10030654	3300031241	Bacteria	2882
171	Ga0265331_10000012	3300031250	Bacteria	297201
172	Ga0265331_10000019	3300031250	Bacteria	258837
173	Ga0265331_10007377	3300031250	Bacteria	6368
174	Ga0265331_10024100	3300031250	Bacteria	3083
175	Ga0265331_10035018	3300031250	Bacteria	2472
176	Ga0265331_10053191	3300031250	Bacteria	1932
177	Ga0265331_10096111	3300031250	Bacteria	1367
178	Ga0265331_10153338	3300031250	Bacteria	1046
179	Ga0265327_10000068	3300031251	Bacteria	219962
180	Ga0265327_10000173	3300031251	Bacteria	138925
181	Ga0265327_10000471	3300031251	Bacteria	71254
182	Ga0265327_10001224	3300031251	Bacteria	34492
183	Ga0265327_10012104	3300031251	Bacteria	5855
184	Ga0265327_10039452	3300031251	Bacteria	2565
185	Ga0265316_10027461	3300031344	Bacteria	4712
186	Ga0265316_10077865	3300031344	Bacteria	2546
187	Ga0265316_10099394	3300031344	Bacteria	2213
188	Ga0265316_10100700	3300031344	Bacteria	2196
189	Ga0265316_10115723	3300031344	Bacteria	2027
190	Ga0307509_10000018	3300031507	Bacteria	258998
191	Ga0307508_10211792	3300031616	Bacteria	1538
192	Ga0307514_10065978	3300031649	Bacteria	2739
193	Ga0316575_10003181	3300031665	Bacteria	5619
194	Ga0265314_10000262	3300031711	Bacteria	77107
195	Ga0265314_10000307	3300031711	Bacteria	70029
196	Ga0316577_10006905	3300031733	Bacteria	6030
197	Ga0316583_10002950	3300032133	Bacteria	5980
198	Ga0316583_10003069	3300032133	Bacteria	5867
199	Ga0316583_10097330	3300032133	Bacteria	1026
200	Ga0316593_10009940	3300032168	Bacteria	2710
201	Ga0316593_10014448	3300032168	Bacteria	2355
202	Ga0316593_10049646	3300032168	Bacteria	1415
203	Ga0316593_10071464	3300032168	Bacteria	1201
204	Ga0316593_10201503	3300032168	Bacteria	736
205	Ga0316593_10216189	3300032168	Bacteria	711
206	Ga0316592_1025299	3300033524	Bacteria	1280
207	Ga0316592_1046926	3300033524	Bacteria	962
208	Ga0316592_1096122	3300033524	Bacteria	680
209	Ga0316592_1104706	3300033524	Bacteria	652
210	Ga0316588_1017969	3300033528	Bacteria	1580
211	Ga0316588_1026857	3300033528	Bacteria	1335
212	Ga0316587_1006039	3300033529	Bacteria	1837
213	Ga0316587_1053472	3300033529	Bacteria	742
214	Ga0316587_1056118	3300033529	Bacteria	726
215	Ga0316587_1058650	3300033529	Bacteria	711
216	Ga0316587_1060212	3300033529	Bacteria	703
217	Ga0316596_1034049	3300033541	Bacteria	1329
218	Ga0316596_1060269	3300033541	Bacteria	1012
219	Ga0316596_1069406	3300033541	Bacteria	943
220	Ga0316596_1070046	3300033541	Bacteria	939
221	Ga0316596_1078928	3300033541	Bacteria	884
222	Ga0316596_1109012	3300033541	Bacteria	751
223	Ga0316596_1117778	3300033541	Bacteria	722
224	Ga0316596_1118563	3300033541	Bacteria	720
225	Ga0316596_1121170	3300033541	Bacteria	712
226	Ga0316596_1126447	3300033541	Bacteria	697
227	Ga0316596_1126516	3300033541	Bacteria	697
228	Ga0316596_1144099	3300033541	Bacteria	653
229	Ga0316596_1145931	3300033541	Bacteria	649
230	Ga0316574_0000014	3300035398	Bacteria	42376
231	Ga0316582_0010254	3300036647	Bacteria	5123
232	Ga0316582_0782235	3300036647	Bacteria	654
233	Ga0316584_0023544	3300036712	Bacteria	4499
234	Ga0316584_0134659	3300036712	Bacteria	1845
235	Ga0373925_0885176	3300037068	Bacteria	736
236	Ga0400484_20914	3300038725	Bacteria	5273
237	Ga0400484_39735	3300038725	Bacteria	4976
238	Ga0400490_05485	3300038726	Bacteria	73498
239	Ga0400490_36510	3300038726	Bacteria	7687
240	Ga0400490_37780	3300038726	Bacteria	37835
241	Ga0400490_47679	3300038726	Bacteria	119204
242	Ga0400491_19719	3300038727	Bacteria	14547
243	Ga0400485_02110	3300038735	Bacteria	20147
244	Ga0400485_08080	3300038735	Bacteria	12733
245	Ga0400488_07068	3300038741	Bacteria	8344
246	Ga0400488_14649	3300038741	Bacteria	2376
247	Ga0400488_19178	3300038741	Bacteria	7374
248	Ga0400488_38786	3300038741	Bacteria	1095
249	Ga0400486_13079	3300038742	Bacteria	32894
250	Ga0400486_26530	3300038742	Bacteria	3310
251	Ga0400486_30938	3300038742	Bacteria	20776
252	Ga0400483_011695	3300039062	Bacteria	16998
253	Ga0400483_059991	3300039062	Bacteria	2905
254	Ga0400483_067420	3300039062	Bacteria	26098
255	Ga0400483_076262	3300039062	Bacteria	3305
256	Ga0400483_089669	3300039062	Bacteria	3262
257	Ga0400483_136165	3300039062	Bacteria	23864
258	Ga0400483_194015	3300039062	Bacteria	1586
259	Ga0400483_199105	3300039062	Bacteria	12845
260	Ga0400483_254574	3300039062	Bacteria	3627
261	Ga0400487_06586	3300039110	Bacteria	1096
262	Ga0400487_13389	3300039110	Unclassified	1068
263	Ga0400487_22173	3300039110	Bacteria	2400
264	Ga0400487_33200	3300039110	Unclassified	1487
265	Ga0400487_47932	3300039110	Bacteria	12738
266	Ga0400487_55141	3300039110	Bacteria	10633
267	Ga0400487_64640	3300039110	Bacteria	31253
268	Ga0436365_1871244	3300039437	Bacteria	1217
269	Ga0436361_0041735	3300039447	Bacteria	40196
270	Ga0436361_0071841	3300039447	Bacteria	1496
271	Ga0436361_0105560	3300039447	Bacteria	44727
272	Ga0436361_0164497	3300039447	Bacteria	699
273	Ga0436361_0432960	3300039447	Bacteria	11072
274	Ga0436361_0718861	3300039447	Bacteria	22975
275	Ga0436361_1190835	3300039447	Bacteria	817
276	Ga0439438_000763	3300041405	Bacteria	14419
277	Ga0439447_002208	3300041407	Bacteria	7139
278	Ga0451837_0353250	3300041494	Bacteria	702
279	Ga0439432_030031	3300042006	Bacteria	1764
280	Ga0439432_077141	3300042006	Bacteria	1011
281	Ga0439452_000003	3300042010	Bacteria	942815
282	Ga0439452_000040	3300042010	Bacteria	143490
283	Ga0439452_000361	3300042010	Bacteria	27829
284	Ga0439456_028189	3300042013	Bacteria	1198
285	Ga0450900_005690	3300042136	Bacteria	1482
286	Ga0439464_0053824	3300042439	Bacteria	1168
287	Ga0451577_0000085	3300042876	Bacteria	211141
288	Ga0451577_0000104	3300042876	Bacteria	186417
289	Ga0451577_0000134	3300042876	Bacteria	165856
290	Ga0451577_0000280	3300042876	Bacteria	98991
291	Ga0451577_0002253	3300042876	Bacteria	23418
292	Ga0451577_0008429	3300042876	Bacteria	10034
293	Ga0451577_0008841	3300042876	Bacteria	9752
294	Ga0451577_0017350	3300042876	Bacteria	6653
295	Ga0451577_0026030	3300042876	Bacteria	5300
296	Ga0451577_0076242	3300042876	Bacteria	2990
297	Ga0451577_0093736	3300042876	Bacteria	2681
298	Ga0451577_0247423	3300042876	Bacteria	1614
299	Ga0451577_0333951	3300042876	Bacteria	1375
300	Ga0466981_0000161	3300044669	Bacteria	18917
301	Ga0453683_0000047	3300044673	Bacteria	207763
302	Ga0453683_0188086	3300044673	Bacteria	1310
303	Ga0453683_0628347	3300044673	Bacteria	701
304	Ga0453683_0748547	3300044673	Unclassified	642
305	Ga0453683_1041375	3300044673	Bacteria	544
306	Ga0466961_0000231	3300044693	Bacteria	37788
307	Ga0453684_0000063	3300044712	Bacteria	486079
308	Ga0453684_0000065	3300044712	Bacteria	468481
309	Ga0453684_0000273	3300044712	Bacteria	222658
310	Ga0453684_0000302	3300044712	Bacteria	207763
311	Ga0453684_0000364	3300044712	Bacteria	186418
312	Ga0453684_0000426	3300044712	Bacteria	172005
313	Ga0453684_0000953	3300044712	Bacteria	95365
314	Ga0453684_0001142	3300044712	Bacteria	82866
315	Ga0453684_0001472	3300044712	Bacteria	66447
316	Ga0453684_0001751	3300044712	Bacteria	58062
317	Ga0453684_0011803	3300044712	Bacteria	14556
318	Ga0453684_0021396	3300044712	Bacteria	9664
319	Ga0453684_0026506	3300044712	Bacteria	8364
320	Ga0453684_0036731	3300044712	Bacteria	6744
321	Ga0453684_0074999	3300044712	Bacteria	4255
322	Ga0453684_0082608	3300044712	Bacteria	4001
323	Ga0453684_0148279	3300044712	Bacteria	2791
324	Ga0453684_0172521	3300044712	Bacteria	2547
325	Ga0453684_0259570	3300044712	Bacteria	1991
326	Ga0453684_0295728	3300044712	Bacteria	1842
327	Ga0453684_0307672	3300044712	Bacteria	1799
328	Ga0466959_0080307	3300045049	Bacteria	2351
329	Ga0451576_0000006	3300045051	Bacteria	949698
330	Ga0451576_0000056	3300045051	Bacteria	303398
331	Ga0451576_0000116	3300045051	Bacteria	207763
332	Ga0451576_0000659	3300045051	Bacteria	71101
333	Ga0451576_0001853	3300045051	Bacteria	34252
334	Ga0451576_0002503	3300045051	Bacteria	27266
335	Ga0451576_0002526	3300045051	Bacteria	27094
336	Ga0451576_0018576	3300045051	Bacteria	7613
337	Ga0451576_0020304	3300045051	Bacteria	7236
338	Ga0451576_0037768	3300045051	Bacteria	5114
339	Ga0451576_0046204	3300045051	Bacteria	4585
340	Ga0451576_0047488	3300045051	Bacteria	4513
341	Ga0451576_0168985	3300045051	Bacteria	2282
342	Ga0495627_000136	3300046453	Bacteria	87662
343	Ga0495591_008507	3300046458	Bacteria	4196
344	Ga0495638_0064293	3300046460	Bacteria	2260
345	Ga0495650_0000016	3300046471	Bacteria	554693
346	Ga0495650_0000033	3300046471	Bacteria	412188
347	Ga0495650_0000205	3300046471	Bacteria	128197
348	Ga0495584_0011843	3300046491	Bacteria	4460
349	Ga0495607_0012669	3300046501	Bacteria	5555
350	Ga0495606_0000296	3300046507	Bacteria	85795
351	Ga0495631_0097091	3300046518	Bacteria	1268
352	Ga0495632_0088603	3300046519	Bacteria	1470
353	Ga0495637_0114393	3300046520	Bacteria	1043
354	Ga0495644_0017406	3300046523	Bacteria	2748
355	Ga0495648_0004602	3300046524	Bacteria	11747
356	Ga0495654_0000020	3300046530	Bacteria	284814
357	Ga0495654_0000386	3300046530	Bacteria	38102
358	Ga0495654_0003433	3300046530	Bacteria	9714
359	Ga0495597_0000053	3300046542	Bacteria	95455
360	Ga0495625_0008589	3300046660	Bacteria	8693
361	Ga0495588_0007814	3300046674	Bacteria	4884
362	Ga0495671_0003554	3300046692	Bacteria	9523
363	Ga0495649_0003696	3300046694	Bacteria	10180
364	Ga0495649_0006030	3300046694	Bacteria	7579
365	Ga0495589_0000006	3300046794	Bacteria	303635
366	Ga0495660_0000007	3300046810	Bacteria	485295
367	Ga0495660_0000011	3300046810	Bacteria	361397
368	Ga0495672_0000004	3300047320	Bacteria	631810
369	Ga0495672_0000027	3300047320	Bacteria	325651
370	Ga0495679_000080	3300047446	Bacteria	90450
371	Ga0495679_002092	3300047446	Bacteria	10523
372	Ga0495673_0000023	3300047469	Bacteria	539904
373	Ga0495673_0000930	3300047469	Bacteria	26532
374	Ga0495681_0081428	3300047470	Bacteria	1444
375	Ga0496100_0264425	3300048903	Bacteria	1277
376	Ga0496103_0107711	3300048906	Bacteria	1768
377	Ga0496104_0000810	3300048907	Bacteria	26903
378	Ga0496104_0005159	3300048907	Bacteria	11412
379	Ga0496116_0000031	3300048919	Bacteria	420043
380	Ga0496116_0000054	3300048919	Bacteria	289010
381	Ga0496116_0000170	3300048919	Bacteria	131308
382	Ga0496116_0005721	3300048919	Bacteria	11437
383	Ga0496116_0026931	3300048919	Bacteria	4192
384	Ga0496117_0001230	3300048920	Bacteria	38361
385	Ga0496117_0007239	3300048920	Bacteria	10915
386	Ga0496117_0032079	3300048920	Bacteria	3998
387	Ga0496118_0006433	3300048921	Bacteria	12911
388	Ga0496118_0017095	3300048921	Bacteria	6621
389	Ga0496118_0021230	3300048921	Bacteria	5724
390	Ga0496118_0238329	3300048921	Bacteria	1043
391	Ga0496119_0000078	3300048922	Bacteria	140556
392	Ga0496119_0001296	3300048922	Bacteria	30892
393	Ga0496119_0008099	3300048922	Bacteria	9315
394	Ga0496119_0008475	3300048922	Bacteria	9022
395	Ga0496119_0010104	3300048922	Bacteria	7975
396	Ga0496119_0017994	3300048922	Bacteria	5284
397	Ga0496120_0000009	3300048923	Bacteria	386727
398	Ga0496120_0000265	3300048923	Bacteria	87441
399	Ga0496120_0004921	3300048923	Bacteria	10868
400	Ga0496120_0004997	3300048923	Bacteria	10775
401	Ga0496120_0016275	3300048923	Bacteria	4865
402	Ga0496121_0011365	3300048924	Bacteria	9896
403	Ga0496121_0011922	3300048924	Bacteria	9568
404	Ga0496121_0025092	3300048924	Bacteria	5673
405	Ga0496121_0522535	3300048924	Bacteria	748
406	Ga0496122_0000013	3300048925	Bacteria	501039
407	Ga0496122_0000145	3300048925	Bacteria	165864
408	Ga0496122_0001097	3300048925	Bacteria	46853
409	Ga0496122_0126830	3300048925	Bacteria	1631
410	Ga0496123_0000010	3300048926	Bacteria	501039
411	Ga0496123_0000281	3300048926	Bacteria	100416
412	Ga0496123_0003720	3300048926	Bacteria	16781
413	Ga0496123_0046502	3300048926	Bacteria	2943
414	Ga0496123_0185967	3300048926	Bacteria	1079
415	Ga0496124_0000010	3300048927	Bacteria	595157
416	Ga0496124_0000122	3300048927	Bacteria	161741
417	Ga0496124_0000217	3300048927	Bacteria	112197
418	Ga0496124_0018174	3300048927	Bacteria	6597
419	Ga0496124_0037018	3300048927	Bacteria	4247
420	Ga0496124_0221738	3300048927	Bacteria	1421
421	Ga0496125_0000019	3300048928	Bacteria	474989
422	Ga0496125_0000413	3300048928	Bacteria	79797
423	Ga0496125_0014092	3300048928	Bacteria	7809
424	Ga0496126_0000975	3300048929	Bacteria	49068
425	Ga0496126_0003612	3300048929	Bacteria	19344
426	Ga0496126_0165180	3300048929	Bacteria	1889
427	Ga0496126_0296497	3300048929	Bacteria	1335
428	Ga0495678_004114	3300049459	Bacteria	8613
429	Ga0495682_0000004	3300049460	Bacteria	378337
430	Ga0501300_004804	3300049523	Bacteria	1998
431	Ga0501335_028091	3300049551	Bacteria	626
432	Ga0501032_0085799	3300049569	Bacteria	2093
433	Ga0501033_0006249	3300049570	Bacteria	9335
434	Ga0501034_0001310	3300049571	Bacteria	33696
435	Ga0501034_0191681	3300049571	Bacteria	2006
436	Ga0501034_0716157	3300049571	Bacteria	898
437	Ga0501036_0074072	3300049572	Bacteria	2879
438	Ga0501037_0023888	3300049573	Bacteria	4521
439	Ga0501038_0040839	3300049574	Bacteria	4048
440	Ga0501043_0005342	3300049579	Bacteria	10380
441	Ga0501047_0371184	3300049581	Bacteria	1266
442	Ga0501073_0095173	3300049589	Bacteria	2069
443	Ga0501225_0102587	3300049705	Bacteria	837
444	Ga0501079_0061051	3300049741	Bacteria	2908
445	Ga0501080_0024799	3300049742	Bacteria	5561
446	Ga0501280_000298	3300049776	Bacteria	12518
447	Ga0501035_0025328	3300049822	Bacteria	5439
448	Ga0501044_0050951	3300049823	Bacteria	4270
449	nmdc:mga00v17_253652_c1	3300050491	Bacteria	1141
450	nmdc:mga00v17_44237_c1	3300050491	Bacteria	2685
451	nmdc:mga0qj67_653187_c1	3300050509	Bacteria	839
452	Ga0500643_000735	3300053087	Bacteria	21414
453	Ga0500607_098537	3300053121	Bacteria	1456
454	Ga0500621_000001	3300053126	Bacteria	1049698
455	Ga0500568_0006902	3300053139	Bacteria	5641
456	Ga0500573_0065946	3300053140	Bacteria	2070
457	Ga0500622_0000001	3300053156	Bacteria	657715
458	Ga0500636_0000369	3300053177	Bacteria	24646
459	Ga0500637_0004567	3300053178	Bacteria	6587
460	Ga0500625_029348	3300053729	Bacteria	2611
461	Ga0501082_0152405	3300060353	Bacteria	2008
462	2506577021	2506520007	Bacteria	5442880
463	2506582159	2506520008	Bacteria	5443009
464	2508850997	2508501071	Bacteria	5454741
465	2526211855	2526164512	Bacteria	4025691
466	2538428277	2537561728	Bacteria	5149301
467	2547375899	2547132103	Bacteria	5115736
468	2548848809	2547132512	Bacteria	3416496
469	2555259487	2554235234	Bacteria	5762085
470	2562466217	2561511199	Bacteria	5155034
471	2585828322	2585427591	Bacteria	5482980
472	2585831379	2585427592	Bacteria	5370892
473	2599412066	2599185169	Bacteria	5441380
474	2601525244	2600255254	Bacteria	5281859
475	2601530431	2600255255	Bacteria	5282785
476	2601531668	2600255256	Bacteria	5597742
477	2601537040	2600255257	Bacteria	5597196
478	2601616965	2600255280	Bacteria	5292309
479	2601621688	2600255281	Bacteria	5288753
480	2601644900	2600255287	Bacteria	5210468
481	2601650588	2600255288	Bacteria	5282738
482	2601655012	2600255289	Bacteria	5281907
483	2601660321	2600255290	Bacteria	5282218
484	2601665130	2600255291	Bacteria	5217298
485	2601697745	2600255298	Bacteria	5215185
486	2601703133	2600255299	Bacteria	5218662
487	2601708168	2600255300	Bacteria	5287774
488	2601713261	2600255301	Bacteria	5280532
489	2601718571	2600255302	Bacteria	5288235
490	2601723294	2600255303	Bacteria	5219315
491	2601728196	2600255304	Bacteria	5283973
492	2601733519	2600255305	Bacteria	5282329
493	2601738180	2600255306	Bacteria	5281613
494	2601742303	2600255307	Bacteria	5439064
495	2601753517	2600255309	Bacteria	5431045
496	2601755386	2600255310	Bacteria	5600903
497	2601760753	2600255311	Bacteria	5598766
498	2602020096	2600255392	Bacteria	5437392
499	2603639203	2602042046	Bacteria	5483348
500	2603643643	2602042047	Bacteria	4697674
501	2603661926	2602042052	Bacteria	5215873
502	2603666824	2602042053	Bacteria	5214361
503	2603700226	2602042066	Bacteria	4423871
504	2603704216	2602042067	Bacteria	4863713
505	2603840632	2602042103	Bacteria	5284714
506	2603845706	2602042104	Bacteria	5281639
507	2603850779	2602042105	Bacteria	5282303
508	2603855849	2602042106	Bacteria	5282744
509	2603866378	2602042109	Bacteria	5152801
510	2603873430	2602042110	Bacteria	5283285
511	2603877520	2602042111	Bacteria	5212080
512	2606050608	2603880178	Bacteria	5283018
513	2606071256	2603880184	Bacteria	5217896
514	2606148292	2603880202	Bacteria	5284684
515	2606178499	2603880211	Bacteria	5284226
516	2637226814	2636415599	Bacteria	5718434
517	2656279390	2654587920	Bacteria	5475511
518	2671102146	2667528172	Bacteria	5170840
519	2671108475	2667528173	Bacteria	5375747
520	2671585291	2671180115	Bacteria	5353919
521	2676407034	2675903046	Bacteria	5451247
522	2681995977	2681812866	Bacteria	4552357
523	2682008995	2681812869	Bacteria	5014465
524	2689443421	2687453601	Bacteria	5546041
525	2707099599	2706794495	Bacteria	4536932
526	2712470604	2711768156	Bacteria	4471618
527	2753854845	2751185917	Bacteria	4551186
528	2765587711	2765235842	Bacteria	4799256
529	2772437547	2772190666	Bacteria	5117644
530	2775541890	2775506706	Bacteria	4873073
531	2777022538	2775507074	Bacteria	5532402
532	2792313637	2791355010	Bacteria	4864581
533	2793406615	2791355275	Bacteria	4429597
534	2807179752	2806310673	Bacteria	4801221
535	2813730246	2811995292	Bacteria	5303342
536	2814697837	2814123068	Bacteria	5687681
537	2821118625	2821118458	Bacteria	4714306
538	2823377173	2823373977	Bacteria	4779415
539	2843691601	2843690924	Bacteria	5169057
540	2844426396	2844425489	Bacteria	4854065
541	2846035444	2846033681	Bacteria	4377894
542	2846040194	2846037992	Bacteria	4526407
543	2846541392	2846540461	Bacteria	5471451
544	2847088796	2847085930	Bacteria	5070450
545	2852103475	2852103415	Bacteria	5193810
546	2854602597	2854601825	Bacteria	4797592
547	2855198910	2855195626	Bacteria	4927512
548	2858469878	2858466076	Bacteria	4722413
549	2869552832	2869551831	Bacteria	5474685
550	2871276781	2871272651	Bacteria	5042015
551	2871283978	2871282230	Bacteria	4917173
552	2884090136	2884086401	Bacteria	5005459
553	2888367566	2888366609	Bacteria	5155009
554	2888374739	2888373701	Bacteria	5098052
555	2891674842	2891670763	Bacteria	4967099
556	2900054322	2900051742	Bacteria	4985156
557	2904474853	2904474040	Bacteria	5504324
558	2904505710	2904504865	Bacteria	5152820
559	2904515080	2904513164	Bacteria	5476410
560	2908671326	2908669403	Bacteria	5740494
561	2919109927	2919108558	Bacteria	5897419
562	2919151199	2919150387	Bacteria	5500879
563	2923638260	2923634449	Bacteria	4753480
564	2927146073	2927143783	Bacteria	5504251
565	2927835303	2927833300	Bacteria	4923934
566	2932407462	2932406140	Bacteria	5134491
567	2937542820	2937539931	Bacteria	4639830
568	2937972082	2937967321	Bacteria	5094075
569	2939570788	2939568625	Bacteria	4542555
570	2939574955	2939573065	Bacteria	4926053
571	2939579372	2939577877	Bacteria	5132791
572	2939610850	2939607340	Bacteria	4719256
573	2939644894	2939642701	Bacteria	4475280
574	2969083797	2969079654	Bacteria	5439582
575	2971825269	2971820967	Bacteria	5823634
576	2974313357	2974310843	Bacteria	4947816
577	2984560899	2984559226	Bacteria	5683096
578	2984598974	2984595703	Bacteria	5682994
579	2998345881	2998344455	Bacteria	4222996
580	640936577	640753048	Bacteria	5495657
581	8004594251	8004592986	Bacteria	5122074
582	8015398845	8015394850	Bacteria	5064660
583	8018222383	8018221730	Bacteria	4616064
584	8018406579	8018405270	Bacteria	4978981
585	8054846366	8054844752	Bacteria	4450330
586	8054849344	8054849141	Bacteria	5232694
587	8055089951	8055087960	Bacteria	4784273
588	8055096417	8055092621	Bacteria	4873875
589	8055101409	8055097453	Bacteria	4865496
590	8057306333	8057304971	Bacteria	4649742
591	Ga0453683_0179333
592	JGI25162J39368_1000003
593	JGI25163J39215_1000062
594	JGI25164J39214_1000009
595	JGI25165J46597_1017328
596	rootH2_10015620
597	Ga0055538_1000005
598	Ga0055539_1000007
599	Ga0055533_1000009
600	Ga0055525_1000010
601	Ga0055541_1000005
602	Ga0058692_1001175
603	Ga0058692_1031678
604	Ga0058862_12009584
605	Ga0058862_12846961
606	Ga0065703_1019868
607	Ga0065704_10000444
608	Ga0065704_10000805
609	Ga0065704_10355730
610	Ga0070660_100454887
611	Ga0070661_100690102
612	Ga0070659_100605168
613	Ga0070698_100204857
614	Ga0070665_100002124
615	Ga0068857_100035370
616	Ga0068851_10073993
617	Ga0081455_10419118
618	Ga0075364_10001196
619	Ga0075364_10357735
620	Ga0075364_10528249
621	Ga0075367_10492900
622	Ga0075366_10017456
623	Ga0075366_10038652
624	Ga0075428_100620870
625	Ga0075430_100032821
626	Ga0079104_1000166
627	Ga0079104_1000174
628	Ga0079104_1000192
629	Ga0079104_1000578
630	Ga0079104_1000845
631	Ga0079104_1001233
632	Ga0105251_10000254
633	Ga0105251_10000827
634	Ga0105251_10001719
635	Ga0105251_10001743
636	Ga0105251_10001955
637	Ga0105251_10003499
638	Ga0105251_10069159
639	Ga0105244_10000031
640	Ga0105244_10000041
641	Ga0105244_10000105
642	Ga0105244_10001211
643	Ga0105244_10002072
644	Ga0105244_10031954
645	Ga0105250_10000003
646	Ga0105250_10000052
647	Ga0105250_10000150
648	Ga0105250_10000320
649	Ga0105250_10003644
650	Ga0105250_10010479
651	Ga0105250_10097781
652	Ga0105240_10342309
653	Ga0105247_10000191
654	Ga0105243_10289713
655	Ga0105241_10000004
656	Ga0105237_10029153
657	Ga0105237_10618255
658	Ga0105239_10810406
659	Ga0105239_11499317
660	Ga0157373_10030819
661	Ga0157373_10087601
662	Ga0157373_10116591
663	Ga0157371_10000007
664	Ga0157370_10000122
665	Ga0163162_10175717
666	Ga0157372_10006185
667	Ga0157372_10046090
668	Ga0157372_10347858
669	Ga0182008_10004036
670	Ga0182006_1000020
671	Ga0182006_1132128
672	Ga0183366_1001
673	Ga0183370_1001
674	Ga0183369_1001
675	Ga0183368_1001
676	Ga0163161_10000004
677	Ga0163161_10033976
678	Ga0206354_11367514
679	Ga0213872_10000414
680	Ga0213872_10000807
681	Ga0213872_10002543
682	Ga0213872_10006294
683	Ga0213876_10347102
684	Ga0209760_100069
685	Ga0209784_100001
686	Ga0209566_100001
687	Ga0209674_100002
688	Ga0209563_100008
689	Ga0207427_100002
690	Ga0209437_100007
691	Ga0209677_100004
692	Ga0209233_1003111
693	Ga0207696_1000003
694	Ga0207696_1000004
695	Ga0207696_1000007
696	Ga0207696_1000033
697	Ga0207696_1000313
698	Ga0207696_1001321
699	Ga0207696_1017107
700	Ga0207696_1052151
701	Ga0207655_1000001
702	Ga0207655_1000011
703	Ga0207655_1000029
704	Ga0207655_1000087
705	Ga0207655_1000121
706	Ga0207655_1000226
707	Ga0207655_1000404
708	Ga0207655_1000559
709	Ga0207655_1029382
710	Ga0207713_1000005
711	Ga0207713_1000038
712	Ga0207713_1000065
713	Ga0207713_1000108
714	Ga0207713_1000155
715	Ga0207713_1001769
716	Ga0207713_1006287
717	Ga0207713_1046152
718	Ga0207713_1118598
719	Ga0207713_1139314
720	Ga0207710_10000016
721	Ga0207654_10000006
722	Ga0207695_10218033
723	Ga0207657_10332546
724	Ga0207690_10533057
725	Ga0207709_10007879
726	Ga0207674_10078122
727	Ga0209281_1000001
728	Ga0209281_1000008
729	Ga0209281_1000021
730	Ga0209281_1000075
731	Ga0209281_1000093
732	Ga0209281_1000254
733	Ga0209281_1000480
734	Ga0209281_1000492
735	Ga0209281_1001723
736	Ga0209281_1002685
737	Ga0209281_1004290
738	Ga0209371_1000001
739	Ga0209371_1000104
740	Ga0209371_1000946
741	Ga0209371_1001819
742	Ga0209371_1008692
743	Ga0268266_10000165
744	Ga0265323_10021331
745	Ga0265336_10000185
746	Ga0265338_10093790
747	Ga0265338_10519268
748	Ga0265324_10000011
749	Ga0265324_10002330
750	Ga0265324_10008459
751	Ga0268256_1000001
752	Ga0268256_1000017
753	Ga0268256_1001277
754	Ga0268256_1001587
755	Ga0265330_10002891
756	Ga0265332_10000039
757	Ga0265328_10000002
758	Ga0265328_10054967
759	Ga0265325_10001032
760	Ga0265325_10030654
761	Ga0265331_10000012
762	Ga0265331_10000019
763	Ga0265331_10007377
764	Ga0265331_10024100
765	Ga0265331_10035018
766	Ga0265331_10053191
767	Ga0265331_10096111
768	Ga0265331_10153338
769	Ga0265327_10000068
770	Ga0265327_10000173
771	Ga0265327_10000471
772	Ga0265327_10001224
773	Ga0265327_10012104
774	Ga0265327_10039452
775	Ga0265316_10027461
776	Ga0265316_10077865
777	Ga0265316_10099394
778	Ga0265316_10100700
779	Ga0265316_10115723
780	Ga0307509_10000018
781	Ga0307508_10211792
782	Ga0307514_10065978
783	Ga0316575_10003181
784	Ga0265314_10000262
785	Ga0265314_10000307
786	Ga0316577_10006905
787	Ga0316583_10002950
788	Ga0316583_10003069
789	Ga0316583_10097330
790	Ga0316593_10009940
791	Ga0316593_10014448
792	Ga0316593_10049646
793	Ga0316593_10071464
794	Ga0316593_10201503
795	Ga0316593_10216189
796	Ga0316592_1025299
797	Ga0316592_1046926
798	Ga0316592_1096122
799	Ga0316592_1104706
800	Ga0316588_1017969
801	Ga0316588_1026857
802	Ga0316587_1006039
803	Ga0316587_1053472
804	Ga0316587_1056118
805	Ga0316587_1058650
806	Ga0316587_1060212
807	Ga0316596_1034049
808	Ga0316596_1060269
809	Ga0316596_1069406
810	Ga0316596_1070046
811	Ga0316596_1078928
812	Ga0316596_1109012
813	Ga0316596_1117778
814	Ga0316596_1118563
815	Ga0316596_1121170
816	Ga0316596_1126447
817	Ga0316596_1126516
818	Ga0316596_1144099
819	Ga0316596_1145931
820	Ga0316574_0000014
821	Ga0316582_0010254
822	Ga0316582_0782235
823	Ga0316584_0023544
824	Ga0316584_0134659
825	Ga0373925_0885176
826	Ga0400484_20914
827	Ga0400484_39735
828	Ga0400490_05485
829	Ga0400490_36510
830	Ga0400490_37780
831	Ga0400490_47679
832	Ga0400491_19719
833	Ga0400485_02110
834	Ga0400485_08080
835	Ga0400488_07068
836	Ga0400488_14649
837	Ga0400488_19178
838	Ga0400488_38786
839	Ga0400486_13079
840	Ga0400486_26530
841	Ga0400486_30938
842	Ga0400483_011695
843	Ga0400483_059991
844	Ga0400483_067420
845	Ga0400483_076262
846	Ga0400483_089669
847	Ga0400483_136165
848	Ga0400483_194015
849	Ga0400483_199105
850	Ga0400483_254574
851	Ga0400487_06586
852	Ga0400487_13389
853	Ga0400487_22173
854	Ga0400487_33200
855	Ga0400487_47932
856	Ga0400487_55141
857	Ga0400487_64640
858	Ga0436365_1871244
859	Ga0436361_0041735
860	Ga0436361_0071841
861	Ga0436361_0105560
862	Ga0436361_0164497
863	Ga0436361_0432960
864	Ga0436361_0718861
865	Ga0436361_1190835
866	Ga0439438_000763
867	Ga0439447_002208
868	Ga0451837_0353250
869	Ga0439432_030031
870	Ga0439432_077141
871	Ga0439452_000003
872	Ga0439452_000040
873	Ga0439452_000361
874	Ga0439456_028189
875	Ga0450900_005690
876	Ga0439464_0053824
877	Ga0451577_0000085
878	Ga0451577_0000104
879	Ga0451577_0000134
880	Ga0451577_0000280
881	Ga0451577_0002253
882	Ga0451577_0008429
883	Ga0451577_0008841
884	Ga0451577_0017350
885	Ga0451577_0026030
886	Ga0451577_0076242
887	Ga0451577_0093736
888	Ga0451577_0247423
889	Ga0451577_0333951
890	Ga0466981_0000161
891	Ga0453683_0000047
892	Ga0453683_0188086
893	Ga0453683_0628347
894	Ga0453683_0748547
895	Ga0453683_1041375
896	Ga0466961_0000231
897	Ga0453684_0000063
898	Ga0453684_0000065
899	Ga0453684_0000273
900	Ga0453684_0000302
901	Ga0453684_0000364
902	Ga0453684_0000426
903	Ga0453684_0000953
904	Ga0453684_0001142
905	Ga0453684_0001472
906	Ga0453684_0001751
907	Ga0453684_0011803
908	Ga0453684_0021396
909	Ga0453684_0026506
910	Ga0453684_0036731
911	Ga0453684_0074999
912	Ga0453684_0082608
913	Ga0453684_0148279
914	Ga0453684_0172521
915	Ga0453684_0259570
916	Ga0453684_0295728
917	Ga0453684_0307672
918	Ga0466959_0080307
919	Ga0451576_0000006
920	Ga0451576_0000056
921	Ga0451576_0000116
922	Ga0451576_0000659
923	Ga0451576_0001853
924	Ga0451576_0002503
925	Ga0451576_0002526
926	Ga0451576_0018576
927	Ga0451576_0020304
928	Ga0451576_0037768
929	Ga0451576_0046204
930	Ga0451576_0047488
931	Ga0451576_0168985
932	Ga0495627_000136
933	Ga0495591_008507
934	Ga0495638_0064293
935	Ga0495650_0000016
936	Ga0495650_0000033
937	Ga0495650_0000205
938	Ga0495584_0011843
939	Ga0495607_0012669
940	Ga0495606_0000296
941	Ga0495631_0097091
942	Ga0495632_0088603
943	Ga0495637_0114393
944	Ga0495644_0017406
945	Ga0495648_0004602
946	Ga0495654_0000020
947	Ga0495654_0000386
948	Ga0495654_0003433
949	Ga0495597_0000053
950	Ga0495625_0008589
951	Ga0495588_0007814
952	Ga0495671_0003554
953	Ga0495649_0003696
954	Ga0495649_0006030
955	Ga0495589_0000006
956	Ga0495660_0000007
957	Ga0495660_0000011
958	Ga0495672_0000004
959	Ga0495672_0000027
960	Ga0495679_000080
961	Ga0495679_002092
962	Ga0495673_0000023
963	Ga0495673_0000930
964	Ga0495681_0081428
965	Ga0496100_0264425
966	Ga0496103_0107711
967	Ga0496104_0000810
968	Ga0496104_0005159
969	Ga0496116_0000031
970	Ga0496116_0000054
971	Ga0496116_0000170
972	Ga0496116_0005721
973	Ga0496116_0026931
974	Ga0496117_0001230
975	Ga0496117_0007239
976	Ga0496117_0032079
977	Ga0496118_0006433
978	Ga0496118_0017095
979	Ga0496118_0021230
980	Ga0496118_0238329
981	Ga0496119_0000078
982	Ga0496119_0001296
983	Ga0496119_0008099
984	Ga0496119_0008475
985	Ga0496119_0010104
986	Ga0496119_0017994
987	Ga0496120_0000009
988	Ga0496120_0000265
989	Ga0496120_0004921
990	Ga0496120_0004997
991	Ga0496120_0016275
992	Ga0496121_0011365
993	Ga0496121_0011922
994	Ga0496121_0025092
995	Ga0496121_0522535
996	Ga0496122_0000013
997	Ga0496122_0000145
998	Ga0496122_0001097
999	Ga0496122_0126830
1000	Ga0496123_0000010
1001	Ga0496123_0000281
1002	Ga0496123_0003720
1003	Ga0496123_0046502
1004	Ga0496123_0185967
1005	Ga0496124_0000010
1006	Ga0496124_0000122
1007	Ga0496124_0000217
1008	Ga0496124_0018174
1009	Ga0496124_0037018
1010	Ga0496124_0221738
1011	Ga0496125_0000019
1012	Ga0496125_0000413
1013	Ga0496125_0014092
1014	Ga0496126_0000975
1015	Ga0496126_0003612
1016	Ga0496126_0165180
1017	Ga0496126_0296497
1018	Ga0495678_004114
1019	Ga0495682_0000004
1020	Ga0501300_004804
1021	Ga0501335_028091
1022	Ga0501032_0085799
1023	Ga0501033_0006249
1024	Ga0501034_0001310
1025	Ga0501034_0191681
1026	Ga0501034_0716157
1027	Ga0501036_0074072
1028	Ga0501037_0023888
1029	Ga0501038_0040839
1030	Ga0501043_0005342
1031	Ga0501047_0371184
1032	Ga0501073_0095173
1033	Ga0501225_0102587
1034	Ga0501079_0061051
1035	Ga0501080_0024799
1036	Ga0501280_000298
1037	Ga0501035_0025328
1038	Ga0501044_0050951
1039	nmdc:mga00v17_253652_c1
1040	nmdc:mga00v17_44237_c1
1041	nmdc:mga0qj67_653187_c1
1042	Ga0500643_000735
1043	Ga0500607_098537
1044	Ga0500621_000001
1045	Ga0500568_0006902
1046	Ga0500573_0065946
1047	Ga0500622_0000001
1048	Ga0500636_0000369
1049	Ga0500637_0004567
1050	Ga0500625_029348
1051	Ga0501082_0152405
1052	2506577021
1053	2506582159
1054	2508850997
1055	2526211855
1056	2538428277
1057	2547375899
1058	2548848809
1059	2555259487
1060	2562466217
1061	2585828322
1062	2585831379
1063	2599412066
1064	2601525244
1065	2601530431
1066	2601531668
1067	2601537040
1068	2601616965
1069	2601621688
1070	2601644900
1071	2601650588
1072	2601655012
1073	2601660321
1074	2601665130
1075	2601697745
1076	2601703133
1077	2601708168
1078	2601713261
1079	2601718571
1080	2601723294
1081	2601728196
1082	2601733519
1083	2601738180
1084	2601742303
1085	2601753517
1086	2601755386
1087	2601760753
1088	2602020096
1089	2603639203
1090	2603643643
1091	2603661926
1092	2603666824
1093	2603700226
1094	2603704216
1095	2603840632
1096	2603845706
1097	2603850779
1098	2603855849
1099	2603866378
1100	2603873430
1101	2603877520
1102	2606050608
1103	2606071256
1104	2606148292
1105	2606178499
1106	2637226814
1107	2656279390
1108	2671102146
1109	2671108475
1110	2671585291
1111	2676407034
1112	2681995977
1113	2682008995
1114	2689443421
1115	2707099599
1116	2712470604
1117	2753854845
1118	2765587711
1119	2772437547
1120	2775541890
1121	2777022538
1122	2792313637
1123	2793406615
1124	2807179752
1125	2813730246
1126	2814697837
1127	2821118625
1128	2823377173
1129	2843691601
1130	2844426396
1131	2846035444
1132	2846040194
1133	2846541392
1134	2847088796
1135	2852103475
1136	2854602597
1137	2855198910
1138	2858469878
1139	2869552832
1140	2871276781
1141	2871283978
1142	2884090136
1143	2888367566
1144	2888374739
1145	2891674842
1146	2900054322
1147	2904474853
1148	2904505710
1149	2904515080
1150	2908671326
1151	2919109927
1152	2919151199
1153	2923638260
1154	2927146073
1155	2927835303
1156	2932407462
1157	2937542820
1158	2937972082
1159	2939570788
1160	2939574955
1161	2939579372
1162	2939610850
1163	2939644894
1164	2969083797
1165	2971825269
1166	2974313357
1167	2984560899
1168	2984598974
1169	2998345881
1170	640936577
1171	8004594251
1172	8015398845
1173	8018222383
1174	8018406579
1175	8054846366
1176	8054849344
1177	8055089951
1178	8055096417
1179	8055101409
1180	8057306333

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

40

173

0.98 PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

193

228

0.96 PF08534

Redoxin

39

188

0.89 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6khx-assembly1.cif.gz_H	crystal structure of prx from akkermansia muciniphila	0.966	1	195
2z9s-assembly1.cif.gz_G	crystal structure analysis of rat hbp23/peroxiredoxin i, cys52ser mutant	0.9645	4	195
3tkr-assembly1.cif.gz_A	crystal structure of full-length human peroxiredoxin 4 with t118e mutation	0.9632	4	195
4llr-assembly1.cif.gz_E	tryparedoxin peroxidase (txnpx) from trypanosoma cruzi in the reduced state	0.9616	4	194
3tkq-assembly1.cif.gz_B-2	crystal structure of full-length human peroxiredoxin 4 with mixed conformation	0.9611	4	186

ID	Description	Score	Start	End	Superfamily
af_A0A0R4J2P7_61_260_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9535	1	194	3.40.30.10
af_Q8I5Q6_15_214_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9507	1	200	3.40.30.10
5dvbA00	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9486	4	195	3.40.30.10
2c0dA00	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9467	3	172	3.40.30.10
5ijtA00	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9432	4	163	3.40.30.10

ID	Description	Score	Start	End
AF-A0A6N6X8E0-F1-model_v4	deleted	0.9921	1	168
AF-A0A7H4NPY3-F1-model_v4	deleted	0.992	1	181
AF-H8NW63-F1-model_v4	deleted	0.9917	1	200
AF-A0A3S4DK11-F1-model_v4	deleted	0.9911	74	200
AF-A0A3N2E2E5-F1-model_v4	deleted	0.991	1	200

F466992

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00578

AhpC-TSA

AhpC/TSA family

40

173

0.98

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

193

228

0.96

PF08534

Redoxin

Redoxin

39

188

0.89

Structural Annotation

Top 5 Hits

Map