F466997

General Info

Members Datasets Scaffolds Average Seq Length
590 290 1180 337

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0092174|Ga0495643_0092174_321_1412
Length 363
Sequence VEIVFEKSEKLMEYCSLEKTNDMNTDTSLNSVIATAKANVDSRGFLDIDLDPTLDLFAEIERLKKEKNAVVLAHYYQEPDIQDVADYIGDSLGLAQQAEKTTADMIVFAGVHFMAETAKILNPTKKVVIPDLKAGCSLSDSCPPPLFKKFKEQHPDHVVVSYINCSAGIKALSDVIVTSSNAKIIVESFPKDQKIIFAPDKNLGGYINKVTGRNMLLWNGACMVHEIFSLEKITKLKVKHPNAKFIAHPECEEPVLRIADYIGSTTGLLKYTQTDNSQEYIVATETGILHQMMKASPHKTFIPAPPTNACACNDCPHMKLNSLEKLYLCMEYETPEINMEEGLRLAAKKPIDRMLEISAKAGL

Samples

Sample ID Description Type Environment
1 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
176 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
177 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
180 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
181 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
182 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
183 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
184 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
187 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
212 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
213 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
214 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
229 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
230 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
231 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
232 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
233 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
234 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
235 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
236 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
237 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
238 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
239 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
240 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
241 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
242 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
243 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
244 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
245 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
250 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
251 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
256 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
265 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
266 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
267 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
268 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
269 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
270 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
271 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
276 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
277 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
280 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
281 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
282 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
283 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
288 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
289 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
290 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.81
Nodule 0
Rhizoplane 1.36
Rhizosphere 87.12
Stem 0
Stem Tuber 0
Unclassified 4.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495643_0092174 3300046522 Bacteria 1562
2 JGI24740J21852_10000715 3300001979 Bacteria 14403
3 JGI24739J22299_10008942 3300001989 Bacteria 3737
4 JGI25154J39366_1000023 3300002738 Bacteria 219569
5 JGI25153J46596_10000396 3300003215 Bacteria 29349
6 rootL2_10002906 3300003322 Bacteria 12743
7 rootL2_10002907 3300003322 Bacteria 5500
8 rootH1_10037492 3300003323 Bacteria 4824
9 rootH1_10090199 3300003323 Bacteria 6622
10 JGI25160J50197_1012018 3300003354 Bacteria 3034
11 JGI25160J50197_1032919 3300003354 Bacteria 1311
12 Ga0055535_1002010 3300003761 Bacteria 8340
13 Ga0055542_1001495 3300003762 Bacteria 11422
14 Ga0055526_1013423 3300003771 Bacteria 3467
15 Ga0055528_1001056 3300003790 Bacteria 18207
16 Ga0055531_10000080 3300003794 Bacteria 103922
17 Ga0065165_1000027 3300005262 Bacteria 228507
18 Ga0065714_10022897 3300005288 Bacteria 1411
19 Ga0065712_10098576 3300005290 Bacteria 2109
20 Ga0065707_10004731 3300005295 Bacteria 3772
21 Ga0065707_10183665 3300005295 Bacteria 1402
22 Ga0065707_10193980 3300005295 Bacteria 1345
23 Ga0070658_10081597 3300005327 Bacteria 2656
24 Ga0070676_10003561 3300005328 Bacteria 8146
25 Ga0070683_100000327 3300005329 Bacteria 32861
26 Ga0070683_100047705 3300005329 Bacteria 3958
27 Ga0070690_100068855 3300005330 Bacteria 2296
28 Ga0070690_100068857 3300005330 Bacteria 2296
29 Ga0070690_100099446 3300005330 Bacteria 1927
30 Ga0070670_100004281 3300005331 Bacteria 11945
31 Ga0070670_100034017 3300005331 Bacteria 4388
32 Ga0070670_100070694 3300005331 Bacteria 2996
33 Ga0070670_100342569 3300005331 Bacteria 1312
34 Ga0070670_100384296 3300005331 Bacteria 1237
35 Ga0070677_10039565 3300005333 Bacteria 1851
36 Ga0070677_10041642 3300005333 Bacteria 1815
37 Ga0070677_10055932 3300005333 Bacteria 1612
38 Ga0070677_10094273 3300005333 Bacteria 1308
39 Ga0068869_100004762 3300005334 Bacteria 8468
40 Ga0068869_100089449 3300005334 Bacteria 2312
41 Ga0068869_100099396 3300005334 Unclassified 2199
42 Ga0068869_100154425 3300005334 Bacteria 1782
43 Ga0070666_10038674 3300005335 Bacteria 3176
44 Ga0070682_100000012 3300005337 Bacteria 265658
45 Ga0068868_100001123 3300005338 Bacteria 18309
46 Ga0068868_100057324 3300005338 Bacteria 3077
47 Ga0068868_100094374 3300005338 Unclassified 2413
48 Ga0070660_100000435 3300005339 Bacteria 27665
49 Ga0070660_100255862 3300005339 Bacteria 1429
50 Ga0070689_100023985 3300005340 Bacteria 4573
51 Ga0070689_100220257 3300005340 Bacteria 1556
52 Ga0070689_100248682 3300005340 Bacteria 1466
53 Ga0070661_100001196 3300005344 Bacteria 18334
54 Ga0070661_100006373 3300005344 Bacteria 8139
55 Ga0070661_100048650 3300005344 Bacteria 3104
56 Ga0070668_100027817 3300005347 Unclassified 4292
57 Ga0070668_100028581 3300005347 Bacteria 4232
58 Ga0070668_100074248 3300005347 Bacteria 2653
59 Ga0070669_100099164 3300005353 Bacteria 2195
60 Ga0070669_100180196 3300005353 Bacteria 1652
61 Ga0070675_100006806 3300005354 Bacteria 8780
62 Ga0070675_100022259 3300005354 Bacteria 5063
63 Ga0070675_100022293 3300005354 Bacteria 5060
64 Ga0070675_100077331 3300005354 Bacteria 2769
65 Ga0070675_100085838 3300005354 Bacteria 2630
66 Ga0070675_100250588 3300005354 Bacteria 1550
67 Ga0070675_100300049 3300005354 Bacteria 1415
68 Ga0070671_100059593 3300005355 Bacteria 3177
69 Ga0070671_100187645 3300005355 Bacteria 1752
70 Ga0070671_100194693 3300005355 Bacteria 1718
71 Ga0070674_100275092 3300005356 Bacteria 1332
72 Ga0070673_100002938 3300005364 Bacteria 10506
73 Ga0070673_100084680 3300005364 Bacteria 2579
74 Ga0070673_100312063 3300005364 Unclassified 1387
75 Ga0070688_100035603 3300005365 Bacteria 3025
76 Ga0070688_100097684 3300005365 Bacteria 1931
77 Ga0070659_100002952 3300005366 Bacteria 12126
78 Ga0070659_100002987 3300005366 Bacteria 12044
79 Ga0070659_100021577 3300005366 Bacteria 4907
80 Ga0070659_100063784 3300005366 Bacteria 2915
81 Ga0070667_100031019 3300005367 Bacteria 4457
82 Ga0070667_100187019 3300005367 Bacteria 1833
83 Ga0070714_100230134 3300005435 Bacteria 1707
84 Ga0070663_100024487 3300005455 Unclassified 4064
85 Ga0070663_100059505 3300005455 Bacteria 2745
86 Ga0070678_100004280 3300005456 Bacteria 8069
87 Ga0070678_100082929 3300005456 Bacteria 2436
88 Ga0070678_100159151 3300005456 Bacteria 1827
89 Ga0070662_100114955 3300005457 Bacteria 2055
90 Ga0070662_100158708 3300005457 Bacteria 1767
91 Ga0068867_100001627 3300005459 Bacteria 15620
92 Ga0068867_100065778 3300005459 Bacteria 2699
93 Ga0068867_100066673 3300005459 Bacteria 2682
94 Ga0068867_100076624 3300005459 Bacteria 2511
95 Ga0068867_100125835 3300005459 Bacteria 1986
96 Ga0070685_10124745 3300005466 Bacteria 1603
97 Ga0070706_100433638 3300005467 Bacteria 1223
98 Ga0070698_100000282 3300005471 Bacteria 51827
99 Ga0070698_100001103 3300005471 Bacteria 29751
100 Ga0070679_100004530 3300005530 Bacteria 12835
101 Ga0070684_100000290 3300005535 Bacteria 34902
102 Ga0070684_100014260 3300005535 Bacteria 6432
103 Ga0070684_100016576 3300005535 Bacteria 6025
104 Ga0068853_100000837 3300005539 Bacteria 21517
105 Ga0068853_100240092 3300005539 Bacteria 1660
106 Ga0070672_100082512 3300005543 Bacteria 2579
107 Ga0070672_100088578 3300005543 Bacteria 2493
108 Ga0070672_100111023 3300005543 Bacteria 2234
109 Ga0070672_100200059 3300005543 Bacteria 1670
110 Ga0070704_100281855 3300005549 Bacteria 1377
111 Ga0068855_100146995 3300005563 Bacteria 2682
112 Ga0070664_100000509 3300005564 Bacteria 29514
113 Ga0070664_100085554 3300005564 Bacteria 2723
114 Ga0070664_100136488 3300005564 Bacteria 2157
115 Ga0070664_100312036 3300005564 Bacteria 1423
116 Ga0068857_100000579 3300005577 Bacteria 26747
117 Ga0068857_100026014 3300005577 Bacteria 5154
118 Ga0068857_100203096 3300005577 Bacteria 1807
119 Ga0068857_100238897 3300005577 Bacteria 1663
120 Ga0068852_100003313 3300005616 Bacteria 11246
121 Ga0068852_100428613 3300005616 Bacteria 1306
122 Ga0068852_100524417 3300005616 Bacteria 1182
123 Ga0068859_100004960 3300005617 Bacteria 13517
124 Ga0068859_100007913 3300005617 Bacteria 10781
125 Ga0068859_100024205 3300005617 Bacteria 6093
126 Ga0068859_100030568 3300005617 Bacteria 5405
127 Ga0068859_100072558 3300005617 Bacteria 3479
128 Ga0068859_100314608 3300005617 Bacteria 1659
129 Ga0068859_100388747 3300005617 Bacteria 1491
130 Ga0068859_100457941 3300005617 Bacteria 1371
131 Ga0068859_100477343 3300005617 Bacteria 1342
132 Ga0068864_100075356 3300005618 Bacteria 2946
133 Ga0068864_100137476 3300005618 Bacteria 2201
134 Ga0068866_10059834 3300005718 Bacteria 1972
135 Ga0068866_10103928 3300005718 Bacteria 1572
136 Ga0068861_100003222 3300005719 Bacteria 10797
137 Ga0068861_100003315 3300005719 Bacteria 10661
138 Ga0068861_100085481 3300005719 Unclassified 2477
139 Ga0068861_100090096 3300005719 Bacteria 2418
140 Ga0068870_10005253 3300005840 Bacteria 5638
141 Ga0068870_10017614 3300005840 Bacteria 3434
142 Ga0068863_100019337 3300005841 Bacteria 6514
143 Ga0068863_100093742 3300005841 Unclassified 2849
144 Ga0068863_100239998 3300005841 Bacteria 1749
145 Ga0068858_100333807 3300005842 Bacteria 1450
146 Ga0068860_100012951 3300005843 Bacteria 8191
147 Ga0068860_100022295 3300005843 Bacteria 6129
148 Ga0068860_100023666 3300005843 Bacteria 5937
149 Ga0068860_100024407 3300005843 Bacteria 5841
150 Ga0068860_100183639 3300005843 Bacteria 2022
151 Ga0068860_100229297 3300005843 Bacteria 1805
152 Ga0068860_100471008 3300005843 Bacteria 1251
153 Ga0068862_100043728 3300005844 Bacteria 3819
154 Ga0068862_100071434 3300005844 Bacteria 2997
155 Ga0068862_100196324 3300005844 Bacteria 1818
156 Ga0068862_100255907 3300005844 Bacteria 1597
157 Ga0075366_10009800 3300006195 Bacteria 5356
158 Ga0075366_10022569 3300006195 Bacteria 3662
159 Ga0097621_100006322 3300006237 Bacteria 8405
160 Ga0097621_100013151 3300006237 Bacteria 6156
161 Ga0097621_100075035 3300006237 Bacteria 2802
162 Ga0075370_10062278 3300006353 Bacteria 2126
163 Ga0068871_100011482 3300006358 Bacteria 6499
164 Ga0068871_100138754 3300006358 Bacteria 2066
165 Ga0068871_100139556 3300006358 Bacteria 2060
166 Ga0068871_100168979 3300006358 Bacteria 1873
167 Ga0068871_100206806 3300006358 Bacteria 1696
168 Ga0075428_100004587 3300006844 Bacteria 15280
169 Ga0075430_100055545 3300006846 Bacteria 3330
170 Ga0075431_100009229 3300006847 Bacteria 9899
171 Ga0075431_100084913 3300006847 Bacteria 3268
172 Ga0075434_100090839 3300006871 Bacteria 3055
173 Ga0075429_100000261 3300006880 Bacteria 36762
174 Ga0075429_100004600 3300006880 Bacteria 11863
175 Ga0068865_100139293 3300006881 Bacteria 1828
176 Ga0068865_100222766 3300006881 Bacteria 1475
177 Ga0097620_100004960 3300006931 Bacteria 13517
178 Ga0097620_100007913 3300006931 Bacteria 10781
179 Ga0097620_100024205 3300006931 Bacteria 6093
180 Ga0097620_100030573 3300006931 Bacteria 5405
181 Ga0097620_100072554 3300006931 Bacteria 3479
182 Ga0097620_100314603 3300006931 Bacteria 1659
183 Ga0097620_100388743 3300006931 Bacteria 1491
184 Ga0097620_100457925 3300006931 Bacteria 1371
185 Ga0097620_100477326 3300006931 Bacteria 1342
186 Ga0105240_10030192 3300009093 Bacteria 7049
187 Ga0111539_10003763 3300009094 Bacteria 19972
188 Ga0111539_10065216 3300009094 Bacteria 4304
189 Ga0111539_10554300 3300009094 Bacteria 1339
190 Ga0105247_10001391 3300009101 Bacteria 17555
191 Ga0114129_10021302 3300009147 Bacteria 9203
192 Ga0114129_10135009 3300009147 Bacteria 3386
193 Ga0105242_10008286 3300009176 Bacteria 7988
194 Ga0105242_10044394 3300009176 Bacteria 3600
195 Ga0105242_10078956 3300009176 Bacteria 2748
196 Ga0105242_10336363 3300009176 Bacteria 1390
197 Ga0105249_10001404 3300009553 Bacteria 21086
198 Ga0105249_10003219 3300009553 Bacteria 14138
199 Ga0105249_10003256 3300009553 Bacteria 14068
200 Ga0105249_10003625 3300009553 Bacteria 13351
201 Ga0105249_10017160 3300009553 Bacteria 6426
202 Ga0105249_10018659 3300009553 Bacteria 6177
203 Ga0105249_10159063 3300009553 Bacteria 2181
204 Ga0105249_10286380 3300009553 Bacteria 1647
205 Ga0105249_10451418 3300009553 Bacteria 1324
206 Ga0105239_10170971 3300010375 Bacteria 2430
207 Ga0105239_10179515 3300010375 Bacteria 2369
208 Ga0105246_10051200 3300011119 Bacteria 2835
209 Ga0157373_10006857 3300013100 Bacteria 8479
210 Ga0157373_10020602 3300013100 Bacteria 4791
211 Ga0157373_10055385 3300013100 Bacteria 2817
212 Ga0157373_10141691 3300013100 Bacteria 1691
213 Ga0157371_10000518 3300013102 Bacteria 46197
214 Ga0157371_10012028 3300013102 Bacteria 6635
215 Ga0157371_10021069 3300013102 Bacteria 4792
216 Ga0157371_10027482 3300013102 Bacteria 4127
217 Ga0157371_10028520 3300013102 Bacteria 4041
218 Ga0157371_10038752 3300013102 Bacteria 3409
219 Ga0157371_10041458 3300013102 Bacteria 3284
220 Ga0157370_10005116 3300013104 Bacteria 14791
221 Ga0157370_10075581 3300013104 Bacteria 3175
222 Ga0157370_10361785 3300013104 Bacteria 1337
223 Ga0157369_10056076 3300013105 Bacteria 4252
224 Ga0157374_10000587 3300013296 Bacteria 32144
225 Ga0157374_10004126 3300013296 Bacteria 12197
226 Ga0157374_10062741 3300013296 Bacteria 3484
227 Ga0157374_10144026 3300013296 Bacteria 2314
228 Ga0157374_10406873 3300013296 Bacteria 1358
229 Ga0163162_10002830 3300013306 Bacteria 16503
230 Ga0163162_10005849 3300013306 Bacteria 11896
231 Ga0163162_10022504 3300013306 Bacteria 6211
232 Ga0163162_10066324 3300013306 Unclassified 3658
233 Ga0163162_10130099 3300013306 Bacteria 2625
234 Ga0157372_10025914 3300013307 Bacteria 6377
235 Ga0157372_10031849 3300013307 Bacteria 5778
236 Ga0157372_10166106 3300013307 Unclassified 2552
237 Ga0157372_10242836 3300013307 Bacteria 2090
238 Ga0157372_10389700 3300013307 Bacteria 1623
239 Ga0157375_10026685 3300013308 Bacteria 5388
240 Ga0157375_10114623 3300013308 Bacteria 2797
241 Ga0157375_10127275 3300013308 Bacteria 2664
242 Ga0157375_10145411 3300013308 Bacteria 2501
243 Ga0157375_10316559 3300013308 Bacteria 1725
244 Ga0163163_10000867 3300014325 Bacteria 25795
245 Ga0163163_10024406 3300014325 Bacteria 5755
246 Ga0163163_10078371 3300014325 Bacteria 3301
247 Ga0157380_10003760 3300014326 Bacteria 10433
248 Ga0157380_10009876 3300014326 Bacteria 6853
249 Ga0157380_10029152 3300014326 Bacteria 4217
250 Ga0157380_10144960 3300014326 Bacteria 2045
251 Ga0157377_10001699 3300014745 Bacteria 9598
252 Ga0157377_10019476 3300014745 Bacteria 3546
253 Ga0157377_10084354 3300014745 Bacteria 1863
254 Ga0157379_10011401 3300014968 Bacteria 7756
255 Ga0157379_10036734 3300014968 Bacteria 4368
256 Ga0157376_10014832 3300014969 Bacteria 5865
257 Ga0157376_10025221 3300014969 Bacteria 4680
258 Ga0157376_10033135 3300014969 Bacteria 4155
259 Ga0157376_10048291 3300014969 Bacteria 3519
260 Ga0163161_10008580 3300017792 Bacteria 7066
261 Ga0163161_10076295 3300017792 Unclassified 2460
262 Ga0163161_10080597 3300017792 Bacteria 2396
263 Ga0209258_100116 3300025242 Bacteria 190317
264 Ga0209646_1000004 3300025246 Bacteria 786587
265 Ga0209646_1001871 3300025246 Bacteria 5172
266 Ga0209026_1000095 3300025250 Bacteria 164309
267 Ga0209148_1000251 3300025254 Bacteria 85638
268 Ga0209129_1018188 3300025258 Bacteria 1356
269 Ga0209673_1000203 3300025273 Bacteria 119623
270 Ga0209564_1006438 3300025295 Bacteria 6332
271 Ga0209564_1019459 3300025295 Bacteria 2535
272 Ga0209758_1001033 3300025297 Bacteria 36447
273 Ga0209758_1006449 3300025297 Bacteria 8422
274 Ga0209758_1012105 3300025297 Bacteria 4879
275 Ga0207426_1000313 3300025302 Bacteria 94934
276 Ga0207426_1006511 3300025302 Bacteria 5059
277 Ga0209257_1000004 3300025304 Bacteria 1678347
278 Ga0209257_1001198 3300025304 Bacteria 32624
279 Ga0207697_10040155 3300025315 Bacteria 1921
280 Ga0207656_10127275 3300025321 Bacteria 1191
281 Ga0207682_10051684 3300025893 Bacteria 1702
282 Ga0207642_10069556 3300025899 Bacteria 1670
283 Ga0207642_10069637 3300025899 Bacteria 1669
284 Ga0207710_10000673 3300025900 Bacteria 19242
285 Ga0207688_10026069 3300025901 Bacteria 3212
286 Ga0207680_10023426 3300025903 Bacteria 3371
287 Ga0207647_10000210 3300025904 Bacteria 47384
288 Ga0207647_10005891 3300025904 Bacteria 8933
289 Ga0207645_10000050 3300025907 Bacteria 84659
290 Ga0207645_10008204 3300025907 Bacteria 7307
291 Ga0207643_10004301 3300025908 Bacteria 7656
292 Ga0207643_10011252 3300025908 Bacteria 4832
293 Ga0207643_10119533 3300025908 Bacteria 1559
294 Ga0207643_10157450 3300025908 Bacteria 1365
295 Ga0207705_10051221 3300025909 Bacteria 2972
296 Ga0207705_10143417 3300025909 Bacteria 1785
297 Ga0207654_10138921 3300025911 Bacteria 1547
298 Ga0207695_10055852 3300025913 Bacteria 4112
299 Ga0207662_10047868 3300025918 Bacteria 2533
300 Ga0207657_10012449 3300025919 Bacteria 8401
301 Ga0207657_10014890 3300025919 Bacteria 7566
302 Ga0207649_10000567 3300025920 Bacteria 25427
303 Ga0207649_10029390 3300025920 Bacteria 3245
304 Ga0207649_10104033 3300025920 Unclassified 1885
305 Ga0207652_10000090 3300025921 Bacteria 99245
306 Ga0207681_10018862 3300025923 Bacteria 4350
307 Ga0207681_10046209 3300025923 Bacteria 2928
308 Ga0207681_10064580 3300025923 Bacteria 2528
309 Ga0207681_10100378 3300025923 Bacteria 2086
310 Ga0207681_10236915 3300025923 Bacteria 1419
311 Ga0207650_10008006 3300025925 Bacteria 7202
312 Ga0207650_10045278 3300025925 Bacteria 3237
313 Ga0207650_10126230 3300025925 Bacteria 1997
314 Ga0207659_10053668 3300025926 Bacteria 2875
315 Ga0207659_10116237 3300025926 Bacteria 2042
316 Ga0207659_10186142 3300025926 Unclassified 1649
317 Ga0207659_10297131 3300025926 Bacteria 1325
318 Ga0207644_10132231 3300025931 Bacteria 1912
319 Ga0207644_10137763 3300025931 Bacteria 1876
320 Ga0207644_10196281 3300025931 Bacteria 1590
321 Ga0207690_10013908 3300025932 Bacteria 4849
322 Ga0207690_10048350 3300025932 Bacteria 2828
323 Ga0207706_10009149 3300025933 Bacteria 9107
324 Ga0207706_10029711 3300025933 Bacteria 4878
325 Ga0207706_10165302 3300025933 Bacteria 1945
326 Ga0207686_10000372 3300025934 Bacteria 31309
327 Ga0207709_10251962 3300025935 Unclassified 1290
328 Ga0207670_10003217 3300025936 Bacteria 8652
329 Ga0207670_10014483 3300025936 Bacteria 4682
330 Ga0207670_10037728 3300025936 Bacteria 3151
331 Ga0207670_10042074 3300025936 Bacteria 3008
332 Ga0207669_10168043 3300025937 Bacteria 1558
333 Ga0207704_10153017 3300025938 Bacteria 1630
334 Ga0207691_10004485 3300025940 Bacteria 13524
335 Ga0207691_10059512 3300025940 Bacteria 3473
336 Ga0207691_10081462 3300025940 Bacteria 2909
337 Ga0207691_10130341 3300025940 Bacteria 2222
338 Ga0207691_10169108 3300025940 Bacteria 1915
339 Ga0207691_10182912 3300025940 Bacteria 1831
340 Ga0207691_10214994 3300025940 Bacteria 1669
341 Ga0207691_10359581 3300025940 Bacteria 1245
342 Ga0207689_10000664 3300025942 Bacteria 32785
343 Ga0207689_10000843 3300025942 Bacteria 29516
344 Ga0207689_10007973 3300025942 Bacteria 9252
345 Ga0207689_10116955 3300025942 Bacteria 2192
346 Ga0207689_10143534 3300025942 Bacteria 1967
347 Ga0207661_10000411 3300025944 Bacteria 27626
348 Ga0207661_10010383 3300025944 Bacteria 6703
349 Ga0207679_10000297 3300025945 Bacteria 37427
350 Ga0207679_10000800 3300025945 Bacteria 20460
351 Ga0207667_10322650 3300025949 Bacteria 1577
352 Ga0207651_10007515 3300025960 Bacteria 5809
353 Ga0207651_10028687 3300025960 Bacteria 3515
354 Ga0207651_10092372 3300025960 Bacteria 2219
355 Ga0207651_10118286 3300025960 Bacteria 2004
356 Ga0207651_10303044 3300025960 Bacteria 1329
357 Ga0207712_10000874 3300025961 Bacteria 21909
358 Ga0207712_10002895 3300025961 Bacteria 10971
359 Ga0207712_10010741 3300025961 Bacteria 5820
360 Ga0207712_10055530 3300025961 Bacteria 2787
361 Ga0207712_10265646 3300025961 Bacteria 1393
362 Ga0207668_10068020 3300025972 Bacteria 2531
363 Ga0207668_10098116 3300025972 Unclassified 2170
364 Ga0207658_10067010 3300025986 Unclassified 2703
365 Ga0207658_10125637 3300025986 Bacteria 2052
366 Ga0207658_10220192 3300025986 Bacteria 1596
367 Ga0207677_10002901 3300026023 Bacteria 9057
368 Ga0207677_10008754 3300026023 Bacteria 5668
369 Ga0207677_10110743 3300026023 Bacteria 2044
370 Ga0207703_10104570 3300026035 Bacteria 2406
371 Ga0207639_10001395 3300026041 Bacteria 16309
372 Ga0207639_10002195 3300026041 Bacteria 13146
373 Ga0207678_10381668 3300026067 Bacteria 1218
374 Ga0207708_10031066 3300026075 Bacteria 4053
375 Ga0207708_10106017 3300026075 Bacteria 2179
376 Ga0207641_10002324 3300026088 Bacteria 17635
377 Ga0207641_10020315 3300026088 Bacteria 5454
378 Ga0207641_10107870 3300026088 Bacteria 2464
379 Ga0207641_10218531 3300026088 Bacteria 1766
380 Ga0207648_10000384 3300026089 Bacteria 48937
381 Ga0207648_10000464 3300026089 Bacteria 45165
382 Ga0207648_10026203 3300026089 Bacteria 5183
383 Ga0207648_10096287 3300026089 Bacteria 2590
384 Ga0207648_10102916 3300026089 Bacteria 2504
385 Ga0207648_10137141 3300026089 Bacteria 2155
386 Ga0207648_10188012 3300026089 Unclassified 1829
387 Ga0207676_10012791 3300026095 Bacteria 6022
388 Ga0207676_10027372 3300026095 Bacteria 4245
389 Ga0207676_10166366 3300026095 Bacteria 1916
390 Ga0207676_10309198 3300026095 Bacteria 1446
391 Ga0207674_10003152 3300026116 Bacteria 20329
392 Ga0207674_10012899 3300026116 Bacteria 9322
393 Ga0207674_10014623 3300026116 Bacteria 8656
394 Ga0207674_10145579 3300026116 Bacteria 2328
395 Ga0207674_10147117 3300026116 Bacteria 2314
396 Ga0207674_10161133 3300026116 Bacteria 2198
397 Ga0207674_10308232 3300026116 Bacteria 1532
398 Ga0207674_10384719 3300026116 Bacteria 1356
399 Ga0207675_100015433 3300026118 Bacteria 7125
400 Ga0207675_100030208 3300026118 Bacteria 5047
401 Ga0207675_100054118 3300026118 Bacteria 3744
402 Ga0207675_100057632 3300026118 Bacteria 3625
403 Ga0207683_10004165 3300026121 Bacteria 12520
404 Ga0207683_10035205 3300026121 Bacteria 4355
405 Ga0207683_10039933 3300026121 Bacteria 4094
406 Ga0207698_10030340 3300026142 Unclassified 3886
407 Ga0207698_10053758 3300026142 Bacteria 3094
408 Ga0207698_10066647 3300026142 Unclassified 2835
409 Ga0207428_10015369 3300027907 Bacteria 6624
410 Ga0268265_10055796 3300028380 Bacteria 3003
411 Ga0268265_10237560 3300028380 Unclassified 1606
412 Ga0268264_10016003 3300028381 Bacteria 6145
413 Ga0268264_10016238 3300028381 Bacteria 6097
414 Ga0268264_10046050 3300028381 Bacteria 3622
415 Ga0268264_10135204 3300028381 Bacteria 2191
416 Ga0268264_10261899 3300028381 Bacteria 1611
417 Ga0268264_10434471 3300028381 Bacteria 1268
418 Ga0307517_10041785 3300028786 Bacteria 4938
419 Ga0265327_10000024 3300031251 Bacteria 382499
420 Ga0265327_10020725 3300031251 Bacteria 3994
421 Ga0307508_10000969 3300031616 Bacteria 33410
422 Ga0307516_10006319 3300031730 Bacteria 13917
423 Ga0307410_10153913 3300031852 Bacteria 1715
424 Ga0373924_0033221 3300035410 Bacteria 2082
425 Ga0373933_0008063 3300035724 Bacteria 5748
426 Ga0373937_0006966 3300036401 Bacteria 9758
427 Ga0395899_0000025 3300037312 Bacteria 350927
428 Ga0395899_0138388 3300037312 Bacteria 1734
429 Ga0395899_0266926 3300037312 Bacteria 1168
430 Ga0395900_0012377 3300037418 Bacteria 8730
431 Ga0395900_0030331 3300037418 Bacteria 5552
432 Ga0395900_0153841 3300037418 Bacteria 2350
433 Ga0395898_0001675 3300037466 Bacteria 29715
434 Ga0395898_0403248 3300037466 Bacteria 1304
435 Ga0395905_0003668 3300037471 Bacteria 16282
436 Ga0395905_0034648 3300037471 Bacteria 4742
437 Ga0395901_0000465 3300038443 Bacteria 47053
438 Ga0395901_0222478 3300038443 Bacteria 1973
439 Ga0436365_0463074 3300039437 Bacteria 9678
440 Ga0439465_0018540 3300041413 Bacteria 2175
441 Ga0451791_0538267 3300041451 Bacteria 1131
442 Ga0451798_0203730 3300041458 Bacteria 2053
443 Ga0451807_1267892 3300041486 Bacteria 1543
444 Ga0439431_0010447 3300041997 Bacteria 2108
445 Ga0439442_001558 3300042002 Bacteria 4497
446 Ga0439445_0002995 3300042004 Bacteria 3780
447 Ga0439449_0029804 3300042007 Bacteria 2033
448 Ga0439449_0046192 3300042007 Unclassified 1613
449 Ga0439457_012813 3300042014 Unclassified 1887
450 Ga0439434_0013034 3300042435 Bacteria 2465
451 Ga0451577_0004648 3300042876 Bacteria 14421
452 Ga0451577_0293523 3300042876 Bacteria 1473
453 Ga0466972_0000044 3300044658 Bacteria 131031
454 Ga0466965_0164080 3300044683 Bacteria 1166
455 Ga0453684_0008300 3300044712 Bacteria 18697
456 Ga0453684_0032450 3300044712 Bacteria 7309
457 Ga0453684_0063844 3300044712 Bacteria 4707
458 Ga0453684_0088704 3300044712 Bacteria 3828
459 Ga0453684_0173708 3300044712 Bacteria 2537
460 Ga0466957_0009943 3300044842 Bacteria 5442
461 Ga0451576_0000426 3300045051 Bacteria 96967
462 Ga0451576_0214186 3300045051 Unclassified 2012
463 Ga0451576_0222101 3300045051 Bacteria 1973
464 Ga0451576_0419529 3300045051 Bacteria 1404
465 Ga0495592_0053232 3300046454 Bacteria 3003
466 Ga0495638_0041084 3300046460 Bacteria 2928
467 Ga0495580_0214025 3300046472 Bacteria 1325
468 Ga0495628_0011209 3300046516 Bacteria 7585
469 Ga0495630_0022287 3300046517 Bacteria 4679
470 Ga0495632_0066911 3300046519 Bacteria 1733
471 Ga0495652_0068780 3300046529 Bacteria 2966
472 Ga0495621_0041888 3300046539 Bacteria 1610
473 Ga0495633_0000125 3300046558 Bacteria 104459
474 Ga0495668_0001712 3300046616 Bacteria 20247
475 Ga0495635_0043624 3300046663 Bacteria 3095
476 Ga0495658_0090971 3300046683 Bacteria 1807
477 Ga0495604_0108331 3300047317 Bacteria 2030
478 Ga0495672_0003219 3300047320 Bacteria 14197
479 Ga0495686_0006905 3300047472 Bacteria 8591
480 Ga0496109_0392666 3300048912 Bacteria 1311
481 Ga0496110_0065464 3300048913 Bacteria 3213
482 Ga0496110_0085614 3300048913 Bacteria 2813
483 Ga0496111_0166348 3300048914 Bacteria 1638
484 Ga0496114_0420497 3300048917 Bacteria 1184
485 Ga0496126_0022924 3300048929 Bacteria 6062
486 Ga0501292_004799 3300049515 Bacteria 1864
487 Ga0501296_003933 3300049519 Bacteria 1603
488 Ga0501297_000709 3300049520 Bacteria 2997
489 Ga0501298_006414 3300049521 Bacteria 1923
490 Ga0501032_0001909 3300049569 Bacteria 16464
491 Ga0501032_0026095 3300049569 Bacteria 4024
492 Ga0501034_0064914 3300049571 Bacteria 3664
493 Ga0501034_0107048 3300049571 Bacteria 2788
494 Ga0501036_0020907 3300049572 Bacteria 5496
495 Ga0501038_0009439 3300049574 Bacteria 8954
496 Ga0501038_0355430 3300049574 Bacteria 1140
497 Ga0501039_0014014 3300049575 Bacteria 6134
498 Ga0501039_0025210 3300049575 Bacteria 4568
499 Ga0501039_0151818 3300049575 Bacteria 1820
500 Ga0501043_0004295 3300049579 Bacteria 11599
501 Ga0501043_0009702 3300049579 Bacteria 7544
502 Ga0501043_0028061 3300049579 Bacteria 4418
503 Ga0501046_0008862 3300049580 Bacteria 8741
504 Ga0501046_0045910 3300049580 Bacteria 3468
505 Ga0501047_0006977 3300049581 Bacteria 10603
506 Ga0501047_0115665 3300049581 Bacteria 2564
507 Ga0501047_0116316 3300049581 Bacteria 2556
508 Ga0501047_0181955 3300049581 Bacteria 1968
509 Ga0501047_0230862 3300049581 Unclassified 1704
510 Ga0501047_0321263 3300049581 Bacteria 1388
511 Ga0501048_0008239 3300049582 Bacteria 7885
512 Ga0501070_0043299 3300049586 Bacteria 3747
513 Ga0501073_0028591 3300049589 Bacteria 3983
514 Ga0501074_0002599 3300049590 Bacteria 12616
515 Ga0501077_0115430 3300049593 Bacteria 1702
516 Ga0501201_000104 3300049651 Bacteria 6685
517 Ga0501202_000399 3300049652 Bacteria 6080
518 Ga0501207_000110 3300049654 Bacteria 6952
519 Ga0501216_021808 3300049660 Bacteria 1128
520 Ga0501217_011893 3300049661 Bacteria 1931
521 Ga0501223_000426 3300049663 Bacteria 10221
522 Ga0501224_002132 3300049664 Bacteria 2679
523 Ga0501233_020520 3300049668 Bacteria 1411
524 Ga0501235_009731 3300049669 Bacteria 2102
525 Ga0501240_006226 3300049673 Bacteria 1462
526 Ga0501242_001381 3300049674 Bacteria 2420
527 Ga0501250_000249 3300049680 Bacteria 3265
528 Ga0501251_004689 3300049681 Bacteria 1420
529 Ga0501252_000435 3300049682 Bacteria 3158
530 Ga0501257_001750 3300049686 Bacteria 4522
531 Ga0501221_000120 3300049704 Bacteria 9800
532 Ga0501225_0002029 3300049705 Bacteria 6302
533 Ga0501234_007647 3300049707 Bacteria 1688
534 Ga0501079_0113443 3300049741 Bacteria 2106
535 Ga0501080_0167597 3300049742 Bacteria 2027
536 Ga0501083_0030945 3300049744 Bacteria 3673
537 Ga0501241_007462 3300049758 Bacteria 2002
538 Ga0501266_000867 3300049763 Bacteria 3937
539 Ga0501268_008919 3300049765 Bacteria 1531
540 Ga0501035_0002433 3300049822 Bacteria 18202
541 Ga0501035_0008252 3300049822 Bacteria 9704
542 Ga0501035_0306773 3300049822 Bacteria 1336
543 Ga0501044_0004638 3300049823 Bacteria 15377
544 Ga0501044_0009632 3300049823 Bacteria 10511
545 Ga0501044_0096487 3300049823 Bacteria 2978
546 Ga0501045_0341183 3300049824 Bacteria 1115
547 Ga0501212_004112 3300049851 Bacteria 1859
548 Ga0501284_00351 3300050005 Bacteria 2438
549 nmdc:mga0k408_1660_c1 3300050493 Bacteria 12015
550 nmdc:mga07m45_155469_c1 3300050496 Unclassified 1327
551 nmdc:mga09592_5718_c1 3300050508 Bacteria 10141
552 nmdc:mga0qj67_29873_c1 3300050509 Bacteria 4236
553 nmdc:mga0qj67_89396_c1 3300050509 Bacteria 2474
554 nmdc:mga06r32_69393_c1 3300050510 Bacteria 3406
555 nmdc:mga06r32_9580_c1 3300050510 Bacteria 8749
556 nmdc:mga08y16_144564_c1 3300050511 Bacteria 2472
557 nmdc:mga08y16_1594_c1 3300050511 Bacteria 22911
558 nmdc:mga08y16_257572_c1 3300050511 Bacteria 1802
559 nmdc:mga0n895_90047_c1 3300050512 Bacteria 3069
560 Ga0500578_0000026 3300053086 Bacteria 145328
561 Ga0500578_0048259 3300053086 Bacteria 2732
562 Ga0500644_0002676 3300053088 Bacteria 4449
563 Ga0500581_024454 3300053089 Bacteria 3066
564 Ga0500583_0002407 3300053092 Bacteria 5615
565 Ga0500583_0003847 3300053092 Bacteria 4803
566 Ga0500583_0013181 3300053092 Bacteria 3188
567 Ga0500651_0028977 3300053093 Bacteria 3480
568 Ga0500569_000110 3300053109 Bacteria 12745
569 Ga0500607_038944 3300053121 Bacteria 2584
570 Ga0500652_000936 3300053131 Bacteria 9654
571 Ga0500658_0029122 3300053134 Bacteria 2146
572 Ga0500559_0004789 3300053136 Bacteria 6336
573 Ga0500559_0009116 3300053136 Bacteria 4311
574 Ga0500568_0000142 3300053139 Bacteria 64049
575 Ga0500577_0000344 3300053142 Bacteria 11965
576 Ga0500589_000077 3300053147 Bacteria 15331
577 Ga0500604_0000772 3300053151 Bacteria 8801
578 Ga0500616_0004658 3300053153 Bacteria 9670
579 Ga0500622_0000556 3300053156 Bacteria 34185
580 Ga0500633_0000698 3300053160 Bacteria 5667
581 Ga0500636_0022605 3300053177 Bacteria 3718
582 Ga0500637_0032773 3300053178 Bacteria 2898
583 Ga0500611_000003 3300053727 Bacteria 333431
584 Ga0501084_0064267 3300054114 Bacteria 3072
585 Ga0500661_000084 3300055283 Bacteria 14952
586 Ga0501082_0179177 3300060353 Bacteria 1843
587 2883069126 2883068021 Bacteria 6192739
588 2929240093 2929239360 Bacteria 7745570
589 2929921799 2929921140 Bacteria 8649150
590 8003154131 8003151029 Bacteria 8187759
591 Ga0495643_0092174
592 JGI24740J21852_10000715
593 JGI24739J22299_10008942
594 JGI25154J39366_1000023
595 JGI25153J46596_10000396
596 rootL2_10002906
597 rootL2_10002907
598 rootH1_10037492
599 rootH1_10090199
600 JGI25160J50197_1012018
601 JGI25160J50197_1032919
602 Ga0055535_1002010
603 Ga0055542_1001495
604 Ga0055526_1013423
605 Ga0055528_1001056
606 Ga0055531_10000080
607 Ga0065165_1000027
608 Ga0065714_10022897
609 Ga0065712_10098576
610 Ga0065707_10004731
611 Ga0065707_10183665
612 Ga0065707_10193980
613 Ga0070658_10081597
614 Ga0070676_10003561
615 Ga0070683_100000327
616 Ga0070683_100047705
617 Ga0070690_100068855
618 Ga0070690_100068857
619 Ga0070690_100099446
620 Ga0070670_100004281
621 Ga0070670_100034017
622 Ga0070670_100070694
623 Ga0070670_100342569
624 Ga0070670_100384296
625 Ga0070677_10039565
626 Ga0070677_10041642
627 Ga0070677_10055932
628 Ga0070677_10094273
629 Ga0068869_100004762
630 Ga0068869_100089449
631 Ga0068869_100099396
632 Ga0068869_100154425
633 Ga0070666_10038674
634 Ga0070682_100000012
635 Ga0068868_100001123
636 Ga0068868_100057324
637 Ga0068868_100094374
638 Ga0070660_100000435
639 Ga0070660_100255862
640 Ga0070689_100023985
641 Ga0070689_100220257
642 Ga0070689_100248682
643 Ga0070661_100001196
644 Ga0070661_100006373
645 Ga0070661_100048650
646 Ga0070668_100027817
647 Ga0070668_100028581
648 Ga0070668_100074248
649 Ga0070669_100099164
650 Ga0070669_100180196
651 Ga0070675_100006806
652 Ga0070675_100022259
653 Ga0070675_100022293
654 Ga0070675_100077331
655 Ga0070675_100085838
656 Ga0070675_100250588
657 Ga0070675_100300049
658 Ga0070671_100059593
659 Ga0070671_100187645
660 Ga0070671_100194693
661 Ga0070674_100275092
662 Ga0070673_100002938
663 Ga0070673_100084680
664 Ga0070673_100312063
665 Ga0070688_100035603
666 Ga0070688_100097684
667 Ga0070659_100002952
668 Ga0070659_100002987
669 Ga0070659_100021577
670 Ga0070659_100063784
671 Ga0070667_100031019
672 Ga0070667_100187019
673 Ga0070714_100230134
674 Ga0070663_100024487
675 Ga0070663_100059505
676 Ga0070678_100004280
677 Ga0070678_100082929
678 Ga0070678_100159151
679 Ga0070662_100114955
680 Ga0070662_100158708
681 Ga0068867_100001627
682 Ga0068867_100065778
683 Ga0068867_100066673
684 Ga0068867_100076624
685 Ga0068867_100125835
686 Ga0070685_10124745
687 Ga0070706_100433638
688 Ga0070698_100000282
689 Ga0070698_100001103
690 Ga0070679_100004530
691 Ga0070684_100000290
692 Ga0070684_100014260
693 Ga0070684_100016576
694 Ga0068853_100000837
695 Ga0068853_100240092
696 Ga0070672_100082512
697 Ga0070672_100088578
698 Ga0070672_100111023
699 Ga0070672_100200059
700 Ga0070704_100281855
701 Ga0068855_100146995
702 Ga0070664_100000509
703 Ga0070664_100085554
704 Ga0070664_100136488
705 Ga0070664_100312036
706 Ga0068857_100000579
707 Ga0068857_100026014
708 Ga0068857_100203096
709 Ga0068857_100238897
710 Ga0068852_100003313
711 Ga0068852_100428613
712 Ga0068852_100524417
713 Ga0068859_100004960
714 Ga0068859_100007913
715 Ga0068859_100024205
716 Ga0068859_100030568
717 Ga0068859_100072558
718 Ga0068859_100314608
719 Ga0068859_100388747
720 Ga0068859_100457941
721 Ga0068859_100477343
722 Ga0068864_100075356
723 Ga0068864_100137476
724 Ga0068866_10059834
725 Ga0068866_10103928
726 Ga0068861_100003222
727 Ga0068861_100003315
728 Ga0068861_100085481
729 Ga0068861_100090096
730 Ga0068870_10005253
731 Ga0068870_10017614
732 Ga0068863_100019337
733 Ga0068863_100093742
734 Ga0068863_100239998
735 Ga0068858_100333807
736 Ga0068860_100012951
737 Ga0068860_100022295
738 Ga0068860_100023666
739 Ga0068860_100024407
740 Ga0068860_100183639
741 Ga0068860_100229297
742 Ga0068860_100471008
743 Ga0068862_100043728
744 Ga0068862_100071434
745 Ga0068862_100196324
746 Ga0068862_100255907
747 Ga0075366_10009800
748 Ga0075366_10022569
749 Ga0097621_100006322
750 Ga0097621_100013151
751 Ga0097621_100075035
752 Ga0075370_10062278
753 Ga0068871_100011482
754 Ga0068871_100138754
755 Ga0068871_100139556
756 Ga0068871_100168979
757 Ga0068871_100206806
758 Ga0075428_100004587
759 Ga0075430_100055545
760 Ga0075431_100009229
761 Ga0075431_100084913
762 Ga0075434_100090839
763 Ga0075429_100000261
764 Ga0075429_100004600
765 Ga0068865_100139293
766 Ga0068865_100222766
767 Ga0097620_100004960
768 Ga0097620_100007913
769 Ga0097620_100024205
770 Ga0097620_100030573
771 Ga0097620_100072554
772 Ga0097620_100314603
773 Ga0097620_100388743
774 Ga0097620_100457925
775 Ga0097620_100477326
776 Ga0105240_10030192
777 Ga0111539_10003763
778 Ga0111539_10065216
779 Ga0111539_10554300
780 Ga0105247_10001391
781 Ga0114129_10021302
782 Ga0114129_10135009
783 Ga0105242_10008286
784 Ga0105242_10044394
785 Ga0105242_10078956
786 Ga0105242_10336363
787 Ga0105249_10001404
788 Ga0105249_10003219
789 Ga0105249_10003256
790 Ga0105249_10003625
791 Ga0105249_10017160
792 Ga0105249_10018659
793 Ga0105249_10159063
794 Ga0105249_10286380
795 Ga0105249_10451418
796 Ga0105239_10170971
797 Ga0105239_10179515
798 Ga0105246_10051200
799 Ga0157373_10006857
800 Ga0157373_10020602
801 Ga0157373_10055385
802 Ga0157373_10141691
803 Ga0157371_10000518
804 Ga0157371_10012028
805 Ga0157371_10021069
806 Ga0157371_10027482
807 Ga0157371_10028520
808 Ga0157371_10038752
809 Ga0157371_10041458
810 Ga0157370_10005116
811 Ga0157370_10075581
812 Ga0157370_10361785
813 Ga0157369_10056076
814 Ga0157374_10000587
815 Ga0157374_10004126
816 Ga0157374_10062741
817 Ga0157374_10144026
818 Ga0157374_10406873
819 Ga0163162_10002830
820 Ga0163162_10005849
821 Ga0163162_10022504
822 Ga0163162_10066324
823 Ga0163162_10130099
824 Ga0157372_10025914
825 Ga0157372_10031849
826 Ga0157372_10166106
827 Ga0157372_10242836
828 Ga0157372_10389700
829 Ga0157375_10026685
830 Ga0157375_10114623
831 Ga0157375_10127275
832 Ga0157375_10145411
833 Ga0157375_10316559
834 Ga0163163_10000867
835 Ga0163163_10024406
836 Ga0163163_10078371
837 Ga0157380_10003760
838 Ga0157380_10009876
839 Ga0157380_10029152
840 Ga0157380_10144960
841 Ga0157377_10001699
842 Ga0157377_10019476
843 Ga0157377_10084354
844 Ga0157379_10011401
845 Ga0157379_10036734
846 Ga0157376_10014832
847 Ga0157376_10025221
848 Ga0157376_10033135
849 Ga0157376_10048291
850 Ga0163161_10008580
851 Ga0163161_10076295
852 Ga0163161_10080597
853 Ga0209258_100116
854 Ga0209646_1000004
855 Ga0209646_1001871
856 Ga0209026_1000095
857 Ga0209148_1000251
858 Ga0209129_1018188
859 Ga0209673_1000203
860 Ga0209564_1006438
861 Ga0209564_1019459
862 Ga0209758_1001033
863 Ga0209758_1006449
864 Ga0209758_1012105
865 Ga0207426_1000313
866 Ga0207426_1006511
867 Ga0209257_1000004
868 Ga0209257_1001198
869 Ga0207697_10040155
870 Ga0207656_10127275
871 Ga0207682_10051684
872 Ga0207642_10069556
873 Ga0207642_10069637
874 Ga0207710_10000673
875 Ga0207688_10026069
876 Ga0207680_10023426
877 Ga0207647_10000210
878 Ga0207647_10005891
879 Ga0207645_10000050
880 Ga0207645_10008204
881 Ga0207643_10004301
882 Ga0207643_10011252
883 Ga0207643_10119533
884 Ga0207643_10157450
885 Ga0207705_10051221
886 Ga0207705_10143417
887 Ga0207654_10138921
888 Ga0207695_10055852
889 Ga0207662_10047868
890 Ga0207657_10012449
891 Ga0207657_10014890
892 Ga0207649_10000567
893 Ga0207649_10029390
894 Ga0207649_10104033
895 Ga0207652_10000090
896 Ga0207681_10018862
897 Ga0207681_10046209
898 Ga0207681_10064580
899 Ga0207681_10100378
900 Ga0207681_10236915
901 Ga0207650_10008006
902 Ga0207650_10045278
903 Ga0207650_10126230
904 Ga0207659_10053668
905 Ga0207659_10116237
906 Ga0207659_10186142
907 Ga0207659_10297131
908 Ga0207644_10132231
909 Ga0207644_10137763
910 Ga0207644_10196281
911 Ga0207690_10013908
912 Ga0207690_10048350
913 Ga0207706_10009149
914 Ga0207706_10029711
915 Ga0207706_10165302
916 Ga0207686_10000372
917 Ga0207709_10251962
918 Ga0207670_10003217
919 Ga0207670_10014483
920 Ga0207670_10037728
921 Ga0207670_10042074
922 Ga0207669_10168043
923 Ga0207704_10153017
924 Ga0207691_10004485
925 Ga0207691_10059512
926 Ga0207691_10081462
927 Ga0207691_10130341
928 Ga0207691_10169108
929 Ga0207691_10182912
930 Ga0207691_10214994
931 Ga0207691_10359581
932 Ga0207689_10000664
933 Ga0207689_10000843
934 Ga0207689_10007973
935 Ga0207689_10116955
936 Ga0207689_10143534
937 Ga0207661_10000411
938 Ga0207661_10010383
939 Ga0207679_10000297
940 Ga0207679_10000800
941 Ga0207667_10322650
942 Ga0207651_10007515
943 Ga0207651_10028687
944 Ga0207651_10092372
945 Ga0207651_10118286
946 Ga0207651_10303044
947 Ga0207712_10000874
948 Ga0207712_10002895
949 Ga0207712_10010741
950 Ga0207712_10055530
951 Ga0207712_10265646
952 Ga0207668_10068020
953 Ga0207668_10098116
954 Ga0207658_10067010
955 Ga0207658_10125637
956 Ga0207658_10220192
957 Ga0207677_10002901
958 Ga0207677_10008754
959 Ga0207677_10110743
960 Ga0207703_10104570
961 Ga0207639_10001395
962 Ga0207639_10002195
963 Ga0207678_10381668
964 Ga0207708_10031066
965 Ga0207708_10106017
966 Ga0207641_10002324
967 Ga0207641_10020315
968 Ga0207641_10107870
969 Ga0207641_10218531
970 Ga0207648_10000384
971 Ga0207648_10000464
972 Ga0207648_10026203
973 Ga0207648_10096287
974 Ga0207648_10102916
975 Ga0207648_10137141
976 Ga0207648_10188012
977 Ga0207676_10012791
978 Ga0207676_10027372
979 Ga0207676_10166366
980 Ga0207676_10309198
981 Ga0207674_10003152
982 Ga0207674_10012899
983 Ga0207674_10014623
984 Ga0207674_10145579
985 Ga0207674_10147117
986 Ga0207674_10161133
987 Ga0207674_10308232
988 Ga0207674_10384719
989 Ga0207675_100015433
990 Ga0207675_100030208
991 Ga0207675_100054118
992 Ga0207675_100057632
993 Ga0207683_10004165
994 Ga0207683_10035205
995 Ga0207683_10039933
996 Ga0207698_10030340
997 Ga0207698_10053758
998 Ga0207698_10066647
999 Ga0207428_10015369
1000 Ga0268265_10055796
1001 Ga0268265_10237560
1002 Ga0268264_10016003
1003 Ga0268264_10016238
1004 Ga0268264_10046050
1005 Ga0268264_10135204
1006 Ga0268264_10261899
1007 Ga0268264_10434471
1008 Ga0307517_10041785
1009 Ga0265327_10000024
1010 Ga0265327_10020725
1011 Ga0307508_10000969
1012 Ga0307516_10006319
1013 Ga0307410_10153913
1014 Ga0373924_0033221
1015 Ga0373933_0008063
1016 Ga0373937_0006966
1017 Ga0395899_0000025
1018 Ga0395899_0138388
1019 Ga0395899_0266926
1020 Ga0395900_0012377
1021 Ga0395900_0030331
1022 Ga0395900_0153841
1023 Ga0395898_0001675
1024 Ga0395898_0403248
1025 Ga0395905_0003668
1026 Ga0395905_0034648
1027 Ga0395901_0000465
1028 Ga0395901_0222478
1029 Ga0436365_0463074
1030 Ga0439465_0018540
1031 Ga0451791_0538267
1032 Ga0451798_0203730
1033 Ga0451807_1267892
1034 Ga0439431_0010447
1035 Ga0439442_001558
1036 Ga0439445_0002995
1037 Ga0439449_0029804
1038 Ga0439449_0046192
1039 Ga0439457_012813
1040 Ga0439434_0013034
1041 Ga0451577_0004648
1042 Ga0451577_0293523
1043 Ga0466972_0000044
1044 Ga0466965_0164080
1045 Ga0453684_0008300
1046 Ga0453684_0032450
1047 Ga0453684_0063844
1048 Ga0453684_0088704
1049 Ga0453684_0173708
1050 Ga0466957_0009943
1051 Ga0451576_0000426
1052 Ga0451576_0214186
1053 Ga0451576_0222101
1054 Ga0451576_0419529
1055 Ga0495592_0053232
1056 Ga0495638_0041084
1057 Ga0495580_0214025
1058 Ga0495628_0011209
1059 Ga0495630_0022287
1060 Ga0495632_0066911
1061 Ga0495652_0068780
1062 Ga0495621_0041888
1063 Ga0495633_0000125
1064 Ga0495668_0001712
1065 Ga0495635_0043624
1066 Ga0495658_0090971
1067 Ga0495604_0108331
1068 Ga0495672_0003219
1069 Ga0495686_0006905
1070 Ga0496109_0392666
1071 Ga0496110_0065464
1072 Ga0496110_0085614
1073 Ga0496111_0166348
1074 Ga0496114_0420497
1075 Ga0496126_0022924
1076 Ga0501292_004799
1077 Ga0501296_003933
1078 Ga0501297_000709
1079 Ga0501298_006414
1080 Ga0501032_0001909
1081 Ga0501032_0026095
1082 Ga0501034_0064914
1083 Ga0501034_0107048
1084 Ga0501036_0020907
1085 Ga0501038_0009439
1086 Ga0501038_0355430
1087 Ga0501039_0014014
1088 Ga0501039_0025210
1089 Ga0501039_0151818
1090 Ga0501043_0004295
1091 Ga0501043_0009702
1092 Ga0501043_0028061
1093 Ga0501046_0008862
1094 Ga0501046_0045910
1095 Ga0501047_0006977
1096 Ga0501047_0115665
1097 Ga0501047_0116316
1098 Ga0501047_0181955
1099 Ga0501047_0230862
1100 Ga0501047_0321263
1101 Ga0501048_0008239
1102 Ga0501070_0043299
1103 Ga0501073_0028591
1104 Ga0501074_0002599
1105 Ga0501077_0115430
1106 Ga0501201_000104
1107 Ga0501202_000399
1108 Ga0501207_000110
1109 Ga0501216_021808
1110 Ga0501217_011893
1111 Ga0501223_000426
1112 Ga0501224_002132
1113 Ga0501233_020520
1114 Ga0501235_009731
1115 Ga0501240_006226
1116 Ga0501242_001381
1117 Ga0501250_000249
1118 Ga0501251_004689
1119 Ga0501252_000435
1120 Ga0501257_001750
1121 Ga0501221_000120
1122 Ga0501225_0002029
1123 Ga0501234_007647
1124 Ga0501079_0113443
1125 Ga0501080_0167597
1126 Ga0501083_0030945
1127 Ga0501241_007462
1128 Ga0501266_000867
1129 Ga0501268_008919
1130 Ga0501035_0002433
1131 Ga0501035_0008252
1132 Ga0501035_0306773
1133 Ga0501044_0004638
1134 Ga0501044_0009632
1135 Ga0501044_0096487
1136 Ga0501045_0341183
1137 Ga0501212_004112
1138 Ga0501284_00351
1139 nmdc:mga0k408_1660_c1
1140 nmdc:mga07m45_155469_c1
1141 nmdc:mga09592_5718_c1
1142 nmdc:mga0qj67_29873_c1
1143 nmdc:mga0qj67_89396_c1
1144 nmdc:mga06r32_69393_c1
1145 nmdc:mga06r32_9580_c1
1146 nmdc:mga08y16_144564_c1
1147 nmdc:mga08y16_1594_c1
1148 nmdc:mga08y16_257572_c1
1149 nmdc:mga0n895_90047_c1
1150 Ga0500578_0000026
1151 Ga0500578_0048259
1152 Ga0500644_0002676
1153 Ga0500581_024454
1154 Ga0500583_0002407
1155 Ga0500583_0003847
1156 Ga0500583_0013181
1157 Ga0500651_0028977
1158 Ga0500569_000110
1159 Ga0500607_038944
1160 Ga0500652_000936
1161 Ga0500658_0029122
1162 Ga0500559_0004789
1163 Ga0500559_0009116
1164 Ga0500568_0000142
1165 Ga0500577_0000344
1166 Ga0500589_000077
1167 Ga0500604_0000772
1168 Ga0500616_0004658
1169 Ga0500622_0000556
1170 Ga0500633_0000698
1171 Ga0500636_0022605
1172 Ga0500637_0032773
1173 Ga0500611_000003
1174 Ga0501084_0064267
1175 Ga0500661_000084
1176 Ga0501082_0179177
1177 2883069126
1178 2929240093
1179 2929921799
1180 8003154131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02445

NadA

Quinolinate synthetase A protein

58

356

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lqm-assembly1.cif.gz_A structure of quinolinate synthase y21f mutant in complex with citrate 0.9637 28 329
7p4p-assembly1.cif.gz_A structure of the quinolinate synthase a84l variant complexed with citrate 0.9629 28 329
6ora-assembly2.cif.gz_B an unexpected intermediate in the reaction catalyzed by quinolinate synthase 0.9607 27 330
6ora-assembly2.cif.gz_B an unexpected intermediate in the reaction catalyzed by quinolinate synthase 0.9576 27 330
1wzu-assembly1.cif.gz_A crystal structure of quinolinate synthase (nada) 0.9567 26 328
ID Description Score Start End Superfamily
af_Q57850_5_79_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 1.001 29 102 3.40.50.10800
af_P11458_25_111_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9805 29 106 3.40.50.10800
af_Q57850_5_79_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9749 29 102 3.40.50.10800
af_P9WJK1_121_190_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9707 115 184 3.40.50.10800
af_Q57850_176_259_3.40.50.10800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NadA-like 0.9613 197 275 3.40.50.10800
ID Description Score Start End GO Terms
AF-A0A496RG29-F1-model_v4 quinolinate synthase (EC 2.5.1.72) 1.005 27 108 GO:0005829
GO:0008987
GO:0034628
GO:0046872
GO:0051539
AF-A0A7V4Y254-F1-model_v4 quinolinate synthase (EC 2.5.1.72) 1.003 28 108 GO:0008987
GO:0034628
GO:0046872
GO:0051539
AF-A0A257AE05-F1-model_v4 quinolinate synthase (EC 2.5.1.72) 1.003 27 104 GO:0008987
GO:0034628
GO:0046872
GO:0051539
AF-A0A7K0XRE9-F1-model_v4 quinolinate synthase (EC 2.5.1.72) 1.001 29 109 GO:0005829
GO:0008987
GO:0034628
GO:0046872
GO:0051539
AF-A0A354D7E3-F1-model_v4 deleted 0.9995 28 236

Map