F466994

General Info

Members Datasets Scaffolds Average Seq Length
590 250 590 221

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0186532|Ga0495605_0186532_138_818
Length 218
Sequence MTSVLVVDNYDSFTYNLVQYLGELGADVDVVRNDLPELLERSPDRVIVSPGPCTPEEAGLSKEAIRRYGESGVPVLGVCLGHQALAAEYGGTVVRGEPVHGKTAEAEHDGRTIFDGLESPLVVGRYHSLVVDPELPGELDVSARSGDVIMGLRHRELPVEGVQFHPESVLTPDGPHLLANFLRLAGEGEASRLDAVSGSFATRGMAEPVPTGPVVAAR

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
126 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
131 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
132 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
167 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
168 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
169 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
170 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
171 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
172 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
173 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
174 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 7.12
Rhizosphere 92.37
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000384 3300003373 Bacteria 8473
2 JGI25407J50210_10008373 3300003373 Bacteria 2606
3 JGI25407J50210_10008634 3300003373 Bacteria 2571
4 Ga0070676_10225057 3300005328 Bacteria 1241
5 Ga0070683_100331571 3300005329 Bacteria 1449
6 Ga0070683_100447208 3300005329 Bacteria 1233
7 Ga0070690_100255203 3300005330 Bacteria 1242
8 Ga0070670_100141746 3300005331 Bacteria 2079
9 Ga0068869_100076415 3300005334 Bacteria 2489
10 Ga0068869_100087819 3300005334 Bacteria 2333
11 Ga0070680_100000064 3300005336 Bacteria 55845
12 Ga0070680_100712160 3300005336 Bacteria 864
13 Ga0070682_100339745 3300005337 Bacteria 1116
14 Ga0068868_100100944 3300005338 Bacteria 2335
15 Ga0070689_100201695 3300005340 Bacteria 1625
16 Ga0070691_10008010 3300005341 Bacteria 4834
17 Ga0070691_10037662 3300005341 Bacteria 2283
18 Ga0070691_10070815 3300005341 Bacteria 1692
19 Ga0070687_100255732 3300005343 Bacteria 1090
20 Ga0070661_100182156 3300005344 Bacteria 1599
21 Ga0070692_10025878 3300005345 Bacteria 2895
22 Ga0070692_10103055 3300005345 Bacteria 1567
23 Ga0070692_10443065 3300005345 Bacteria 830
24 Ga0070668_100011470 3300005347 Bacteria 6598
25 Ga0070674_100029199 3300005356 Bacteria 3629
26 Ga0070674_100214949 3300005356 Bacteria 1492
27 Ga0070673_100131649 3300005364 Bacteria 2099
28 Ga0070673_100714827 3300005364 Bacteria 921
29 Ga0070659_100603158 3300005366 Bacteria 944
30 Ga0070659_100663065 3300005366 Bacteria 900
31 Ga0070667_100751954 3300005367 Bacteria 904
32 Ga0070701_10131752 3300005438 Bacteria 1421
33 Ga0070705_100005866 3300005440 Bacteria 6004
34 Ga0070705_100241380 3300005440 Bacteria 1263
35 Ga0070700_100078768 3300005441 Bacteria 2122
36 Ga0070700_100163266 3300005441 Bacteria 1535
37 Ga0070694_100017300 3300005444 Bacteria 4553
38 Ga0070694_100064160 3300005444 Bacteria 2514
39 Ga0070694_100087291 3300005444 Bacteria 2181
40 Ga0070694_100179097 3300005444 Bacteria 1567
41 Ga0070708_100014626 3300005445 Bacteria 6463
42 Ga0070708_100023535 3300005445 Bacteria 5240
43 Ga0070708_100028591 3300005445 Bacteria 4799
44 Ga0070678_100018248 3300005456 Bacteria 4546
45 Ga0070678_100208932 3300005456 Bacteria 1616
46 Ga0070662_100000228 3300005457 Bacteria 33120
47 Ga0070662_100298687 3300005457 Bacteria 1308
48 Ga0070662_100632491 3300005457 Bacteria 902
49 Ga0068867_100038229 3300005459 Bacteria 3493
50 Ga0068867_100584452 3300005459 Bacteria 972
51 Ga0070685_10051119 3300005466 Bacteria 2389
52 Ga0070706_100001298 3300005467 Bacteria 26657
53 Ga0070706_100053774 3300005467 Bacteria 3716
54 Ga0070706_100074566 3300005467 Bacteria 3140
55 Ga0070706_100398623 3300005467 Bacteria 1281
56 Ga0070707_100002764 3300005468 Bacteria 16702
57 Ga0070707_100009095 3300005468 Bacteria 9208
58 Ga0070707_100056386 3300005468 Bacteria 3769
59 Ga0070707_100071130 3300005468 Bacteria 3352
60 Ga0070707_100117981 3300005468 Bacteria 2575
61 Ga0070707_100176638 3300005468 Bacteria 2081
62 Ga0070698_100003028 3300005471 Bacteria 18521
63 Ga0070698_100006530 3300005471 Bacteria 12648
64 Ga0070698_100061582 3300005471 Bacteria 3787
65 Ga0070698_100145909 3300005471 Bacteria 2316
66 Ga0070698_100598849 3300005471 Bacteria 1042
67 Ga0070699_100000533 3300005518 Bacteria 36015
68 Ga0070699_100001412 3300005518 Bacteria 22056
69 Ga0070699_100024630 3300005518 Bacteria 5188
70 Ga0070699_100044658 3300005518 Bacteria 3836
71 Ga0070699_100134244 3300005518 Bacteria 2183
72 Ga0070699_100359296 3300005518 Bacteria 1313
73 Ga0070679_100225581 3300005530 Bacteria 1834
74 Ga0070684_100225949 3300005535 Bacteria 1708
75 Ga0070697_100073972 3300005536 Bacteria 2798
76 Ga0070697_100096114 3300005536 Bacteria 2457
77 Ga0070697_100177333 3300005536 Bacteria 1805
78 Ga0070672_100594940 3300005543 Bacteria 963
79 Ga0070686_100048546 3300005544 Bacteria 2689
80 Ga0070686_100145804 3300005544 Bacteria 1653
81 Ga0070686_100146544 3300005544 Bacteria 1649
82 Ga0070686_100195965 3300005544 Bacteria 1445
83 Ga0070695_100022365 3300005545 Bacteria 3878
84 Ga0070695_100027940 3300005545 Bacteria 3498
85 Ga0070695_100068601 3300005545 Bacteria 2316
86 Ga0070695_100081802 3300005545 Bacteria 2137
87 Ga0070695_100244945 3300005545 Bacteria 1302
88 Ga0070696_100007041 3300005546 Bacteria 7506
89 Ga0070696_100008927 3300005546 Bacteria 6707
90 Ga0070696_100027854 3300005546 Bacteria 3853
91 Ga0070696_100035049 3300005546 Bacteria 3454
92 Ga0070696_100053303 3300005546 Bacteria 2815
93 Ga0070696_100137109 3300005546 Bacteria 1785
94 Ga0070696_100277816 3300005546 Bacteria 1276
95 Ga0070696_100598511 3300005546 Bacteria 889
96 Ga0070693_100112828 3300005547 Bacteria 1675
97 Ga0070693_100176663 3300005547 Bacteria 1372
98 Ga0070665_100936266 3300005548 Bacteria 879
99 Ga0070704_100010891 3300005549 Bacteria 5546
100 Ga0070704_100063555 3300005549 Bacteria 2650
101 Ga0070704_100241000 3300005549 Bacteria 1480
102 Ga0070704_100530696 3300005549 Bacteria 1026
103 Ga0068855_100346138 3300005563 Bacteria 1638
104 Ga0068854_100101461 3300005578 Bacteria 2158
105 Ga0068854_100357125 3300005578 Bacteria 1198
106 Ga0068856_100534511 3300005614 Bacteria 1193
107 Ga0070702_100222438 3300005615 Bacteria 1263
108 Ga0070702_100316526 3300005615 Bacteria 1086
109 Ga0068852_100491559 3300005616 Bacteria 1221
110 Ga0068864_100302880 3300005618 Bacteria 1497
111 Ga0068861_100075194 3300005719 Bacteria 2629
112 Ga0068861_100077267 3300005719 Bacteria 2596
113 Ga0068870_10194241 3300005840 Bacteria 1227
114 Ga0068870_10458578 3300005840 Bacteria 841
115 Ga0068860_100018613 3300005843 Bacteria 6755
116 Ga0081538_10000009 3300005981 Bacteria 172017
117 Ga0081538_10000228 3300005981 Bacteria 63185
118 Ga0081538_10000910 3300005981 Bacteria 31938
119 Ga0081538_10004702 3300005981 Bacteria 12501
120 Ga0081538_10072256 3300005981 Bacteria 1893
121 Ga0081538_10082242 3300005981 Bacteria 1709
122 Ga0081539_10005484 3300005985 Bacteria 12893
123 Ga0081539_10006087 3300005985 Bacteria 11789
124 Ga0081539_10022508 3300005985 Bacteria 4167
125 Ga0081539_10132234 3300005985 Bacteria 1224
126 Ga0075365_10061098 3300006038 Bacteria 2515
127 Ga0075432_10010541 3300006058 Bacteria 3139
128 Ga0075428_100000696 3300006844 Bacteria 34737
129 Ga0075428_100089339 3300006844 Bacteria 3360
130 Ga0075428_100186349 3300006844 Bacteria 2245
131 Ga0075428_100703316 3300006844 Bacteria 1076
132 Ga0075428_100729691 3300006844 Bacteria 1055
133 Ga0075428_100901308 3300006844 Bacteria 938
134 Ga0075430_100000245 3300006846 Bacteria 37686
135 Ga0075430_100003035 3300006846 Bacteria 14041
136 Ga0075430_100582725 3300006846 Bacteria 923
137 Ga0075431_100130755 3300006847 Bacteria 2589
138 Ga0075433_10058521 3300006852 Bacteria 3371
139 Ga0075433_10068092 3300006852 Bacteria 3125
140 Ga0075433_10155640 3300006852 Bacteria 2034
141 Ga0075433_10181143 3300006852 Bacteria 1875
142 Ga0075434_100466597 3300006871 Bacteria 1284
143 Ga0075434_100524546 3300006871 Bacteria 1205
144 Ga0075429_100168938 3300006880 Bacteria 1916
145 Ga0068865_100241437 3300006881 Bacteria 1422
146 Ga0068865_100272808 3300006881 Bacteria 1344
147 Ga0068865_100431336 3300006881 Bacteria 1086
148 Ga0075436_100410208 3300006914 Bacteria 982
149 Ga0075435_100045756 3300007076 Bacteria 3509
150 Ga0075435_100059372 3300007076 Bacteria 3100
151 Ga0075435_100573611 3300007076 Bacteria 978
152 Ga0111539_10009225 3300009094 Bacteria 12466
153 Ga0111539_10022563 3300009094 Bacteria 7733
154 Ga0111539_10096722 3300009094 Bacteria 3468
155 Ga0111539_10102433 3300009094 Bacteria 3360
156 Ga0111539_10175521 3300009094 Bacteria 2503
157 Ga0111539_10212035 3300009094 Bacteria 2256
158 Ga0111539_10250752 3300009094 Bacteria 2061
159 Ga0111539_11312623 3300009094 Bacteria 840
160 Ga0105245_10008333 3300009098 Bacteria 9058
161 Ga0105245_10009100 3300009098 Bacteria 8656
162 Ga0105245_10020624 3300009098 Bacteria 5779
163 Ga0105245_10124687 3300009098 Bacteria 2409
164 Ga0105245_10267973 3300009098 Bacteria 1664
165 Ga0105245_11172708 3300009098 Bacteria 816
166 Ga0114129_10005323 3300009147 Bacteria 18163
167 Ga0114129_10013759 3300009147 Bacteria 11532
168 Ga0114129_10126796 3300009147 Bacteria 3509
169 Ga0114129_10192522 3300009147 Bacteria 2768
170 Ga0114129_10315885 3300009147 Bacteria 2078
171 Ga0114129_10396210 3300009147 Bacteria 1820
172 Ga0114129_10557267 3300009147 Bacteria 1490
173 Ga0114129_11071309 3300009147 Bacteria 1011
174 Ga0114129_11390440 3300009147 Bacteria 866
175 Ga0105243_10078487 3300009148 Bacteria 2688
176 Ga0105243_10105549 3300009148 Bacteria 2347
177 Ga0105243_10214576 3300009148 Bacteria 1697
178 Ga0105243_10405830 3300009148 Bacteria 1267
179 Ga0105243_10415327 3300009148 Bacteria 1253
180 Ga0105242_10418065 3300009176 Bacteria 1256
181 Ga0105242_10523556 3300009176 Bacteria 1132
182 Ga0105248_10113242 3300009177 Bacteria 3059
183 Ga0105248_10394016 3300009177 Bacteria 1559
184 Ga0105248_10461018 3300009177 Bacteria 1433
185 Ga0105249_10282851 3300009553 Bacteria 1657
186 Ga0105249_10402664 3300009553 Bacteria 1399
187 Ga0105249_10613254 3300009553 Bacteria 1144
188 Ga0105249_10636036 3300009553 Bacteria 1124
189 Ga0105239_10102025 3300010375 Bacteria 3175
190 Ga0105239_10174430 3300010375 Bacteria 2405
191 Ga0105239_11249384 3300010375 Bacteria 856
192 Ga0105246_10004227 3300011119 Bacteria 8732
193 Ga0105246_10160959 3300011119 Bacteria 1710
194 Ga0157341_1013854 3300012494 Bacteria 725
195 Ga0157378_10010453 3300013297 Bacteria 8107
196 Ga0157378_10126886 3300013297 Bacteria 2358
197 Ga0157378_10159480 3300013297 Bacteria 2109
198 Ga0163162_10797683 3300013306 Bacteria 1062
199 Ga0157375_10070231 3300013308 Bacteria 3512
200 Ga0157375_10075773 3300013308 Bacteria 3389
201 Ga0157375_10127805 3300013308 Bacteria 2658
202 Ga0157375_10220745 3300013308 Bacteria 2054
203 Ga0163163_10011036 3300014325 Bacteria 8169
204 Ga0163163_10065884 3300014325 Bacteria 3597
205 Ga0163163_10081943 3300014325 Bacteria 3229
206 Ga0163163_10122588 3300014325 Bacteria 2634
207 Ga0163163_10587679 3300014325 Bacteria 1177
208 Ga0163163_10838727 3300014325 Bacteria 983
209 Ga0163163_11217776 3300014325 Bacteria 815
210 Ga0157380_10050282 3300014326 Bacteria 3292
211 Ga0157380_10083552 3300014326 Bacteria 2616
212 Ga0157380_10125486 3300014326 Bacteria 2181
213 Ga0157380_10832720 3300014326 Bacteria 943
214 Ga0182008_10195930 3300014497 Bacteria 1026
215 Ga0157377_10137687 3300014745 Bacteria 1497
216 Ga0157377_10254915 3300014745 Bacteria 1139
217 Ga0157377_10402686 3300014745 Bacteria 932
218 Ga0157379_10026752 3300014968 Bacteria 5135
219 Ga0157379_10147070 3300014968 Bacteria 2125
220 Ga0157376_10354240 3300014969 Bacteria 1406
221 Ga0157376_10365400 3300014969 Bacteria 1385
222 Ga0163161_10030447 3300017792 Bacteria 3842
223 Ga0163161_10635482 3300017792 Bacteria 883
224 Ga0207653_10009867 3300025885 Bacteria 2978
225 Ga0207688_10026193 3300025901 Bacteria 3205
226 Ga0207688_10107710 3300025901 Bacteria 1615
227 Ga0207645_10049873 3300025907 Bacteria 2673
228 Ga0207643_10011050 3300025908 Bacteria 4873
229 Ga0207684_10000544 3300025910 Bacteria 46474
230 Ga0207684_10015072 3300025910 Bacteria 6654
231 Ga0207684_10055603 3300025910 Bacteria 3357
232 Ga0207684_10063193 3300025910 Bacteria 3143
233 Ga0207684_10121752 3300025910 Bacteria 2237
234 Ga0207684_10132742 3300025910 Bacteria 2137
235 Ga0207707_10304964 3300025912 Bacteria 1376
236 Ga0207707_10656177 3300025912 Bacteria 884
237 Ga0207660_10000002 3300025917 Bacteria 883566
238 Ga0207662_10000902 3300025918 Bacteria 13729
239 Ga0207662_10096226 3300025918 Bacteria 1828
240 Ga0207662_10217754 3300025918 Bacteria 1242
241 Ga0207649_10073789 3300025920 Bacteria 2187
242 Ga0207652_10068593 3300025921 Bacteria 3077
243 Ga0207652_10138895 3300025921 Bacteria 2171
244 Ga0207646_10001034 3300025922 Bacteria 35529
245 Ga0207646_10011213 3300025922 Bacteria 8701
246 Ga0207646_10049169 3300025922 Bacteria 3777
247 Ga0207646_10167728 3300025922 Bacteria 1982
248 Ga0207646_10190873 3300025922 Bacteria 1850
249 Ga0207646_10206369 3300025922 Bacteria 1775
250 Ga0207646_10813386 3300025922 Bacteria 832
251 Ga0207659_10117514 3300025926 Bacteria 2032
252 Ga0207659_10444628 3300025926 Bacteria 1091
253 Ga0207687_10009376 3300025927 Bacteria 6402
254 Ga0207687_10189893 3300025927 Bacteria 1598
255 Ga0207687_10202605 3300025927 Bacteria 1552
256 Ga0207687_10396109 3300025927 Bacteria 1135
257 Ga0207690_10186632 3300025932 Bacteria 1565
258 Ga0207706_10001194 3300025933 Bacteria 26218
259 Ga0207706_10054176 3300025933 Bacteria 3540
260 Ga0207706_10327990 3300025933 Bacteria 1332
261 Ga0207706_10456245 3300025933 Bacteria 1105
262 Ga0207709_10138871 3300025935 Bacteria 1668
263 Ga0207709_10310840 3300025935 Bacteria 1176
264 Ga0207670_10082473 3300025936 Bacteria 2253
265 Ga0207669_10009430 3300025937 Bacteria 4648
266 Ga0207669_10402908 3300025937 Bacteria 1072
267 Ga0207704_10606773 3300025938 Bacteria 897
268 Ga0207689_10019890 3300025942 Bacteria 5655
269 Ga0207689_10150734 3300025942 Bacteria 1917
270 Ga0207689_10415177 3300025942 Bacteria 1123
271 Ga0207661_10060474 3300025944 Bacteria 3057
272 Ga0207679_10043376 3300025945 Bacteria 3238
273 Ga0207712_10024032 3300025961 Bacteria 4030
274 Ga0207712_10214304 3300025961 Bacteria 1536
275 Ga0207668_10010404 3300025972 Bacteria 5619
276 Ga0207640_10141621 3300025981 Bacteria 1754
277 Ga0207640_10620895 3300025981 Bacteria 917
278 Ga0207703_10120551 3300026035 Bacteria 2251
279 Ga0207678_10034056 3300026067 Bacteria 4436
280 Ga0207708_10033653 3300026075 Bacteria 3895
281 Ga0207708_10034375 3300026075 Bacteria 3856
282 Ga0207708_10107364 3300026075 Bacteria 2165
283 Ga0207708_10438107 3300026075 Bacteria 1086
284 Ga0207708_10500740 3300026075 Bacteria 1018
285 Ga0207702_10216018 3300026078 Bacteria 1785
286 Ga0207702_10575678 3300026078 Bacteria 1103
287 Ga0207702_10915650 3300026078 Bacteria 869
288 Ga0207641_10130510 3300026088 Bacteria 2256
289 Ga0207648_10001702 3300026089 Bacteria 24052
290 Ga0207648_10281707 3300026089 Bacteria 1486
291 Ga0207676_10027993 3300026095 Bacteria 4205
292 Ga0207676_10571306 3300026095 Bacteria 1083
293 Ga0207674_10121520 3300026116 Bacteria 2579
294 Ga0207674_10300389 3300026116 Bacteria 1554
295 Ga0207674_10503397 3300026116 Bacteria 1170
296 Ga0207675_100001702 3300026118 Bacteria 22036
297 Ga0207675_100133962 3300026118 Bacteria 2350
298 Ga0207675_100513518 3300026118 Bacteria 1194
299 Ga0207683_10007014 3300026121 Bacteria 9663
300 Ga0207683_10751394 3300026121 Bacteria 905
301 Ga0207698_10387528 3300026142 Bacteria 1331
302 Ga0207428_10100846 3300027907 Bacteria 2231
303 Ga0207428_10351100 3300027907 Bacteria 1085
304 Ga0207428_10368739 3300027907 Bacteria 1055
305 Ga0268266_10543452 3300028379 Bacteria 1113
306 Ga0268265_10096715 3300028380 Bacteria 2374
307 Ga0268264_10101913 3300028381 Bacteria 2497
308 Ga0265337_1018686 3300028556 Bacteria 2197
309 Ga0265326_10062635 3300028558 Bacteria 1052
310 Ga0265319_1005252 3300028563 Bacteria 6247
311 Ga0265319_1021747 3300028563 Bacteria 2349
312 Ga0265319_1039230 3300028563 Bacteria 1607
313 Ga0265334_10024542 3300028573 Bacteria 2444
314 Ga0265318_10048771 3300028577 Bacteria 1594
315 Ga0265323_10103147 3300028653 Bacteria 942
316 Ga0265322_10002802 3300028654 Bacteria 5324
317 Ga0265336_10009743 3300028666 Bacteria 3313
318 Ga0265336_10015457 3300028666 Bacteria 2509
319 Ga0265338_10436974 3300028800 Bacteria 928
320 Ga0265330_10018695 3300031235 Bacteria 3180
321 Ga0265330_10074475 3300031235 Bacteria 1467
322 Ga0265330_10163668 3300031235 Bacteria 944
323 Ga0265320_10006941 3300031240 Bacteria 7068
324 Ga0265320_10053955 3300031240 Bacteria 1941
325 Ga0265325_10024028 3300031241 Bacteria 3318
326 Ga0265325_10044683 3300031241 Bacteria 2306
327 Ga0265329_10016735 3300031242 Bacteria 2536
328 Ga0265329_10041734 3300031242 Bacteria 1470
329 Ga0265340_10023538 3300031247 Bacteria 3139
330 Ga0265339_10027919 3300031249 Bacteria 3214
331 Ga0265339_10052400 3300031249 Bacteria 2223
332 Ga0265339_10073359 3300031249 Bacteria 1820
333 Ga0265331_10026731 3300031250 Bacteria 2898
334 Ga0265316_10023257 3300031344 Bacteria 5209
335 Ga0307408_100026246 3300031548 Bacteria 3999
336 Ga0265314_10008799 3300031711 Bacteria 8626
337 Ga0265342_10040148 3300031712 Bacteria 2839
338 Ga0265342_10094154 3300031712 Bacteria 1714
339 Ga0307405_10023605 3300031731 Bacteria 3499
340 Ga0316577_10005620 3300031733 Bacteria 6583
341 Ga0307410_10109798 3300031852 Bacteria 1994
342 Ga0307406_10226523 3300031901 Bacteria 1393
343 Ga0307407_10106592 3300031903 Bacteria 1751
344 Ga0307407_10211241 3300031903 Bacteria 1307
345 Ga0307412_10144090 3300031911 Bacteria 1749
346 Ga0307409_100514463 3300031995 Bacteria 1168
347 Ga0307416_100012978 3300032002 Bacteria 5642
348 Ga0307414_10675760 3300032004 Bacteria 933
349 Ga0307415_100007958 3300032126 Bacteria 5840
350 Ga0316583_10117653 3300032133 Bacteria 926
351 Ga0373941_0101863 3300035115 Bacteria 1001
352 Ga0373960_0077671 3300035121 Bacteria 1039
353 Ga0373962_0110297 3300035242 Bacteria 867
354 Ga0373931_0139390 3300035691 Bacteria 1403
355 Ga0316582_0118700 3300036647 Bacteria 1768
356 Ga0316584_0009452 3300036712 Bacteria 6769
357 Ga0395900_0045598 3300037418 Bacteria 4516
358 Ga0395905_0586907 3300037471 Bacteria 1016
359 Ga0395905_1219139 3300037471 Bacteria 656
360 Ga0395901_0407479 3300038443 Bacteria 1396
361 Ga0436365_1861341 3300039437 Bacteria 1961
362 Ga0439461_0014497 3300041410 Bacteria 1500
363 Ga0451843_1037854 3300041509 Bacteria 1075
364 Ga0439431_0124518 3300041997 Bacteria 721
365 Ga0439441_040202 3300042001 Bacteria 935
366 Ga0439450_062961 3300042008 Bacteria 899
367 Ga0450920_033168 3300042122 Bacteria 1020
368 Ga0450910_025187 3300042147 Bacteria 915
369 Ga0439458_0050029 3300042157 Bacteria 1030
370 Ga0450908_016678 3300042184 Bacteria 1309
371 Ga0439434_0088945 3300042435 Bacteria 986
372 Ga0439464_0023582 3300042439 Bacteria 1700
373 Ga0451577_0064767 3300042876 Bacteria 3259
374 Ga0451577_0090649 3300042876 Bacteria 2729
375 Ga0451577_0684698 3300042876 Bacteria 929
376 Ga0453683_0091478 3300044673 Bacteria 1907
377 Ga0453684_0357631 3300044712 Bacteria 1645
378 Ga0451576_0056781 3300045051 Bacteria 4093
379 Ga0466967_0732578 3300045976 Bacteria 980
380 Ga0495603_0261692 3300046455 Bacteria 995
381 Ga0495629_0122736 3300046459 Bacteria 1810
382 Ga0495605_0186532 3300046474 Bacteria 910
383 Ga0495664_0354051 3300046477 Bacteria 884
384 Ga0495584_0362321 3300046491 Bacteria 736
385 Ga0495584_0402077 3300046491 Bacteria 696
386 Ga0495594_0289224 3300046499 Bacteria 934
387 Ga0495637_0099104 3300046520 Bacteria 1141
388 Ga0495656_0117140 3300046615 Bacteria 1253
389 Ga0495656_0205666 3300046615 Bacteria 979
390 Ga0495634_0137159 3300046642 Bacteria 1556
391 Ga0495623_0308301 3300046679 Bacteria 873
392 Ga0495674_0177590 3300047319 Bacteria 1774
393 Ga0495676_0259427 3300047321 Bacteria 1183
394 Ga0495680_0135879 3300047322 Bacteria 1803
395 Ga0496100_0290970 3300048903 Bacteria 1220
396 Ga0496101_0081442 3300048904 Bacteria 2394
397 Ga0496102_0009298 3300048905 Bacteria 8437
398 Ga0496102_0067970 3300048905 Bacteria 3269
399 Ga0496102_0384685 3300048905 Bacteria 1320
400 Ga0496102_1098152 3300048905 Bacteria 715
401 Ga0496103_0407351 3300048906 Bacteria 873
402 Ga0496104_0050878 3300048907 Bacteria 3909
403 Ga0496104_0927446 3300048907 Bacteria 775
404 Ga0496105_0102343 3300048908 Bacteria 2365
405 Ga0496105_0209059 3300048908 Bacteria 1591
406 Ga0496106_0112667 3300048909 Bacteria 2120
407 Ga0496106_0164758 3300048909 Bacteria 1754
408 Ga0496106_0247825 3300048909 Bacteria 1424
409 Ga0496106_0320383 3300048909 Bacteria 1244
410 Ga0496107_0116851 3300048910 Bacteria 1964
411 Ga0496107_0366438 3300048910 Bacteria 1072
412 Ga0496108_0033801 3300048911 Bacteria 4247
413 Ga0496108_0064769 3300048911 Bacteria 3080
414 Ga0496108_0237977 3300048911 Bacteria 1584
415 Ga0496108_0292333 3300048911 Bacteria 1419
416 Ga0496108_0330748 3300048911 Bacteria 1329
417 Ga0496109_0018732 3300048912 Bacteria 6087
418 Ga0496109_0100469 3300048912 Bacteria 2684
419 Ga0496109_0131791 3300048912 Bacteria 2333
420 Ga0496109_0208840 3300048912 Bacteria 1836
421 Ga0496109_0272527 3300048912 Bacteria 1595
422 Ga0496109_0328622 3300048912 Bacteria 1443
423 Ga0496109_0416366 3300048912 Bacteria 1270
424 Ga0496110_0021775 3300048913 Bacteria 5433
425 Ga0496110_0041834 3300048913 Bacteria 4000
426 Ga0496110_0446521 3300048913 Bacteria 1179
427 Ga0496111_0022389 3300048914 Bacteria 4424
428 Ga0496111_0362075 3300048914 Bacteria 1073
429 Ga0496112_0000098 3300048915 Bacteria 56421
430 Ga0496112_0085085 3300048915 Bacteria 3129
431 Ga0496112_0113058 3300048915 Bacteria 2686
432 Ga0496112_0421790 3300048915 Bacteria 1273
433 Ga0496112_0745594 3300048915 Bacteria 906
434 Ga0496113_0017155 3300048916 Bacteria 5020
435 Ga0496114_0041128 3300048917 Bacteria 3830
436 Ga0496114_0562162 3300048917 Bacteria 1007
437 Ga0501031_0007593 3300049568 Bacteria 7061
438 Ga0501031_0122648 3300049568 Bacteria 1697
439 Ga0501031_0139396 3300049568 Bacteria 1585
440 Ga0501031_0162700 3300049568 Bacteria 1459
441 Ga0501031_0274338 3300049568 Bacteria 1094
442 Ga0501032_0142420 3300049569 Bacteria 1579
443 Ga0501032_0153224 3300049569 Bacteria 1515
444 Ga0501033_0312817 3300049570 Bacteria 1104
445 Ga0501036_0321890 3300049572 Bacteria 1292
446 Ga0501036_0717456 3300049572 Bacteria 826
447 Ga0501038_0020861 3300049574 Bacteria 5889
448 Ga0501038_0129353 3300049574 Bacteria 2075
449 Ga0501038_0134181 3300049574 Bacteria 2030
450 Ga0501038_0187527 3300049574 Bacteria 1666
451 Ga0501038_0199609 3300049574 Bacteria 1606
452 Ga0501039_0083677 3300049575 Bacteria 2485
453 Ga0501039_0085946 3300049575 Bacteria 2450
454 Ga0501039_0126043 3300049575 Bacteria 2008
455 Ga0501039_0156171 3300049575 Bacteria 1792
456 Ga0501039_0454231 3300049575 Bacteria 1006
457 Ga0501039_0614888 3300049575 Bacteria 851
458 Ga0501040_0037164 3300049576 Bacteria 3307
459 Ga0501040_0129535 3300049576 Bacteria 1773
460 Ga0501040_0163317 3300049576 Bacteria 1575
461 Ga0501041_0054475 3300049577 Bacteria 2440
462 Ga0501041_0062771 3300049577 Bacteria 2275
463 Ga0501042_0049288 3300049578 Bacteria 3004
464 Ga0501042_0133123 3300049578 Bacteria 1792
465 Ga0501046_0033962 3300049580 Bacteria 4118
466 Ga0501046_0045911 3300049580 Bacteria 3468
467 Ga0501048_0101669 3300049582 Bacteria 2028
468 Ga0501048_0142615 3300049582 Bacteria 1694
469 Ga0501048_0166403 3300049582 Bacteria 1561
470 Ga0501067_0018582 3300049583 Bacteria 3848
471 Ga0501067_0082678 3300049583 Bacteria 1781
472 Ga0501067_0237637 3300049583 Bacteria 1014
473 Ga0501068_0098812 3300049584 Bacteria 1808
474 Ga0501068_0185725 3300049584 Bacteria 1315
475 Ga0501068_0357050 3300049584 Bacteria 940
476 Ga0501068_0378940 3300049584 Bacteria 911
477 Ga0501069_0025945 3300049585 Bacteria 3207
478 Ga0501069_0065398 3300049585 Bacteria 2033
479 Ga0501070_0269940 3300049586 Bacteria 1389
480 Ga0501070_0376141 3300049586 Bacteria 1151
481 Ga0501071_0108829 3300049587 Bacteria 2047
482 Ga0501071_0123441 3300049587 Bacteria 1920
483 Ga0501071_0200221 3300049587 Bacteria 1500
484 Ga0501072_0040918 3300049588 Bacteria 3640
485 Ga0501072_0284516 3300049588 Bacteria 1315
486 Ga0501072_1140045 3300049588 Bacteria 606
487 Ga0501074_0040009 3300049590 Bacteria 3395
488 Ga0501075_0009846 3300049591 Bacteria 6699
489 Ga0501075_0045658 3300049591 Bacteria 3289
490 Ga0501075_0134390 3300049591 Bacteria 1884
491 Ga0501075_0145611 3300049591 Bacteria 1805
492 Ga0501075_0273038 3300049591 Bacteria 1288
493 Ga0501075_0351923 3300049591 Bacteria 1122
494 Ga0501075_0403868 3300049591 Bacteria 1042
495 Ga0501075_0561340 3300049591 Bacteria 871
496 Ga0501075_0583275 3300049591 Bacteria 853
497 Ga0501076_0035431 3300049592 Bacteria 3904
498 Ga0501076_0049760 3300049592 Bacteria 3315
499 Ga0501076_0057361 3300049592 Bacteria 3092
500 Ga0501076_0080839 3300049592 Bacteria 2609
501 Ga0501076_0181265 3300049592 Bacteria 1717
502 Ga0501076_0244581 3300049592 Bacteria 1468
503 Ga0501076_0320988 3300049592 Bacteria 1270
504 Ga0501077_0066358 3300049593 Bacteria 2289
505 Ga0501077_0099042 3300049593 Bacteria 1848
506 Ga0501077_0179406 3300049593 Bacteria 1346
507 Ga0501077_0269431 3300049593 Bacteria 1083
508 Ga0501079_0021977 3300049741 Bacteria 4887
509 Ga0501079_0050558 3300049741 Bacteria 3209
510 Ga0501079_0097124 3300049741 Bacteria 2284
511 Ga0501079_0116577 3300049741 Bacteria 2076
512 Ga0501079_0170200 3300049741 Bacteria 1698
513 Ga0501079_0191910 3300049741 Bacteria 1594
514 Ga0501079_0288546 3300049741 Bacteria 1283
515 Ga0501079_0307881 3300049741 Bacteria 1239
516 Ga0501080_0149860 3300049742 Bacteria 2156
517 Ga0501080_0242413 3300049742 Bacteria 1645
518 Ga0501080_0620782 3300049742 Bacteria 958
519 Ga0501081_0022719 3300049743 Bacteria 4198
520 Ga0501081_0042547 3300049743 Bacteria 3113
521 Ga0501081_0045688 3300049743 Bacteria 3007
522 Ga0501081_0090879 3300049743 Bacteria 2147
523 Ga0501081_0256437 3300049743 Bacteria 1277
524 Ga0501081_0309350 3300049743 Bacteria 1160
525 Ga0501081_0349703 3300049743 Bacteria 1089
526 Ga0501083_0408294 3300049744 Bacteria 884
527 Ga0501035_0126674 3300049822 Bacteria 2229
528 Ga0501045_0008770 3300049824 Bacteria 7057
529 Ga0501045_0023131 3300049824 Bacteria 4453
530 Ga0501045_0155368 3300049824 Bacteria 1702
531 Ga0501045_0158283 3300049824 Bacteria 1685
532 Ga0501045_0245980 3300049824 Bacteria 1331
533 Ga0501045_0448332 3300049824 Bacteria 959
534 nmdc:mga05p37_10981_c1 3300050507 Bacteria 10755
535 nmdc:mga05p37_134_c1 3300050507 Bacteria 68333
536 nmdc:mga05p37_170844_c1 3300050507 Bacteria 2651
537 nmdc:mga05p37_243302_c1 3300050507 Bacteria 2162
538 nmdc:mga05p37_306422_c1 3300050507 Bacteria 1884
539 nmdc:mga05p37_39333_c1 3300050507 Bacteria 5806
540 nmdc:mga05p37_416098_c1 3300050507 Bacteria 1565
541 nmdc:mga05p37_41913_c1 3300050507 Bacteria 5623
542 nmdc:mga05p37_828204_c1 3300050507 Bacteria 1008
543 nmdc:mga09592_157843_c1 3300050508 Bacteria 1958
544 nmdc:mga0qj67_10691_c1 3300050509 Bacteria 6859
545 nmdc:mga0qj67_273542_c1 3300050509 Bacteria 1369
546 nmdc:mga0qj67_6001_c1 3300050509 Bacteria 8901
547 nmdc:mga06r32_7615_c1 3300050510 Bacteria 9740
548 nmdc:mga08y16_151551_c1 3300050511 Bacteria 2410
549 nmdc:mga08y16_229305_c1 3300050511 Bacteria 1921
550 nmdc:mga08y16_23283_c1 3300050511 Bacteria 6541
551 nmdc:mga08y16_395197_c1 3300050511 Bacteria 1416
552 nmdc:mga08y16_456417_c1 3300050511 Bacteria 1303
553 nmdc:mga08y16_513425_c1 3300050511 Bacteria 1216
554 nmdc:mga08y16_687151_c1 3300050511 Bacteria 1024
555 nmdc:mga08y16_702266_c1 3300050511 Bacteria 1011
556 nmdc:mga08y16_895995_c1 3300050511 Bacteria 873
557 nmdc:mga0n895_1144525_c1 3300050512 Bacteria 754
558 nmdc:mga0n895_210168_c1 3300050512 Bacteria 1976
559 nmdc:mga0n895_486596_c1 3300050512 Bacteria 1244
560 nmdc:mga0n895_840221_c1 3300050512 Bacteria 907
561 nmdc:mga0rr50_107410_c1 3300050513 Bacteria 2203
562 nmdc:mga0rr50_22360_c1 3300050513 Bacteria 4338
563 nmdc:mga0rr50_30797_c1 3300050513 Bacteria 3803
564 nmdc:mga0rr50_729834_c1 3300050513 Bacteria 845
565 nmdc:mga0a205_121620_c1 3300050515 Bacteria 2510
566 nmdc:mga0a205_639449_c1 3300050515 Bacteria 915
567 nmdc:mga0a205_72459_c1 3300050515 Bacteria 3328
568 nmdc:mga0a205_83286_c1 3300050515 Bacteria 3089
569 nmdc:mga0a205_91439_c1 3300050515 Bacteria 2940
570 Ga0495601_0091239 3300053077 Bacteria 1961
571 Ga0495612_0016935 3300053078 Bacteria 2919
572 Ga0495655_0079336 3300053083 Bacteria 935
573 Ga0501084_0020839 3300054114 Bacteria 5468
574 Ga0501084_0066285 3300054114 Bacteria 3021
575 Ga0501084_0066952 3300054114 Bacteria 3006
576 Ga0501084_0089209 3300054114 Bacteria 2588
577 Ga0501084_0109265 3300054114 Bacteria 2323
578 Ga0501084_0148490 3300054114 Bacteria 1975
579 Ga0501084_0225511 3300054114 Bacteria 1581
580 Ga0501082_0053950 3300060353 Bacteria 3465
581 Ga0501082_0105166 3300060353 Bacteria 2442
582 Ga0501082_0310508 3300060353 Bacteria 1373
583 Ga0501082_0320138 3300060353 Bacteria 1351
584 Ga0501082_0441972 3300060353 Bacteria 1136
585 Ga0530510_0010697 3300061734 Bacteria 6436
586 Ga0530510_0062329 3300061734 Bacteria 2699
587 Ga0530510_0067054 3300061734 Bacteria 2603
588 Ga0530510_0194022 3300061734 Bacteria 1508
589 Ga0530510_0280247 3300061734 Bacteria 1245
590 Ga0530510_0512979 3300061734 Bacteria 909

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026075 Ga0207708_10438107 Ga0207708_104381072 153
2 3300050512 nmdc:mga0n895_1144525_c1 nmdc:mga0n895_1144525_c1_13_612 155
3 3300049741 Ga0501079_0307881 Ga0501079_0307881_23_619 158
4 3300031235 Ga0265330_10018695 Ga0265330_100186952 163
5 3300031242 Ga0265329_10016735 Ga0265329_100167352 163
6 3300031712 Ga0265342_10040148 Ga0265342_100401483 163
7 3300048912 Ga0496109_0416366 Ga0496109_0416366_223_918 177
8 3300061734 Ga0530510_0512979 Ga0530510_0512979_257_799 180
9 3300003373 JGI25407J50210_10008634 JGI25407J50210_100086344 182
10 3300005518 Ga0070699_100359296 Ga0070699_1003592962 182
11 3300005563 Ga0068855_100346138 Ga0068855_1003461382 182
12 3300005614 Ga0068856_100534511 Ga0068856_1005345113 182
13 3300005981 Ga0081538_10082242 Ga0081538_100822422 182
14 3300025920 Ga0207649_10073789 Ga0207649_100737893 182
15 3300025945 Ga0207679_10043376 Ga0207679_100433765 182
16 3300026078 Ga0207702_10216018 Ga0207702_102160183 182
17 3300026078 Ga0207702_10915650 Ga0207702_109156502 182
18 3300026116 Ga0207674_10300389 Ga0207674_103003892 182
19 3300042008 Ga0439450_062961 Ga0439450_062961_27_578 182
20 3300042439 Ga0439464_0023582 Ga0439464_0023582_10_561 182
21 3300049568 Ga0501031_0139396 Ga0501031_0139396_728_1276 182
22 3300049574 Ga0501038_0187527 Ga0501038_0187527_682_1230 182
23 3300049575 Ga0501039_0085946 Ga0501039_0085946_866_1414 182
24 3300049577 Ga0501041_0054475 Ga0501041_0054475_761_1309 182
25 3300049578 Ga0501042_0133123 Ga0501042_0133123_711_1259 182
26 3300049582 Ga0501048_0142615 Ga0501048_0142615_151_699 182
27 3300049588 Ga0501072_0040918 Ga0501072_0040918_2552_3100 182
28 3300005329 Ga0070683_100331571 Ga0070683_1003315712 183
29 3300005329 Ga0070683_100447208 Ga0070683_1004472082 183
30 3300005330 Ga0070690_100255203 Ga0070690_1002552032 183
31 3300005331 Ga0070670_100141746 Ga0070670_1001417462 183
32 3300005334 Ga0068869_100076415 Ga0068869_1000764152 183
33 3300005334 Ga0068869_100087819 Ga0068869_1000878192 183
34 3300005336 Ga0070680_100000064 Ga0070680_10000006434 183
35 3300005336 Ga0070680_100712160 Ga0070680_1007121602 183
36 3300005337 Ga0070682_100339745 Ga0070682_1003397451 183
37 3300005338 Ga0068868_100100944 Ga0068868_1001009442 183
38 3300005340 Ga0070689_100201695 Ga0070689_1002016952 183
39 3300005341 Ga0070691_10037662 Ga0070691_100376622 183
40 3300005341 Ga0070691_10070815 Ga0070691_100708152 183
41 3300005343 Ga0070687_100255732 Ga0070687_1002557322 183
42 3300005344 Ga0070661_100182156 Ga0070661_1001821562 183
43 3300005345 Ga0070692_10025878 Ga0070692_100258782 183
44 3300005345 Ga0070692_10103055 Ga0070692_101030552 183
45 3300005345 Ga0070692_10443065 Ga0070692_104430651 183
46 3300005356 Ga0070674_100029199 Ga0070674_1000291994 183
47 3300005356 Ga0070674_100214949 Ga0070674_1002149492 183
48 3300005364 Ga0070673_100131649 Ga0070673_1001316492 183
49 3300005364 Ga0070673_100714827 Ga0070673_1007148272 183
50 3300005366 Ga0070659_100603158 Ga0070659_1006031581 183
51 3300005366 Ga0070659_100663065 Ga0070659_1006630652 183
52 3300005367 Ga0070667_100751954 Ga0070667_1007519542 183
53 3300005438 Ga0070701_10131752 Ga0070701_101317522 183
54 3300005440 Ga0070705_100005866 Ga0070705_1000058663 183
55 3300005440 Ga0070705_100241380 Ga0070705_1002413802 183
56 3300005441 Ga0070700_100078768 Ga0070700_1000787683 183
57 3300005444 Ga0070694_100017300 Ga0070694_1000173002 183
58 3300005444 Ga0070694_100064160 Ga0070694_1000641602 183
59 3300005444 Ga0070694_100087291 Ga0070694_1000872912 183
60 3300005444 Ga0070694_100179097 Ga0070694_1001790972 183
61 3300005445 Ga0070708_100014626 Ga0070708_1000146262 183
62 3300005445 Ga0070708_100023535 Ga0070708_1000235353 183
63 3300005445 Ga0070708_100028591 Ga0070708_1000285912 183
64 3300005456 Ga0070678_100018248 Ga0070678_1000182483 183
65 3300005456 Ga0070678_100208932 Ga0070678_1002089322 183
66 3300005457 Ga0070662_100298687 Ga0070662_1002986871 183
67 3300005457 Ga0070662_100632491 Ga0070662_1006324911 183
68 3300005459 Ga0068867_100038229 Ga0068867_1000382292 183
69 3300005459 Ga0068867_100584452 Ga0068867_1005844522 183
70 3300005466 Ga0070685_10051119 Ga0070685_100511192 183
71 3300005467 Ga0070706_100001298 Ga0070706_10000129829 183
72 3300005467 Ga0070706_100053774 Ga0070706_1000537742 183
73 3300005467 Ga0070706_100074566 Ga0070706_1000745662 183
74 3300005467 Ga0070706_100398623 Ga0070706_1003986232 183
75 3300005468 Ga0070707_100002764 Ga0070707_1000027643 183
76 3300005468 Ga0070707_100009095 Ga0070707_1000090954 183
77 3300005468 Ga0070707_100056386 Ga0070707_1000563862 183
78 3300005468 Ga0070707_100071130 Ga0070707_1000711302 183
79 3300005468 Ga0070707_100117981 Ga0070707_1001179812 183
80 3300005468 Ga0070707_100176638 Ga0070707_1001766381 183
81 3300005471 Ga0070698_100003028 Ga0070698_1000030282 183
82 3300005471 Ga0070698_100006530 Ga0070698_1000065303 183
83 3300005471 Ga0070698_100061582 Ga0070698_1000615824 183
84 3300005471 Ga0070698_100145909 Ga0070698_1001459092 183
85 3300005471 Ga0070698_100598849 Ga0070698_1005988492 183
86 3300005518 Ga0070699_100001412 Ga0070699_10000141221 183
87 3300005518 Ga0070699_100024630 Ga0070699_1000246305 183
88 3300005518 Ga0070699_100044658 Ga0070699_1000446584 183
89 3300005518 Ga0070699_100134244 Ga0070699_1001342442 183
90 3300005530 Ga0070679_100225581 Ga0070679_1002255812 183
91 3300005535 Ga0070684_100225949 Ga0070684_1002259492 183
92 3300005536 Ga0070697_100073972 Ga0070697_1000739722 183
93 3300005536 Ga0070697_100096114 Ga0070697_1000961142 183
94 3300005536 Ga0070697_100177333 Ga0070697_1001773332 183
95 3300005543 Ga0070672_100594940 Ga0070672_1005949402 183
96 3300005544 Ga0070686_100048546 Ga0070686_1000485462 183
97 3300005544 Ga0070686_100145804 Ga0070686_1001458042 183
98 3300005544 Ga0070686_100146544 Ga0070686_1001465442 183
99 3300005544 Ga0070686_100195965 Ga0070686_1001959652 183
100 3300005545 Ga0070695_100022365 Ga0070695_1000223653 183
101 3300005545 Ga0070695_100027940 Ga0070695_1000279403 183
102 3300005545 Ga0070695_100068601 Ga0070695_1000686012 183
103 3300005545 Ga0070695_100081802 Ga0070695_1000818022 183
104 3300005545 Ga0070695_100244945 Ga0070695_1002449452 183
105 3300005546 Ga0070696_100007041 Ga0070696_1000070413 183
106 3300005546 Ga0070696_100008927 Ga0070696_1000089272 183
107 3300005546 Ga0070696_100027854 Ga0070696_1000278542 183
108 3300005546 Ga0070696_100035049 Ga0070696_1000350495 183
109 3300005546 Ga0070696_100053303 Ga0070696_1000533032 183
110 3300005546 Ga0070696_100137109 Ga0070696_1001371092 183
111 3300005546 Ga0070696_100277816 Ga0070696_1002778162 183
112 3300005546 Ga0070696_100598511 Ga0070696_1005985112 183
113 3300005547 Ga0070693_100112828 Ga0070693_1001128282 183
114 3300005547 Ga0070693_100176663 Ga0070693_1001766632 183
115 3300005548 Ga0070665_100936266 Ga0070665_1009362662 183
116 3300005549 Ga0070704_100010891 Ga0070704_1000108913 183
117 3300005549 Ga0070704_100063555 Ga0070704_1000635553 183
118 3300005549 Ga0070704_100241000 Ga0070704_1002410002 183
119 3300005578 Ga0068854_100101461 Ga0068854_1001014612 183
120 3300005615 Ga0070702_100222438 Ga0070702_1002224382 183
121 3300005615 Ga0070702_100316526 Ga0070702_1003165262 183
122 3300005616 Ga0068852_100491559 Ga0068852_1004915592 183
123 3300005618 Ga0068864_100302880 Ga0068864_1003028802 183
124 3300005719 Ga0068861_100075194 Ga0068861_1000751943 183
125 3300005840 Ga0068870_10194241 Ga0068870_101942412 183
126 3300005840 Ga0068870_10458578 Ga0068870_104585782 183
127 3300005843 Ga0068860_100018613 Ga0068860_1000186136 183
128 3300005981 Ga0081538_10000910 Ga0081538_1000091018 183
129 3300005981 Ga0081538_10004702 Ga0081538_1000470210 183
130 3300005981 Ga0081538_10072256 Ga0081538_100722562 183
131 3300005985 Ga0081539_10005484 Ga0081539_100054845 183
132 3300005985 Ga0081539_10006087 Ga0081539_100060876 183
133 3300005985 Ga0081539_10132234 Ga0081539_101322342 183
134 3300006038 Ga0075365_10061098 Ga0075365_100610982 183
135 3300006844 Ga0075428_100000696 Ga0075428_10000069623 183
136 3300006844 Ga0075428_100703316 Ga0075428_1007033162 183
137 3300006844 Ga0075428_100901308 Ga0075428_1009013081 183
138 3300006846 Ga0075430_100000245 Ga0075430_10000024527 183
139 3300006847 Ga0075431_100130755 Ga0075431_1001307553 183
140 3300006852 Ga0075433_10068092 Ga0075433_100680922 183
141 3300006852 Ga0075433_10155640 Ga0075433_101556402 183
142 3300006852 Ga0075433_10181143 Ga0075433_101811432 183
143 3300006871 Ga0075434_100466597 Ga0075434_1004665972 183
144 3300006871 Ga0075434_100524546 Ga0075434_1005245461 183
145 3300006881 Ga0068865_100241437 Ga0068865_1002414371 183
146 3300006881 Ga0068865_100272808 Ga0068865_1002728082 183
147 3300006881 Ga0068865_100431336 Ga0068865_1004313362 183
148 3300006914 Ga0075436_100410208 Ga0075436_1004102082 183
149 3300007076 Ga0075435_100045756 Ga0075435_1000457564 183
150 3300007076 Ga0075435_100059372 Ga0075435_1000593723 183
151 3300007076 Ga0075435_100573611 Ga0075435_1005736112 183
152 3300009094 Ga0111539_10022563 Ga0111539_100225637 183
153 3300009094 Ga0111539_10096722 Ga0111539_100967223 183
154 3300009094 Ga0111539_10102433 Ga0111539_101024333 183
155 3300009094 Ga0111539_10175521 Ga0111539_101755212 183
156 3300009094 Ga0111539_11312623 Ga0111539_113126232 183
157 3300009098 Ga0105245_10009100 Ga0105245_100091003 183
158 3300009098 Ga0105245_10020624 Ga0105245_100206243 183
159 3300009098 Ga0105245_10124687 Ga0105245_101246872 183
160 3300009098 Ga0105245_10267973 Ga0105245_102679732 183
161 3300009098 Ga0105245_11172708 Ga0105245_111727081 183
162 3300009147 Ga0114129_10005323 Ga0114129_1000532314 183
163 3300009147 Ga0114129_10192522 Ga0114129_101925223 183
164 3300009147 Ga0114129_10315885 Ga0114129_103158853 183
165 3300009147 Ga0114129_10557267 Ga0114129_105572672 183
166 3300009148 Ga0105243_10078487 Ga0105243_100784872 183
167 3300009148 Ga0105243_10105549 Ga0105243_101055492 183
168 3300009148 Ga0105243_10214576 Ga0105243_102145762 183
169 3300009148 Ga0105243_10405830 Ga0105243_104058302 183
170 3300009148 Ga0105243_10415327 Ga0105243_104153272 183
171 3300009176 Ga0105242_10418065 Ga0105242_104180652 183
172 3300009176 Ga0105242_10523556 Ga0105242_105235562 183
173 3300009177 Ga0105248_10113242 Ga0105248_101132421 183
174 3300009177 Ga0105248_10394016 Ga0105248_103940162 183
175 3300009177 Ga0105248_10461018 Ga0105248_104610182 183
176 3300009553 Ga0105249_10282851 Ga0105249_102828512 183
177 3300009553 Ga0105249_10402664 Ga0105249_104026642 183
178 3300009553 Ga0105249_10613254 Ga0105249_106132542 183
179 3300009553 Ga0105249_10636036 Ga0105249_106360362 183
180 3300010375 Ga0105239_10102025 Ga0105239_101020253 183
181 3300010375 Ga0105239_10174430 Ga0105239_101744302 183
182 3300010375 Ga0105239_11249384 Ga0105239_112493842 183
183 3300011119 Ga0105246_10004227 Ga0105246_100042273 183
184 3300011119 Ga0105246_10160959 Ga0105246_101609592 183
185 3300013297 Ga0157378_10010453 Ga0157378_100104536 183
186 3300013297 Ga0157378_10126886 Ga0157378_101268862 183
187 3300013297 Ga0157378_10159480 Ga0157378_101594802 183
188 3300013306 Ga0163162_10797683 Ga0163162_107976832 183
189 3300013308 Ga0157375_10070231 Ga0157375_100702313 183
190 3300013308 Ga0157375_10075773 Ga0157375_100757733 183
191 3300013308 Ga0157375_10127805 Ga0157375_101278052 183
192 3300013308 Ga0157375_10220745 Ga0157375_102207452 183
193 3300014325 Ga0163163_10011036 Ga0163163_100110364 183
194 3300014325 Ga0163163_10065884 Ga0163163_100658843 183
195 3300014325 Ga0163163_10081943 Ga0163163_100819431 183
196 3300014325 Ga0163163_10122588 Ga0163163_101225882 183
197 3300014325 Ga0163163_10587679 Ga0163163_105876792 183
198 3300014325 Ga0163163_10838727 Ga0163163_108387272 183
199 3300014325 Ga0163163_11217776 Ga0163163_112177761 183
200 3300014326 Ga0157380_10050282 Ga0157380_100502823 183
201 3300014326 Ga0157380_10083552 Ga0157380_100835522 183
202 3300014326 Ga0157380_10125486 Ga0157380_101254862 183
203 3300014326 Ga0157380_10832720 Ga0157380_108327202 183
204 3300014497 Ga0182008_10195930 Ga0182008_101959302 183
205 3300014745 Ga0157377_10137687 Ga0157377_101376872 183
206 3300014745 Ga0157377_10254915 Ga0157377_102549152 183
207 3300014745 Ga0157377_10402686 Ga0157377_104026862 183
208 3300014968 Ga0157379_10026752 Ga0157379_100267522 183
209 3300014968 Ga0157379_10147070 Ga0157379_101470701 183
210 3300014969 Ga0157376_10354240 Ga0157376_103542402 183
211 3300014969 Ga0157376_10365400 Ga0157376_103654002 183
212 3300017792 Ga0163161_10635482 Ga0163161_106354822 183
213 3300025885 Ga0207653_10009867 Ga0207653_100098672 183
214 3300025901 Ga0207688_10026193 Ga0207688_100261932 183
215 3300025908 Ga0207643_10011050 Ga0207643_100110505 183
216 3300025910 Ga0207684_10000544 Ga0207684_1000054429 183
217 3300025910 Ga0207684_10015072 Ga0207684_100150724 183
218 3300025910 Ga0207684_10055603 Ga0207684_100556033 183
219 3300025910 Ga0207684_10063193 Ga0207684_100631933 183
220 3300025910 Ga0207684_10121752 Ga0207684_101217522 183
221 3300025910 Ga0207684_10132742 Ga0207684_101327423 183
222 3300025912 Ga0207707_10304964 Ga0207707_103049642 183
223 3300025912 Ga0207707_10656177 Ga0207707_106561771 183
224 3300025917 Ga0207660_10000002 Ga0207660_10000002428 183
225 3300025918 Ga0207662_10000902 Ga0207662_100009022 183
226 3300025918 Ga0207662_10096226 Ga0207662_100962262 183
227 3300025918 Ga0207662_10217754 Ga0207662_102177542 183
228 3300025921 Ga0207652_10068593 Ga0207652_100685932 183
229 3300025921 Ga0207652_10138895 Ga0207652_101388952 183
230 3300025922 Ga0207646_10001034 Ga0207646_1000103424 183
231 3300025922 Ga0207646_10011213 Ga0207646_100112133 183
232 3300025922 Ga0207646_10049169 Ga0207646_100491692 183
233 3300025922 Ga0207646_10167728 Ga0207646_101677282 183
234 3300025922 Ga0207646_10190873 Ga0207646_101908732 183
235 3300025922 Ga0207646_10206369 Ga0207646_102063692 183
236 3300025926 Ga0207659_10117514 Ga0207659_101175142 183
237 3300025926 Ga0207659_10444628 Ga0207659_104446282 183
238 3300025927 Ga0207687_10189893 Ga0207687_101898932 183
239 3300025927 Ga0207687_10202605 Ga0207687_102026052 183
240 3300025927 Ga0207687_10396109 Ga0207687_103961092 183
241 3300025932 Ga0207690_10186632 Ga0207690_101866322 183
242 3300025933 Ga0207706_10054176 Ga0207706_100541762 183
243 3300025933 Ga0207706_10327990 Ga0207706_103279902 183
244 3300025933 Ga0207706_10456245 Ga0207706_104562452 183
245 3300025935 Ga0207709_10138871 Ga0207709_101388712 183
246 3300025935 Ga0207709_10310840 Ga0207709_103108402 183
247 3300025936 Ga0207670_10082473 Ga0207670_100824732 183
248 3300025937 Ga0207669_10009430 Ga0207669_100094303 183
249 3300025937 Ga0207669_10402908 Ga0207669_104029082 183
250 3300025938 Ga0207704_10606773 Ga0207704_106067732 183
251 3300025942 Ga0207689_10019890 Ga0207689_100198903 183
252 3300025942 Ga0207689_10150734 Ga0207689_101507342 183
253 3300025942 Ga0207689_10415177 Ga0207689_104151772 183
254 3300025944 Ga0207661_10060474 Ga0207661_100604743 183
255 3300025961 Ga0207712_10214304 Ga0207712_102143042 183
256 3300025981 Ga0207640_10141621 Ga0207640_101416212 183
257 3300025981 Ga0207640_10620895 Ga0207640_106208951 183
258 3300026035 Ga0207703_10120551 Ga0207703_101205513 183
259 3300026067 Ga0207678_10034056 Ga0207678_100340563 183
260 3300026075 Ga0207708_10033653 Ga0207708_100336532 183
261 3300026075 Ga0207708_10034375 Ga0207708_100343752 183
262 3300026075 Ga0207708_10107364 Ga0207708_101073642 183
263 3300026075 Ga0207708_10500740 Ga0207708_105007402 183
264 3300026078 Ga0207702_10575678 Ga0207702_105756782 183
265 3300026088 Ga0207641_10130510 Ga0207641_101305102 183
266 3300026089 Ga0207648_10001702 Ga0207648_100017023 183
267 3300026089 Ga0207648_10281707 Ga0207648_102817072 183
268 3300026095 Ga0207676_10027993 Ga0207676_100279932 183
269 3300026095 Ga0207676_10571306 Ga0207676_105713062 183
270 3300026116 Ga0207674_10121520 Ga0207674_101215202 183
271 3300026116 Ga0207674_10503397 Ga0207674_105033972 183
272 3300026118 Ga0207675_100133962 Ga0207675_1001339622 183
273 3300026118 Ga0207675_100513518 Ga0207675_1005135181 183
274 3300026121 Ga0207683_10007014 Ga0207683_100070147 183
275 3300026121 Ga0207683_10751394 Ga0207683_107513942 183
276 3300027907 Ga0207428_10351100 Ga0207428_103511002 183
277 3300027907 Ga0207428_10368739 Ga0207428_103687392 183
278 3300028379 Ga0268266_10543452 Ga0268266_105434522 183
279 3300028380 Ga0268265_10096715 Ga0268265_100967152 183
280 3300028381 Ga0268264_10101913 Ga0268264_101019132 183
281 3300028556 Ga0265337_1018686 Ga0265337_10186862 183
282 3300028558 Ga0265326_10062635 Ga0265326_100626352 183
283 3300028563 Ga0265319_1005252 Ga0265319_10052522 183
284 3300028563 Ga0265319_1021747 Ga0265319_10217472 183
285 3300028563 Ga0265319_1039230 Ga0265319_10392302 183
286 3300028573 Ga0265334_10024542 Ga0265334_100245422 183
287 3300028577 Ga0265318_10048771 Ga0265318_100487712 183
288 3300028653 Ga0265323_10103147 Ga0265323_101031471 183
289 3300028654 Ga0265322_10002802 Ga0265322_100028023 183
290 3300028666 Ga0265336_10009743 Ga0265336_100097433 183
291 3300028666 Ga0265336_10015457 Ga0265336_100154572 183
292 3300028800 Ga0265338_10436974 Ga0265338_104369742 183
293 3300031235 Ga0265330_10074475 Ga0265330_100744752 183
294 3300031235 Ga0265330_10163668 Ga0265330_101636681 183
295 3300031240 Ga0265320_10006941 Ga0265320_100069414 183
296 3300031240 Ga0265320_10053955 Ga0265320_100539552 183
297 3300031241 Ga0265325_10024028 Ga0265325_100240282 183
298 3300031241 Ga0265325_10044683 Ga0265325_100446832 183
299 3300031242 Ga0265329_10041734 Ga0265329_100417342 183
300 3300031247 Ga0265340_10023538 Ga0265340_100235382 183
301 3300031249 Ga0265339_10027919 Ga0265339_100279193 183
302 3300031249 Ga0265339_10052400 Ga0265339_100524002 183
303 3300031249 Ga0265339_10073359 Ga0265339_100733592 183
304 3300031250 Ga0265331_10026731 Ga0265331_100267312 183
305 3300031344 Ga0265316_10023257 Ga0265316_100232573 183
306 3300031711 Ga0265314_10008799 Ga0265314_100087993 183
307 3300031712 Ga0265342_10094154 Ga0265342_100941542 183
308 3300031731 Ga0307405_10023605 Ga0307405_100236052 183
309 3300031733 Ga0316577_10005620 Ga0316577_100056204 183
310 3300031852 Ga0307410_10109798 Ga0307410_101097982 183
311 3300031901 Ga0307406_10226523 Ga0307406_102265231 183
312 3300031903 Ga0307407_10106592 Ga0307407_101065922 183
313 3300031903 Ga0307407_10211241 Ga0307407_102112412 183
314 3300031911 Ga0307412_10144090 Ga0307412_101440902 183
315 3300032002 Ga0307416_100012978 Ga0307416_1000129782 183
316 3300032004 Ga0307414_10675760 Ga0307414_106757602 183
317 3300032126 Ga0307415_100007958 Ga0307415_1000079581 183
318 3300032133 Ga0316583_10117653 Ga0316583_101176532 183
319 3300035121 Ga0373960_0077671 Ga0373960_0077671_148_699 183
320 3300035242 Ga0373962_0110297 Ga0373962_0110297_111_797 183
321 3300036647 Ga0316582_0118700 Ga0316582_0118700_225_950 183
322 3300036712 Ga0316584_0009452 Ga0316584_0009452_1780_2505 183
323 3300037471 Ga0395905_0586907 Ga0395905_0586907_208_912 183
324 3300039437 Ga0436365_1861341 Ga0436365_1861341_312_1013 183
325 3300041410 Ga0439461_0014497 Ga0439461_0014497_709_1389 183
326 3300041509 Ga0451843_1037854 Ga0451843_1037854_362_1030 183
327 3300041997 Ga0439431_0124518 Ga0439431_0124518_35_700 183
328 3300042001 Ga0439441_040202 Ga0439441_040202_70_753 183
329 3300042122 Ga0450920_033168 Ga0450920_033168_163_846 183
330 3300042147 Ga0450910_025187 Ga0450910_025187_62_745 183
331 3300042157 Ga0439458_0050029 Ga0439458_0050029_178_879 183
332 3300042184 Ga0450908_016678 Ga0450908_016678_520_1203 183
333 3300042435 Ga0439434_0088945 Ga0439434_0088945_76_741 183
334 3300042876 Ga0451577_0064767 Ga0451577_0064767_912_1703 183
335 3300042876 Ga0451577_0090649 Ga0451577_0090649_401_1066 183
336 3300042876 Ga0451577_0684698 Ga0451577_0684698_154_849 183
337 3300044673 Ga0453683_0091478 Ga0453683_0091478_564_1229 183
338 3300045051 Ga0451576_0056781 Ga0451576_0056781_701_1366 183
339 3300045976 Ga0466967_0732578 Ga0466967_0732578_115_768 183
340 3300046455 Ga0495603_0261692 Ga0495603_0261692_62_739 183
341 3300046459 Ga0495629_0122736 Ga0495629_0122736_1051_1752 183
342 3300046477 Ga0495664_0354051 Ga0495664_0354051_48_758 183
343 3300046491 Ga0495584_0362321 Ga0495584_0362321_88_639 183
344 3300046491 Ga0495584_0402077 Ga0495584_0402077_59_661 183
345 3300046499 Ga0495594_0289224 Ga0495594_0289224_92_775 183
346 3300046615 Ga0495656_0117140 Ga0495656_0117140_260_970 183
347 3300046615 Ga0495656_0205666 Ga0495656_0205666_180_857 183
348 3300046642 Ga0495634_0137159 Ga0495634_0137159_477_1193 183
349 3300046679 Ga0495623_0308301 Ga0495623_0308301_27_704 183
350 3300047319 Ga0495674_0177590 Ga0495674_0177590_1053_1721 183
351 3300047321 Ga0495676_0259427 Ga0495676_0259427_204_881 183
352 3300047322 Ga0495680_0135879 Ga0495680_0135879_611_1279 183
353 3300048903 Ga0496100_0290970 Ga0496100_0290970_375_1052 183
354 3300048904 Ga0496101_0081442 Ga0496101_0081442_268_945 183
355 3300048905 Ga0496102_0009298 Ga0496102_0009298_6360_7058 183
356 3300048905 Ga0496102_0067970 Ga0496102_0067970_2534_3241 183
357 3300048905 Ga0496102_0384685 Ga0496102_0384685_434_1150 183
358 3300048905 Ga0496102_1098152 Ga0496102_1098152_15_692 183
359 3300048906 Ga0496103_0407351 Ga0496103_0407351_10_726 183
360 3300048907 Ga0496104_0050878 Ga0496104_0050878_3131_3808 183
361 3300048907 Ga0496104_0927446 Ga0496104_0927446_90_758 183
362 3300048908 Ga0496105_0102343 Ga0496105_0102343_864_1574 183
363 3300048908 Ga0496105_0209059 Ga0496105_0209059_609_1286 183
364 3300048909 Ga0496106_0112667 Ga0496106_0112667_852_1538 183
365 3300048909 Ga0496106_0164758 Ga0496106_0164758_757_1455 183
366 3300048909 Ga0496106_0247825 Ga0496106_0247825_17_691 183
367 3300048909 Ga0496106_0320383 Ga0496106_0320383_549_1226 183
368 3300048910 Ga0496107_0116851 Ga0496107_0116851_880_1557 183
369 3300048910 Ga0496107_0366438 Ga0496107_0366438_45_722 183
370 3300048911 Ga0496108_0033801 Ga0496108_0033801_935_1612 183
371 3300048911 Ga0496108_0064769 Ga0496108_0064769_1048_1731 183
372 3300048911 Ga0496108_0237977 Ga0496108_0237977_34_750 183
373 3300048911 Ga0496108_0292333 Ga0496108_0292333_44_775 183
374 3300048911 Ga0496108_0330748 Ga0496108_0330748_94_771 183
375 3300048912 Ga0496109_0018732 Ga0496109_0018732_2232_2909 183
376 3300048912 Ga0496109_0100469 Ga0496109_0100469_1011_1694 183
377 3300048912 Ga0496109_0131791 Ga0496109_0131791_1457_2188 183
378 3300048912 Ga0496109_0208840 Ga0496109_0208840_114_782 183
379 3300048912 Ga0496109_0272527 Ga0496109_0272527_313_990 183
380 3300048912 Ga0496109_0328622 Ga0496109_0328622_733_1419 183
381 3300048913 Ga0496110_0021775 Ga0496110_0021775_2253_2930 183
382 3300048913 Ga0496110_0041834 Ga0496110_0041834_33_719 183
383 3300048913 Ga0496110_0446521 Ga0496110_0446521_170_853 183
384 3300048914 Ga0496111_0022389 Ga0496111_0022389_2560_3237 183
385 3300048914 Ga0496111_0362075 Ga0496111_0362075_298_975 183
386 3300048915 Ga0496112_0000098 Ga0496112_0000098_28128_28811 183
387 3300048915 Ga0496112_0085085 Ga0496112_0085085_1981_2715 183
388 3300048915 Ga0496112_0113058 Ga0496112_0113058_1409_2128 183
389 3300048915 Ga0496112_0421790 Ga0496112_0421790_265_996 183
390 3300048915 Ga0496112_0745594 Ga0496112_0745594_178_864 183
391 3300048916 Ga0496113_0017155 Ga0496113_0017155_1776_2459 183
392 3300048917 Ga0496114_0041128 Ga0496114_0041128_122_799 183
393 3300048917 Ga0496114_0562162 Ga0496114_0562162_240_935 183
394 3300049568 Ga0501031_0007593 Ga0501031_0007593_6342_7037 183
395 3300049568 Ga0501031_0122648 Ga0501031_0122648_775_1446 183
396 3300049568 Ga0501031_0162700 Ga0501031_0162700_517_1251 183
397 3300049568 Ga0501031_0274338 Ga0501031_0274338_22_744 183
398 3300049569 Ga0501032_0142420 Ga0501032_0142420_337_1062 183
399 3300049569 Ga0501032_0153224 Ga0501032_0153224_243_938 183
400 3300049570 Ga0501033_0312817 Ga0501033_0312817_61_747 183
401 3300049572 Ga0501036_0321890 Ga0501036_0321890_359_1030 183
402 3300049572 Ga0501036_0717456 Ga0501036_0717456_61_765 183
403 3300049574 Ga0501038_0020861 Ga0501038_0020861_2010_2705 183
404 3300049574 Ga0501038_0129353 Ga0501038_0129353_670_1392 183
405 3300049574 Ga0501038_0134181 Ga0501038_0134181_197_880 183
406 3300049574 Ga0501038_0199609 Ga0501038_0199609_260_994 183
407 3300049575 Ga0501039_0083677 Ga0501039_0083677_97_819 183
408 3300049575 Ga0501039_0126043 Ga0501039_0126043_447_1142 183
409 3300049575 Ga0501039_0156171 Ga0501039_0156171_754_1440 183
410 3300049575 Ga0501039_0454231 Ga0501039_0454231_153_827 183
411 3300049575 Ga0501039_0614888 Ga0501039_0614888_127_810 183
412 3300049576 Ga0501040_0129535 Ga0501040_0129535_269_955 183
413 3300049576 Ga0501040_0163317 Ga0501040_0163317_237_986 183
414 3300049577 Ga0501041_0062771 Ga0501041_0062771_205_939 183
415 3300049578 Ga0501042_0049288 Ga0501042_0049288_2090_2773 183
416 3300049580 Ga0501046_0033962 Ga0501046_0033962_1400_2095 183
417 3300049580 Ga0501046_0045911 Ga0501046_0045911_822_1508 183
418 3300049582 Ga0501048_0101669 Ga0501048_0101669_375_1061 183
419 3300049582 Ga0501048_0166403 Ga0501048_0166403_464_1213 183
420 3300049583 Ga0501067_0018582 Ga0501067_0018582_1610_2281 183
421 3300049583 Ga0501067_0082678 Ga0501067_0082678_701_1408 183
422 3300049584 Ga0501068_0098812 Ga0501068_0098812_262_948 183
423 3300049584 Ga0501068_0185725 Ga0501068_0185725_218_913 183
424 3300049584 Ga0501068_0378940 Ga0501068_0378940_205_876 183
425 3300049585 Ga0501069_0025945 Ga0501069_0025945_1564_2235 183
426 3300049585 Ga0501069_0065398 Ga0501069_0065398_1160_1861 183
427 3300049586 Ga0501070_0269940 Ga0501070_0269940_35_730 183
428 3300049586 Ga0501070_0376141 Ga0501070_0376141_124_795 183
429 3300049587 Ga0501071_0108829 Ga0501071_0108829_519_1241 183
430 3300049587 Ga0501071_0123441 Ga0501071_0123441_1105_1800 183
431 3300049587 Ga0501071_0200221 Ga0501071_0200221_809_1480 183
432 3300049588 Ga0501072_0284516 Ga0501072_0284516_425_1108 183
433 3300049590 Ga0501074_0040009 Ga0501074_0040009_2409_3092 183
434 3300049591 Ga0501075_0009846 Ga0501075_0009846_3013_3696 183
435 3300049591 Ga0501075_0134390 Ga0501075_0134390_506_1228 183
436 3300049591 Ga0501075_0145611 Ga0501075_0145611_655_1326 183
437 3300049591 Ga0501075_0273038 Ga0501075_0273038_469_1155 183
438 3300049591 Ga0501075_0351923 Ga0501075_0351923_12_698 183
439 3300049591 Ga0501075_0561340 Ga0501075_0561340_73_738 183
440 3300049591 Ga0501075_0583275 Ga0501075_0583275_107_841 183
441 3300049592 Ga0501076_0035431 Ga0501076_0035431_1352_2047 183
442 3300049592 Ga0501076_0049760 Ga0501076_0049760_960_1646 183
443 3300049592 Ga0501076_0080839 Ga0501076_0080839_1323_1994 183
444 3300049592 Ga0501076_0244581 Ga0501076_0244581_606_1271 183
445 3300049592 Ga0501076_0320988 Ga0501076_0320988_224_946 183
446 3300049593 Ga0501077_0066358 Ga0501077_0066358_1075_1761 183
447 3300049593 Ga0501077_0099042 Ga0501077_0099042_826_1548 183
448 3300049593 Ga0501077_0179406 Ga0501077_0179406_250_921 183
449 3300049593 Ga0501077_0269431 Ga0501077_0269431_107_823 183
450 3300049741 Ga0501079_0021977 Ga0501079_0021977_582_1265 183
451 3300049741 Ga0501079_0050558 Ga0501079_0050558_1685_2371 183
452 3300049741 Ga0501079_0097124 Ga0501079_0097124_313_1035 183
453 3300049741 Ga0501079_0116577 Ga0501079_0116577_200_865 183
454 3300049741 Ga0501079_0170200 Ga0501079_0170200_462_1148 183
455 3300049741 Ga0501079_0191910 Ga0501079_0191910_156_890 183
456 3300049741 Ga0501079_0288546 Ga0501079_0288546_297_980 183
457 3300049742 Ga0501080_0149860 Ga0501080_0149860_444_1139 183
458 3300049742 Ga0501080_0242413 Ga0501080_0242413_419_1123 183
459 3300049742 Ga0501080_0620782 Ga0501080_0620782_180_851 183
460 3300049743 Ga0501081_0022719 Ga0501081_0022719_1795_2481 183
461 3300049743 Ga0501081_0042547 Ga0501081_0042547_1923_2606 183
462 3300049743 Ga0501081_0045688 Ga0501081_0045688_1105_1800 183
463 3300049743 Ga0501081_0090879 Ga0501081_0090879_151_834 183
464 3300049743 Ga0501081_0256437 Ga0501081_0256437_90_815 183
465 3300049743 Ga0501081_0309350 Ga0501081_0309350_17_688 183
466 3300049743 Ga0501081_0349703 Ga0501081_0349703_147_869 183
467 3300049744 Ga0501083_0408294 Ga0501083_0408294_153_824 183
468 3300049822 Ga0501035_0126674 Ga0501035_0126674_1143_1838 183
469 3300049824 Ga0501045_0008770 Ga0501045_0008770_6119_6814 183
470 3300049824 Ga0501045_0023131 Ga0501045_0023131_2984_3667 183
471 3300049824 Ga0501045_0155368 Ga0501045_0155368_57_728 183
472 3300049824 Ga0501045_0158283 Ga0501045_0158283_169_891 183
473 3300049824 Ga0501045_0245980 Ga0501045_0245980_32_718 183
474 3300049824 Ga0501045_0448332 Ga0501045_0448332_99_767 183
475 3300050507 nmdc:mga05p37_134_c1 nmdc:mga05p37_134_c1_37666_38349 183
476 3300050507 nmdc:mga05p37_170844_c1 nmdc:mga05p37_170844_c1_1815_2486 183
477 3300050507 nmdc:mga05p37_306422_c1 nmdc:mga05p37_306422_c1_504_1211 183
478 3300050507 nmdc:mga05p37_416098_c1 nmdc:mga05p37_416098_c1_442_1131 183
479 3300050507 nmdc:mga05p37_41913_c1 nmdc:mga05p37_41913_c1_3589_4260 183
480 3300050507 nmdc:mga05p37_828204_c1 nmdc:mga05p37_828204_c1_162_854 183
481 3300050509 nmdc:mga0qj67_6001_c1 nmdc:mga0qj67_6001_c1_6054_6608 183
482 3300050510 nmdc:mga06r32_7615_c1 nmdc:mga06r32_7615_c1_2851_3405 183
483 3300050511 nmdc:mga08y16_229305_c1 nmdc:mga08y16_229305_c1_1147_1836 183
484 3300050511 nmdc:mga08y16_23283_c1 nmdc:mga08y16_23283_c1_5807_6496 183
485 3300050511 nmdc:mga08y16_395197_c1 nmdc:mga08y16_395197_c1_181_867 183
486 3300050511 nmdc:mga08y16_687151_c1 nmdc:mga08y16_687151_c1_137_877 183
487 3300050511 nmdc:mga08y16_895995_c1 nmdc:mga08y16_895995_c1_120_815 183
488 3300050512 nmdc:mga0n895_210168_c1 nmdc:mga0n895_210168_c1_1034_1741 183
489 3300050512 nmdc:mga0n895_486596_c1 nmdc:mga0n895_486596_c1_110_796 183
490 3300050512 nmdc:mga0n895_840221_c1 nmdc:mga0n895_840221_c1_19_735 183
491 3300050513 nmdc:mga0rr50_107410_c1 nmdc:mga0rr50_107410_c1_1006_1701 183
492 3300050513 nmdc:mga0rr50_22360_c1 nmdc:mga0rr50_22360_c1_150_830 183
493 3300050513 nmdc:mga0rr50_30797_c1 nmdc:mga0rr50_30797_c1_754_1461 183
494 3300050513 nmdc:mga0rr50_729834_c1 nmdc:mga0rr50_729834_c1_25_726 183
495 3300050515 nmdc:mga0a205_121620_c1 nmdc:mga0a205_121620_c1_1237_1953 183
496 3300050515 nmdc:mga0a205_639449_c1 nmdc:mga0a205_639449_c1_74_730 183
497 3300050515 nmdc:mga0a205_83286_c1 nmdc:mga0a205_83286_c1_1738_2415 183
498 3300050515 nmdc:mga0a205_91439_c1 nmdc:mga0a205_91439_c1_673_1356 183
499 3300053077 Ga0495601_0091239 Ga0495601_0091239_988_1656 183
500 3300053078 Ga0495612_0016935 Ga0495612_0016935_115_789 183
501 3300054114 Ga0501084_0020839 Ga0501084_0020839_2653_3375 183
502 3300054114 Ga0501084_0066285 Ga0501084_0066285_1658_2329 183
503 3300054114 Ga0501084_0066952 Ga0501084_0066952_678_1364 183
504 3300054114 Ga0501084_0089209 Ga0501084_0089209_1784_2467 183
505 3300054114 Ga0501084_0109265 Ga0501084_0109265_260_976 183
506 3300054114 Ga0501084_0148490 Ga0501084_0148490_360_1064 183
507 3300054114 Ga0501084_0225511 Ga0501084_0225511_450_1136 183
508 3300060353 Ga0501082_0105166 Ga0501082_0105166_1295_2017 183
509 3300060353 Ga0501082_0310508 Ga0501082_0310508_672_1358 183
510 3300060353 Ga0501082_0320138 Ga0501082_0320138_642_1313 183
511 3300060353 Ga0501082_0441972 Ga0501082_0441972_19_768 183
512 3300061734 Ga0530510_0010697 Ga0530510_0010697_73_741 183
513 3300061734 Ga0530510_0062329 Ga0530510_0062329_1483_2178 183
514 3300061734 Ga0530510_0067054 Ga0530510_0067054_11_694 183
515 3300061734 Ga0530510_0194022 Ga0530510_0194022_633_1340 183
516 3300061734 Ga0530510_0280247 Ga0530510_0280247_528_1196 183
517 3300003373 JGI25407J50210_10008373 JGI25407J50210_100083732 184
518 3300005518 Ga0070699_100000533 Ga0070699_10000053313 184
519 3300005981 Ga0081538_10000009 Ga0081538_1000000996 184
520 3300006844 Ga0075428_100089339 Ga0075428_1000893393 184
521 3300006846 Ga0075430_100003035 Ga0075430_1000030355 184
522 3300009147 Ga0114129_10013759 Ga0114129_100137599 184
523 3300025922 Ga0207646_10813386 Ga0207646_108133862 184
524 3300044712 Ga0453684_0357631 Ga0453684_0357631_971_1567 184
525 3300046520 Ga0495637_0099104 Ga0495637_0099104_210_767 184
526 3300050507 nmdc:mga05p37_10981_c1 nmdc:mga05p37_10981_c1_3946_4503 184
527 3300050509 nmdc:mga0qj67_10691_c1 nmdc:mga0qj67_10691_c1_2556_3113 184
528 3300003373 JGI25407J50210_10000384 JGI25407J50210_100003847 185
529 3300005328 Ga0070676_10225057 Ga0070676_102250572 185
530 3300005341 Ga0070691_10008010 Ga0070691_100080104 185
531 3300005347 Ga0070668_100011470 Ga0070668_1000114706 185
532 3300005441 Ga0070700_100163266 Ga0070700_1001632662 185
533 3300005457 Ga0070662_100000228 Ga0070662_10000022828 185
534 3300005549 Ga0070704_100530696 Ga0070704_1005306962 185
535 3300005578 Ga0068854_100357125 Ga0068854_1003571252 185
536 3300005719 Ga0068861_100077267 Ga0068861_1000772672 185
537 3300005981 Ga0081538_10000228 Ga0081538_100002289 185
538 3300005985 Ga0081539_10022508 Ga0081539_100225085 185
539 3300006058 Ga0075432_10010541 Ga0075432_100105412 185
540 3300006844 Ga0075428_100186349 Ga0075428_1001863492 185
541 3300006844 Ga0075428_100729691 Ga0075428_1007296912 185
542 3300006846 Ga0075430_100582725 Ga0075430_1005827252 185
543 3300006852 Ga0075433_10058521 Ga0075433_100585214 185
544 3300006880 Ga0075429_100168938 Ga0075429_1001689382 185
545 3300009094 Ga0111539_10009225 Ga0111539_100092257 185
546 3300009094 Ga0111539_10212035 Ga0111539_102120353 185
547 3300009094 Ga0111539_10250752 Ga0111539_102507522 185
548 3300009098 Ga0105245_10008333 Ga0105245_100083337 185
549 3300009147 Ga0114129_10126796 Ga0114129_101267963 185
550 3300009147 Ga0114129_10396210 Ga0114129_103962102 185
551 3300009147 Ga0114129_11071309 Ga0114129_110713092 185
552 3300009147 Ga0114129_11390440 Ga0114129_113904402 185
553 3300012494 Ga0157341_1013854 Ga0157341_10138541 185
554 3300017792 Ga0163161_10030447 Ga0163161_100304474 185
555 3300025901 Ga0207688_10107710 Ga0207688_101077102 185
556 3300025907 Ga0207645_10049873 Ga0207645_100498732 185
557 3300025927 Ga0207687_10009376 Ga0207687_100093765 185
558 3300025933 Ga0207706_10001194 Ga0207706_1000119411 185
559 3300025961 Ga0207712_10024032 Ga0207712_100240322 185
560 3300025972 Ga0207668_10010404 Ga0207668_100104045 185
561 3300026118 Ga0207675_100001702 Ga0207675_10000170222 185
562 3300026142 Ga0207698_10387528 Ga0207698_103875282 185
563 3300027907 Ga0207428_10100846 Ga0207428_101008462 185
564 3300031548 Ga0307408_100026246 Ga0307408_1000262464 185
565 3300031995 Ga0307409_100514463 Ga0307409_1005144632 185
566 3300035115 Ga0373941_0101863 Ga0373941_0101863_214_771 185
567 3300035691 Ga0373931_0139390 Ga0373931_0139390_45_602 185
568 3300037418 Ga0395900_0045598 Ga0395900_0045598_399_956 185
569 3300037471 Ga0395905_1219139 Ga0395905_1219139_83_640 185
570 3300038443 Ga0395901_0407479 Ga0395901_0407479_46_603 185
571 3300046474 Ga0495605_0186532 Ga0495605_0186532_138_818 185
572 3300049576 Ga0501040_0037164 Ga0501040_0037164_1916_2473 185
573 3300049583 Ga0501067_0237637 Ga0501067_0237637_331_888 185
574 3300049584 Ga0501068_0357050 Ga0501068_0357050_345_908 185
575 3300049588 Ga0501072_1140045 Ga0501072_1140045_21_584 185
576 3300049591 Ga0501075_0045658 Ga0501075_0045658_1848_2405 185
577 3300049591 Ga0501075_0403868 Ga0501075_0403868_194_757 185
578 3300049592 Ga0501076_0057361 Ga0501076_0057361_995_1552 185
579 3300049592 Ga0501076_0181265 Ga0501076_0181265_593_1156 185
580 3300050507 nmdc:mga05p37_243302_c1 nmdc:mga05p37_243302_c1_902_1459 185
581 3300050507 nmdc:mga05p37_39333_c1 nmdc:mga05p37_39333_c1_2051_2608 185
582 3300050508 nmdc:mga09592_157843_c1 nmdc:mga09592_157843_c1_674_1231 185
583 3300050509 nmdc:mga0qj67_273542_c1 nmdc:mga0qj67_273542_c1_97_654 185
584 3300050511 nmdc:mga08y16_151551_c1 nmdc:mga08y16_151551_c1_123_680 185
585 3300050511 nmdc:mga08y16_456417_c1 nmdc:mga08y16_456417_c1_634_1191 185
586 3300050511 nmdc:mga08y16_513425_c1 nmdc:mga08y16_513425_c1_443_1000 185
587 3300050511 nmdc:mga08y16_702266_c1 nmdc:mga08y16_702266_c1_33_590 185
588 3300050515 nmdc:mga0a205_72459_c1 nmdc:mga0a205_72459_c1_2719_3276 185
589 3300053083 Ga0495655_0079336 Ga0495655_0079336_281_838 185
590 3300060353 Ga0501082_0053950 Ga0501082_0053950_446_1003 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

5

185

0.95

PF07722

Peptidase_C26

Peptidase C26

46

167

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9169 1 185
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9122 1 185
6qur-assembly1.cif.gz_A mapping the allosteric communication network of aminodeoxychorismate synthase 0.9098 4 183
2d7j-assembly1.cif.gz_A crystal structure analysis of glutamine amidotransferase from pyrococcus horikoshii ot3 0.8983 4 184
1wl8-assembly1.cif.gz_A crystal structure of ph1346 protein from pyrococcus horikoshii 0.8961 3 184
ID Description Score Start End Superfamily
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9451 3 184 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9255 4 183 3.40.50.880
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9254 3 184 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9227 4 183 3.40.50.880
1qdlB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9169 1 185 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7W1D7I4-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9594 45 184 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A7V9KFH0-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9589 42 185 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A533RQB3-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9563 4 164 GO:0000162
GO:0004049
GO:0005829
AF-A0A1M3BN39-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.953 3 182 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A7W1CLR2-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.953 2 184 GO:0000162
GO:0004049
GO:0005829
GO:0006541

Feature Viewer

pLDDT pTM Quality
91.71 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map