metagRoot

F467040

General Info

Members	Datasets	Scaffolds	Average Seq Length
591	310	557	257

Family's Representative Sequence

Representative Sequence	3300005844\|Ga0068862_100508581\|Ga0068862_1005085811
Length	304
Sequence	VGESVGARRKISALDIPPPGAPFDDSTFEQFFDPPGRSRAGFSRSNKETLMAKRSTKRRHAQGVLNVEEFQRDDRRQRNLKVLDGGYHPANDATRDQSFVKNVRPKSKGQTALMEAIDAHSLSLALGPAGTGKTYIAIAKAVEALENGKVGRIVLSRPAVEAGESLGYLPGAMEDKLAPYLRPLYDALTDRLSAKRLKALMAEGLIEIAPVGFMRGRTLNNAFVVIDEAQNCTYGQIKMLLTRLGWHSTMVVTGDPAQTDLLPDLSGLHTVADKLESVPNIAVIRLGDADIVRHPLVASMLGVL

Samples

	Sample ID	Description	Type	Environment
1	2510917020	Caulobacter sp. AP07	Isolate	Rhizosphere
2	2582581279	Caulobacter henricii OK261	Isolate	Rhizosphere
3	2582581280	Caulobacter henricii CF287	Isolate	Rhizosphere
4	2582581293	Caulobacter henricii YR570	Isolate	Rhizosphere
5	2585428106	Caulobacter sp. OV484	Isolate	Rhizosphere
6	2643221545	Caulobacter sp. Root1455	Isolate	Unclassified
7	2643221552	Caulobacter sp. Root1472	Isolate	Unclassified
8	2643221574	Brevundimonas sp. Root608	Isolate	Unclassified
9	2643221583	Caulobacter sp. Root655	Isolate	Unclassified
10	2643221584	Caulobacter sp. Root656	Isolate	Unclassified
11	2643221598	Phenylobacterium sp. Root700	Isolate	Unclassified
12	2643221614	Phenylobacterium sp. Root77	Isolate	Unclassified
13	2643221640	Caulobacter sp. Root342	Isolate	Unclassified
14	2643221642	Caulobacter sp. Root343	Isolate	Unclassified
15	2643221661	Phenylobacterium sp. Root1277	Isolate	Unclassified
16	2643221663	Brevundimonas sp. Root1279	Isolate	Unclassified
17	2643221666	Phenylobacterium sp. Root1290	Isolate	Unclassified
18	2643221691	Caulobacter sp. Root487D2Y	Isolate	Unclassified
19	2643221699	Brevundimonas sp. Root1423	Isolate	Unclassified
20	2739367756	Asticcacaulis sp. CF398	Isolate	Unclassified
21	2791355048	Caulobacter flavus CGMCC1 15093	Isolate	Rhizosphere
22	2818991435	Caulobacter henricii 536	Isolate	Unclassified
23	2818991454	Caulobacter rhizosphaerae 3260	Isolate	Rhizosphere
24	2843744320	Caulobacter flavus RHGG3	Isolate	Unclassified
25	2849560528	Caulobacter zeae 410	Isolate	Unclassified
26	2849573788	Caulobacter endophyticus 774	Isolate	Unclassified
27	2851153111	Caulobacter radicis 736	Isolate	Unclassified
28	2857504554	Caulobacter sp. R-72291	Isolate	Unclassified
29	2884960567	Caulobacter sp. 602-1	Isolate	Rhizosphere
30	2898329390	Caulobacter sp. 602-2	Isolate	Rhizosphere
31	2928531327	Caulobacter sp. 1776	Isolate	Rhizosphere
32	2928972540	Brevundimonas sp. 1080	Isolate	Rhizosphere
33	2941485952	Brevundimonas faecalis 2814	Isolate	Rhizosphere
34	2977240413	Brevundimonas vesicularis SORGH_AS 431	Isolate	Unclassified
35	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
36	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
37	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
38	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
39	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
40	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
41	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
42	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
43	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
44	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
45	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
46	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
47	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
48	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
49	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
50	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
51	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
52	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
53	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
54	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
55	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
56	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
57	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
58	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
59	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
60	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
61	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
62	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
63	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
64	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
65	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
66	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
67	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
68	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
69	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
70	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
71	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
72	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
73	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
74	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
75	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
76	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
77	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
78	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
79	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
80	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
81	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
82	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
83	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
84	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
85	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
86	3300012512	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510	Metagenome	Rhizosphere
87	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
88	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
89	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
90	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
91	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
92	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
93	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
94	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
95	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
96	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
97	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
98	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
100	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
101	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
102	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
103	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
104	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
105	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
106	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
107	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
108	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
144	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
145	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
146	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
147	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
148	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
149	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
150	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
151	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
152	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
153	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
154	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
155	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
156	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
157	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
158	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
159	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
160	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
161	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
162	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
163	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
164	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
165	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
166	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
167	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
168	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
169	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
170	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
171	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
172	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
173	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
174	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
175	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
176	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
177	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
178	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
179	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
180	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
181	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
182	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
183	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
184	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
185	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
186	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
187	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
188	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
189	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
190	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
191	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
192	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
193	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
194	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
195	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
196	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
197	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
198	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
199	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
200	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
201	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
202	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
203	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
204	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
205	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
206	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
207	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
208	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
209	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
210	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
211	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
212	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
213	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
214	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
215	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
216	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
217	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
218	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
219	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
220	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
221	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
222	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
223	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
224	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
225	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
226	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
227	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
228	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
229	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
230	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
231	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
232	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
233	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
234	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
235	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
236	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
237	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
238	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
239	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
240	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
241	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
242	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
243	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
244	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
245	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
246	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
247	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
248	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
249	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
250	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
251	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
252	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
253	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
254	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
255	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
256	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
257	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
258	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
259	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
260	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
261	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
262	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
263	3300049671	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought	Metagenome	Rhizosphere
264	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
265	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
266	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
267	3300049760	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control	Metagenome	Rhizosphere
268	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
269	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
270	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
271	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
272	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
273	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
274	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
275	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
276	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
277	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
278	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
279	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
280	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
281	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
282	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
283	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
284	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
285	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
286	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
287	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
288	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
289	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
290	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
291	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
292	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
293	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
294	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
295	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
296	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
297	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
298	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
299	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
300	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
301	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
302	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
303	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
304	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
305	3300053725	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere	Metagenome	Endosphere
306	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
307	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
308	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
309	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
310	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	94.25
Metatranscriptomes	0
Isolates	5.75

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	18.78
Nodule	0
Rhizoplane	3.21
Rhizosphere	68.02
Stem	0
Stem Tuber	0
Unclassified	9.98

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25153J46596_10010891	3300003215	Bacteria	4067
2	rootH2_10017394	3300003320	Bacteria	4506
3	rootH2_10058366	3300003320	Bacteria	3429
4	Ga0055537_1003294	3300003773	Bacteria	5006
5	Ga0055524_1011767	3300003775	Bacteria	3397
6	Ga0055536_1000678	3300003781	Bacteria	22920
7	Ga0055536_1000767	3300003781	Bacteria	21385
8	Ga0055528_1002069	3300003790	Bacteria	11185
9	Ga0055530_10000014	3300003791	Bacteria	151346
10	Ga0055530_10002649	3300003791	Bacteria	11194
11	Ga0055530_10020492	3300003791	Bacteria	1974
12	Ga0055531_10001084	3300003794	Bacteria	21385
13	Ga0055531_10002273	3300003794	Bacteria	12998
14	Ga0055531_10008889	3300003794	Bacteria	5218
15	Ga0055531_10018600	3300003794	Bacteria	2861
16	Ga0055531_10019031	3300003794	Bacteria	2803
17	Ga0065165_1000421	3300005262	Bacteria	66912
18	Ga0065165_1001235	3300005262	Bacteria	29240
19	Ga0065165_1017103	3300005262	Bacteria	2686
20	Ga0070658_10112567	3300005327	Bacteria	2256
21	Ga0070658_10192444	3300005327	Bacteria	1719
22	Ga0070658_10258032	3300005327	Bacteria	1480
23	Ga0070670_100037672	3300005331	Bacteria	4160
24	Ga0068869_100414993	3300005334	Bacteria	1110
25	Ga0070666_10016575	3300005335	Bacteria	4715
26	Ga0070680_100000322	3300005336	Bacteria	32136
27	Ga0070680_100022180	3300005336	Bacteria	5053
28	Ga0070691_10010796	3300005341	Bacteria	4166
29	Ga0070668_100000549	3300005347	Bacteria	25136
30	Ga0070668_100001852	3300005347	Bacteria	15429
31	Ga0070668_100002629	3300005347	Bacteria	13197
32	Ga0070668_100005544	3300005347	Bacteria	9366
33	Ga0070668_100010967	3300005347	Bacteria	6745
34	Ga0070671_100001249	3300005355	Bacteria	19052
35	Ga0070671_100114705	3300005355	Bacteria	2264
36	Ga0070659_100003660	3300005366	Bacteria	10957
37	Ga0070659_100008802	3300005366	Bacteria	7394
38	Ga0070667_100002898	3300005367	Bacteria	14735
39	Ga0070667_100009964	3300005367	Bacteria	7876
40	Ga0070667_100014299	3300005367	Bacteria	6557
41	Ga0070678_100283053	3300005456	Bacteria	1403
42	Ga0070662_100106182	3300005457	Bacteria	2133
43	Ga0070681_10012089	3300005458	Bacteria	8559
44	Ga0070681_10141926	3300005458	Bacteria	2331
45	Ga0070679_100029584	3300005530	Bacteria	5404
46	Ga0070665_100000183	3300005548	Bacteria	111514
47	Ga0070665_100004470	3300005548	Bacteria	14691
48	Ga0070665_100009325	3300005548	Bacteria	9933
49	Ga0070665_100013500	3300005548	Bacteria	8216
50	Ga0070665_100035485	3300005548	Bacteria	5015
51	Ga0070665_100067171	3300005548	Bacteria	3596
52	Ga0068855_100060821	3300005563	Bacteria	4415
53	Ga0068855_100076437	3300005563	Bacteria	3886
54	Ga0068855_100161031	3300005563	Bacteria	2547
55	Ga0068855_100253647	3300005563	Bacteria	1962
56	Ga0070664_100015805	3300005564	Bacteria	6179
57	Ga0068856_100189760	3300005614	Bacteria	2069
58	Ga0068856_100432170	3300005614	Bacteria	1337
59	Ga0068852_100049841	3300005616	Bacteria	3584
60	Ga0068859_100013177	3300005617	Bacteria	8302
61	Ga0068859_100026452	3300005617	Bacteria	5819
62	Ga0068859_100146460	3300005617	Bacteria	2437
63	Ga0068859_100370012	3300005617	Bacteria	1529
64	Ga0068864_100000488	3300005618	Bacteria	34291
65	Ga0068864_100005053	3300005618	Bacteria	10801
66	Ga0068864_100061557	3300005618	Bacteria	3251
67	Ga0068864_100128308	3300005618	Bacteria	2275
68	Ga0068864_100433316	3300005618	Bacteria	1255
69	Ga0068861_100017527	3300005719	Bacteria	5088
70	Ga0068863_100000023	3300005841	Bacteria	186490
71	Ga0068863_100000391	3300005841	Bacteria	44423
72	Ga0068863_100001912	3300005841	Bacteria	20698
73	Ga0068863_100025578	3300005841	Bacteria	5628
74	Ga0068863_100182651	3300005841	Bacteria	2013
75	Ga0068858_100000322	3300005842	Bacteria	50648
76	Ga0068858_100001187	3300005842	Bacteria	26972
77	Ga0068858_100022098	3300005842	Bacteria	5940
78	Ga0068858_100089856	3300005842	Bacteria	2858
79	Ga0068860_100000032	3300005843	Bacteria	251624
80	Ga0068860_100000763	3300005843	Bacteria	36196
81	Ga0068860_100015252	3300005843	Bacteria	7504
82	Ga0068860_100199107	3300005843	Bacteria	1940
83	Ga0068862_100000442	3300005844	Bacteria	45051
84	Ga0068862_100005614	3300005844	Bacteria	10484
85	Ga0068862_100007992	3300005844	Bacteria	8751
86	Ga0068862_100019555	3300005844	Bacteria	5654
87	Ga0068862_100508581	3300005844	Bacteria	1144
88	Ga0081455_10075337	3300005937	Bacteria	2784
89	Ga0075365_10287628	3300006038	Bacteria	1157
90	Ga0075363_100056453	3300006048	Bacteria	2105
91	Ga0075364_10033386	3300006051	Bacteria	3314
92	Ga0075362_10070082	3300006177	Bacteria	1600
93	Ga0075367_10001045	3300006178	Bacteria	11428
94	Ga0075366_10026425	3300006195	Bacteria	3400
95	Ga0075366_10054039	3300006195	Bacteria	2386
96	Ga0068865_100003786	3300006881	Bacteria	9083
97	Ga0097620_100001200	3300006931	Bacteria	26449
98	Ga0097620_100013177	3300006931	Bacteria	8302
99	Ga0097620_100026452	3300006931	Bacteria	5819
100	Ga0097620_100146473	3300006931	Bacteria	2437
101	Ga0097620_100370015	3300006931	Bacteria	1529
102	Ga0105250_10035240	3300009092	Bacteria	2008
103	Ga0105240_10003447	3300009093	Bacteria	24551
104	Ga0105240_10036716	3300009093	Bacteria	6301
105	Ga0105240_10040274	3300009093	Bacteria	5977
106	Ga0105240_10109257	3300009093	Bacteria	3349
107	Ga0105242_10351630	3300009176	Bacteria	1361
108	Ga0105248_10000125	3300009177	Bacteria	88470
109	Ga0105248_10003711	3300009177	Bacteria	16933
110	Ga0105248_10004666	3300009177	Bacteria	15173
111	Ga0105248_10121530	3300009177	Bacteria	2946
112	Ga0105248_10230727	3300009177	Bacteria	2084
113	Ga0105248_10553441	3300009177	Bacteria	1298
114	Ga0105238_10002048	3300009551	Bacteria	20340
115	Ga0105238_10008495	3300009551	Bacteria	10277
116	Ga0105238_10008886	3300009551	Bacteria	10055
117	Ga0105238_10069113	3300009551	Bacteria	3532
118	Ga0105238_10085395	3300009551	Bacteria	3144
119	Ga0105238_10128740	3300009551	Bacteria	2510
120	Ga0105238_10279346	3300009551	Bacteria	1651
121	Ga0105249_10002591	3300009553	Bacteria	15651
122	Ga0105239_10253460	3300010375	Bacteria	1977
123	Ga0105239_10390954	3300010375	Bacteria	1573
124	Ga0157327_1007196	3300012512	Bacteria	963
125	Ga0157373_10001592	3300013100	Bacteria	17340
126	Ga0157373_10001665	3300013100	Bacteria	16969
127	Ga0157371_10043248	3300013102	Bacteria	3209
128	Ga0157370_10025016	3300013104	Bacteria	5909
129	Ga0157370_10067096	3300013104	Bacteria	3391
130	Ga0157370_10311140	3300013104	Bacteria	1453
131	Ga0157369_10205528	3300013105	Bacteria	2065
132	Ga0157369_10495305	3300013105	Bacteria	1264
133	Ga0157372_10027211	3300013307	Bacteria	6225
134	Ga0157375_10144983	3300013308	Bacteria	2504
135	Ga0163163_10005186	3300014325	Bacteria	11237
136	Ga0163163_10086267	3300014325	Bacteria	3148
137	Ga0163163_10190996	3300014325	Bacteria	2096
138	Ga0163163_10298028	3300014325	Bacteria	1665
139	Ga0157379_10006756	3300014968	Bacteria	9912
140	Ga0157379_10026715	3300014968	Bacteria	5139
141	Ga0213872_10034862	3300021361	Bacteria	2302
142	Ga0213876_10000125	3300021384	Bacteria	83238
143	Ga0213876_10038177	3300021384	Bacteria	2534
144	Ga0213876_10047427	3300021384	Bacteria	2271
145	Ga0213876_10208521	3300021384	Bacteria	1039
146	Ga0209026_1000869	3300025250	Bacteria	15786
147	Ga0209233_1012633	3300025261	Bacteria	2441
148	Ga0209565_1000297	3300025263	Bacteria	47258
149	Ga0209673_1001080	3300025273	Bacteria	30753
150	Ga0209675_1009763	3300025291	Bacteria	3354
151	Ga0209676_1000207	3300025292	Bacteria	130882
152	Ga0209676_1000233	3300025292	Bacteria	120247
153	Ga0209676_1000322	3300025292	Bacteria	92241
154	Ga0209676_1005156	3300025292	Bacteria	6948
155	Ga0209758_1000817	3300025297	Bacteria	43865
156	Ga0209758_1001315	3300025297	Bacteria	30225
157	Ga0209758_1002814	3300025297	Bacteria	16933
158	Ga0209050_1000034	3300025298	Bacteria	433906
159	Ga0209050_1000056	3300025298	Bacteria	338703
160	Ga0209050_1000624	3300025298	Bacteria	55344
161	Ga0209256_1001374	3300025299	Bacteria	25523
162	Ga0209256_1006204	3300025299	Bacteria	6445
163	Ga0209051_1001830	3300025303	Bacteria	16814
164	Ga0209257_1000052	3300025304	Bacteria	430947
165	Ga0209257_1000074	3300025304	Bacteria	325641
166	Ga0209257_1000265	3300025304	Bacteria	120247
167	Ga0209257_1001219	3300025304	Bacteria	32208
168	Ga0209257_1001730	3300025304	Bacteria	24283
169	Ga0207696_1024827	3300025711	Bacteria	1875
170	Ga0207680_10060263	3300025903	Bacteria	2309
171	Ga0207705_10006327	3300025909	Bacteria	8790
172	Ga0207705_10080756	3300025909	Bacteria	2370
173	Ga0207707_10098472	3300025912	Bacteria	2556
174	Ga0207707_10230491	3300025912	Bacteria	1611
175	Ga0207707_10247633	3300025912	Bacteria	1548
176	Ga0207695_10002876	3300025913	Bacteria	24974
177	Ga0207695_10003472	3300025913	Bacteria	22178
178	Ga0207695_10006049	3300025913	Bacteria	15795
179	Ga0207695_10025639	3300025913	Bacteria	6595
180	Ga0207695_10098075	3300025913	Bacteria	2930
181	Ga0207671_10495293	3300025914	Bacteria	974
182	Ga0207660_10131344	3300025917	Bacteria	1906
183	Ga0207657_10011618	3300025919	Bacteria	8731
184	Ga0207652_10018087	3300025921	Bacteria	5778
185	Ga0207652_10106127	3300025921	Bacteria	2486
186	Ga0207681_10021837	3300025923	Bacteria	4074
187	Ga0207694_10004714	3300025924	Bacteria	10607
188	Ga0207694_10012288	3300025924	Bacteria	6454
189	Ga0207694_10249649	3300025924	Bacteria	1452
190	Ga0207650_10000129	3300025925	Bacteria	93532
191	Ga0207650_10063239	3300025925	Bacteria	2767
192	Ga0207644_10018684	3300025931	Bacteria	4692
193	Ga0207644_10034456	3300025931	Bacteria	3543
194	Ga0207690_10000307	3300025932	Bacteria	33710
195	Ga0207690_10006889	3300025932	Bacteria	6741
196	Ga0207706_10024354	3300025933	Bacteria	5427
197	Ga0207704_10004658	3300025938	Bacteria	6286
198	Ga0207711_10000728	3300025941	Bacteria	32348
199	Ga0207711_10002777	3300025941	Bacteria	15406
200	Ga0207711_10012936	3300025941	Bacteria	6932
201	Ga0207679_10010679	3300025945	Bacteria	5920
202	Ga0207667_10039711	3300025949	Bacteria	5014
203	Ga0207667_10093674	3300025949	Bacteria	3102
204	Ga0207667_10361429	3300025949	Bacteria	1480
205	Ga0207651_10050260	3300025960	Bacteria	2830
206	Ga0207712_10002817	3300025961	Bacteria	11135
207	Ga0207668_10000303	3300025972	Bacteria	32236
208	Ga0207668_10001943	3300025972	Bacteria	12112
209	Ga0207668_10007393	3300025972	Bacteria	6530
210	Ga0207668_10008642	3300025972	Bacteria	6079
211	Ga0207668_10013928	3300025972	Bacteria	4967
212	Ga0207668_10052642	3300025972	Bacteria	2817
213	Ga0207640_10250965	3300025981	Bacteria	1373
214	Ga0207658_10002315	3300025986	Bacteria	14026
215	Ga0207658_10145582	3300025986	Bacteria	1923
216	Ga0207703_10000532	3300026035	Bacteria	39270
217	Ga0207703_10002122	3300026035	Bacteria	17437
218	Ga0207703_10003504	3300026035	Bacteria	13122
219	Ga0207703_10528379	3300026035	Bacteria	1110
220	Ga0207678_10222918	3300026067	Bacteria	1614
221	Ga0207641_10000286	3300026088	Bacteria	63418
222	Ga0207641_10001269	3300026088	Bacteria	25135
223	Ga0207641_10016109	3300026088	Bacteria	6122
224	Ga0207641_10029859	3300026088	Bacteria	4509
225	Ga0207676_10000077	3300026095	Bacteria	97152
226	Ga0207676_10167951	3300026095	Bacteria	1908
227	Ga0207676_10235175	3300026095	Bacteria	1640
228	Ga0207675_100035930	3300026118	Bacteria	4622
229	Ga0207675_100480199	3300026118	Bacteria	1235
230	Ga0207683_10452604	3300026121	Bacteria	1184
231	Ga0207698_10252065	3300026142	Bacteria	1616
232	Ga0209999_1003272	3300027543	Bacteria	2891
233	Ga0268266_10000062	3300028379	Bacteria	253490
234	Ga0268266_10000769	3300028379	Bacteria	42897
235	Ga0268266_10003751	3300028379	Bacteria	14932
236	Ga0268266_10027029	3300028379	Bacteria	4882
237	Ga0268266_10030220	3300028379	Bacteria	4604
238	Ga0268266_10163951	3300028379	Bacteria	2012
239	Ga0268265_10001261	3300028380	Bacteria	21838
240	Ga0268265_10004220	3300028380	Bacteria	10038
241	Ga0268265_10037730	3300028380	Bacteria	3548
242	Ga0268265_10095150	3300028380	Bacteria	2391
243	Ga0268265_10194196	3300028380	Bacteria	1755
244	Ga0268265_10619665	3300028380	Bacteria	1036
245	Ga0268264_10000045	3300028381	Bacteria	364764
246	Ga0268264_10000445	3300028381	Bacteria	56452
247	Ga0268264_10040737	3300028381	Bacteria	3838
248	Ga0268264_10088274	3300028381	Bacteria	2668
249	Ga0265326_10063163	3300028558	Bacteria	1047
250	Ga0265334_10070208	3300028573	Bacteria	1306
251	Ga0265318_10041941	3300028577	Bacteria	1738
252	Ga0307517_10023982	3300028786	Bacteria	7547
253	Ga0307517_10219669	3300028786	Bacteria	1157
254	Ga0307515_10059624	3300028794	Bacteria	5465
255	Ga0307515_10182687	3300028794	Bacteria	2040
256	Ga0265338_10009945	3300028800	Bacteria	11245
257	Ga0265338_10016959	3300028800	Bacteria	7881
258	Ga0265338_10030173	3300028800	Bacteria	5351
259	Ga0265338_10036690	3300028800	Bacteria	4686
260	Ga0265320_10163775	3300031240	Bacteria	1001
261	Ga0265327_10001324	3300031251	Bacteria	32227
262	Ga0265327_10001771	3300031251	Bacteria	25517
263	Ga0265327_10016176	3300031251	Bacteria	4759
264	Ga0307513_10002328	3300031456	Bacteria	26445
265	Ga0307513_10003571	3300031456	Bacteria	21043
266	Ga0307513_10009427	3300031456	Bacteria	12349
267	Ga0307513_10290934	3300031456	Bacteria	1405
268	Ga0265314_10067955	3300031711	Bacteria	2398
269	Ga0265314_10077878	3300031711	Bacteria	2197
270	Ga0265314_10253257	3300031711	Bacteria	1010
271	Ga0307516_10000002	3300031730	Bacteria	467851
272	Ga0307406_10011583	3300031901	Bacteria	5010
273	Ga0307407_10163559	3300031903	Bacteria	1459
274	Ga0307407_10170230	3300031903	Bacteria	1434
275	Ga0307412_10001935	3300031911	Bacteria	11451
276	Ga0307412_10280682	3300031911	Bacteria	1308
277	Ga0307414_10128759	3300032004	Bacteria	1961
278	Ga0307414_10712962	3300032004	Bacteria	909
279	Ga0373943_0216148	3300035170	Bacteria	1066
280	Ga0373931_0036196	3300035691	Bacteria	2572
281	Ga0373935_0174490	3300035692	Bacteria	1472
282	Ga0373927_0022577	3300035695	Bacteria	4121
283	Ga0373933_0182420	3300035724	Bacteria	1339
284	Ga0373925_0004589	3300037068	Bacteria	10434
285	Ga0373925_0649534	3300037068	Bacteria	869
286	Ga0395899_0000016	3300037312	Bacteria	468322
287	Ga0395899_0000960	3300037312	Bacteria	26797
288	Ga0395899_0056850	3300037312	Bacteria	2890
289	Ga0395900_0000004	3300037418	Bacteria	564908
290	Ga0395900_0087092	3300037418	Bacteria	3210
291	Ga0395900_0171582	3300037418	Bacteria	2207
292	Ga0395900_0521615	3300037418	Bacteria	1136
293	Ga0395898_0029800	3300037466	Bacteria	5462
294	Ga0395898_0210657	3300037466	Bacteria	1854
295	Ga0395905_0000674	3300037471	Bacteria	45330
296	Ga0395905_0007167	3300037471	Bacteria	11136
297	Ga0395905_0007297	3300037471	Bacteria	11016
298	Ga0395905_0047263	3300037471	Bacteria	4034
299	Ga0395905_0239147	3300037471	Bacteria	1697
300	Ga0436364_1359030	3300037853	Bacteria	1086
301	Ga0436364_1400341	3300037853	Bacteria	1151
302	Ga0395901_0000005	3300038443	Bacteria	544998
303	Ga0395901_0060679	3300038443	Bacteria	3935
304	Ga0395901_0147214	3300038443	Bacteria	2475
305	Ga0395901_0149786	3300038443	Bacteria	2452
306	Ga0395901_0161554	3300038443	Bacteria	2353
307	Ga0395901_0163054	3300038443	Bacteria	2341
308	Ga0395901_0554038	3300038443	Bacteria	1165
309	Ga0400483_141433	3300039062	Bacteria	2888
310	Ga0436365_0182940	3300039437	Bacteria	2242
311	Ga0436365_0597400	3300039437	Bacteria	10821
312	Ga0436365_0749742	3300039437	Bacteria	107056
313	Ga0436365_1059193	3300039437	Bacteria	2348
314	Ga0436365_1182578	3300039437	Bacteria	2615
315	Ga0436361_0166979	3300039447	Bacteria	10827
316	Ga0436361_0547178	3300039447	Bacteria	17760
317	Ga0436361_0746645	3300039447	Bacteria	3224
318	Ga0439435_0012803	3300042436	Bacteria	2041
319	Ga0451577_0507048	3300042876	Bacteria	1095
320	Ga0466969_0000099	3300044656	Bacteria	45600
321	Ga0466965_0095129	3300044683	Bacteria	1519
322	Ga0466966_0000192	3300044684	Bacteria	40833
323	Ga0466966_0100236	3300044684	Bacteria	1792
324	Ga0466961_0005537	3300044693	Bacteria	7966
325	Ga0466964_0009639	3300044706	Bacteria	3638
326	Ga0466968_0028850	3300044735	Bacteria	2291
327	Ga0466968_0132854	3300044735	Bacteria	1134
328	Ga0466957_0041658	3300044842	Bacteria	2777
329	Ga0466959_0003290	3300045049	Bacteria	10536
330	Ga0466959_0018628	3300045049	Bacteria	5099
331	Ga0466958_0025202	3300045836	Bacteria	3504
332	Ga0495617_092459	3300046452	Bacteria	986
333	Ga0495627_000956	3300046453	Bacteria	19819
334	Ga0495590_0000897	3300046457	Bacteria	13329
335	Ga0495629_0022303	3300046459	Bacteria	4515
336	Ga0495638_0000460	3300046460	Bacteria	48816
337	Ga0495638_0001412	3300046460	Bacteria	21834
338	Ga0495638_0009849	3300046460	Bacteria	6669
339	Ga0495638_0025250	3300046460	Bacteria	3865
340	Ga0495651_0365562	3300046462	Bacteria	950
341	Ga0495650_0000160	3300046471	Bacteria	152374
342	Ga0495650_0082119	3300046471	Bacteria	1240
343	Ga0495585_0059238	3300046492	Bacteria	2111
344	Ga0495585_0078654	3300046492	Bacteria	1789
345	Ga0495583_0000005	3300046506	Bacteria	636894
346	Ga0495583_0144446	3300046506	Bacteria	989
347	Ga0495606_0079300	3300046507	Bacteria	2045
348	Ga0495606_0121711	3300046507	Bacteria	1561
349	Ga0495610_0000073	3300046512	Bacteria	120193
350	Ga0495610_0003603	3300046512	Bacteria	11962
351	Ga0495610_0014304	3300046512	Bacteria	4668
352	Ga0495616_0000495	3300046513	Bacteria	30032
353	Ga0495620_0089639	3300046515	Bacteria	1235
354	Ga0495628_0024993	3300046516	Bacteria	4884
355	Ga0495631_0007161	3300046518	Bacteria	5690
356	Ga0495632_0004547	3300046519	Bacteria	9401
357	Ga0495637_0024530	3300046520	Bacteria	2729
358	Ga0495637_0029098	3300046520	Bacteria	2461
359	Ga0495637_0054642	3300046520	Bacteria	1658
360	Ga0495637_0066111	3300046520	Bacteria	1470
361	Ga0495643_0051811	3300046522	Bacteria	2206
362	Ga0495643_0107261	3300046522	Bacteria	1424
363	Ga0495643_0167002	3300046522	Bacteria	1078
364	Ga0495648_0000184	3300046524	Bacteria	72048
365	Ga0495648_0012352	3300046524	Bacteria	6379
366	Ga0495648_0157978	3300046524	Bacteria	1175
367	Ga0495663_0032974	3300046525	Bacteria	1545
368	Ga0495642_0022882	3300046528	Bacteria	2464
369	Ga0495654_0000018	3300046530	Bacteria	293124
370	Ga0495609_0018850	3300046538	Bacteria	3196
371	Ga0495597_0001977	3300046542	Bacteria	13765
372	Ga0495597_0140561	3300046542	Bacteria	996
373	Ga0495645_0014524	3300046543	Bacteria	5591
374	Ga0495622_0010571	3300046557	Bacteria	4260
375	Ga0495633_0000833	3300046558	Bacteria	27221
376	Ga0495633_0144497	3300046558	Bacteria	1099
377	Ga0495668_0000511	3300046616	Bacteria	48358
378	Ga0495668_0003276	3300046616	Bacteria	12300
379	Ga0495668_0004346	3300046616	Bacteria	10128
380	Ga0495668_0008970	3300046616	Bacteria	6176
381	Ga0495668_0011550	3300046616	Bacteria	5283
382	Ga0495668_0060292	3300046616	Bacteria	2093
383	Ga0495668_0102603	3300046616	Bacteria	1565
384	Ga0495625_0000887	3300046660	Bacteria	40477
385	Ga0495625_0005074	3300046660	Bacteria	12187
386	Ga0495625_0007046	3300046660	Bacteria	9883
387	Ga0495625_0012948	3300046660	Bacteria	6731
388	Ga0495625_0045080	3300046660	Bacteria	3190
389	Ga0495625_0107073	3300046660	Bacteria	1913
390	Ga0495588_0049608	3300046674	Bacteria	2159
391	Ga0495623_0295809	3300046679	Bacteria	896
392	Ga0495669_0000034	3300046684	Bacteria	96445
393	Ga0495669_0007979	3300046684	Bacteria	4443
394	Ga0495669_0055557	3300046684	Bacteria	1783
395	Ga0495613_0005854	3300046689	Bacteria	9196
396	Ga0495670_0174209	3300046691	Bacteria	1134
397	Ga0495671_0113693	3300046692	Bacteria	1322
398	Ga0495649_0000137	3300046694	Bacteria	63846
399	Ga0495589_0025453	3300046794	Bacteria	3003
400	Ga0495660_0007529	3300046810	Bacteria	6391
401	Ga0495674_0087124	3300047319	Bacteria	2673
402	Ga0495672_0001798	3300047320	Bacteria	20560
403	Ga0495672_0039179	3300047320	Bacteria	2883
404	Ga0495683_0017151	3300047323	Bacteria	3756
405	Ga0495677_0056034	3300047445	Bacteria	1455
406	Ga0495677_0083053	3300047445	Bacteria	1202
407	Ga0495673_0000209	3300047469	Bacteria	88818
408	Ga0495673_0000532	3300047469	Bacteria	39414
409	Ga0495673_0000869	3300047469	Bacteria	28002
410	Ga0495686_0000871	3300047472	Bacteria	38467
411	Ga0495686_0001341	3300047472	Bacteria	27547
412	Ga0495686_0011755	3300047472	Bacteria	6162
413	Ga0495626_0179617	3300048091	Bacteria	878
414	Ga0496100_0470946	3300048903	Bacteria	965
415	Ga0496101_0326525	3300048904	Bacteria	1204
416	Ga0496102_0045745	3300048905	Bacteria	3974
417	Ga0496103_0288134	3300048906	Bacteria	1056
418	Ga0496103_0296007	3300048906	Bacteria	1041
419	Ga0496106_0137981	3300048909	Bacteria	1917
420	Ga0496107_0002879	3300048910	Bacteria	11374
421	Ga0496107_0109502	3300048910	Bacteria	2029
422	Ga0496107_0340176	3300048910	Bacteria	1116
423	Ga0496108_0337597	3300048911	Bacteria	1314
424	Ga0496109_0089391	3300048912	Bacteria	2847
425	Ga0496110_0288560	3300048913	Bacteria	1494
426	Ga0496111_0214503	3300048914	Bacteria	1430
427	Ga0496112_0110252	3300048915	Bacteria	2722
428	Ga0496112_0922996	3300048915	Bacteria	794
429	Ga0496115_0004836	3300048918	Bacteria	9773
430	Ga0496115_0006189	3300048918	Bacteria	8751
431	Ga0496115_0068829	3300048918	Bacteria	2866
432	Ga0496115_0655482	3300048918	Bacteria	829
433	Ga0496116_0041906	3300048919	Bacteria	3136
434	Ga0496117_0074802	3300048920	Bacteria	2253
435	Ga0496118_0023454	3300048921	Bacteria	5358
436	Ga0496119_0010818	3300048922	Bacteria	7636
437	Ga0496121_0000053	3300048924	Bacteria	312611
438	Ga0496121_0001744	3300048924	Bacteria	35548
439	Ga0496121_0184070	3300048924	Bacteria	1504
440	Ga0496123_0009903	3300048926	Bacteria	8505
441	Ga0496124_0074109	3300048927	Bacteria	2815
442	Ga0496125_0000387	3300048928	Bacteria	82001
443	Ga0496125_0008806	3300048928	Bacteria	10495
444	Ga0496125_0260473	3300048928	Bacteria	1087
445	Ga0496126_0002440	3300048929	Bacteria	25108
446	Ga0495678_000400	3300049459	Bacteria	43762
447	Ga0501032_0000014	3300049569	Bacteria	182017
448	Ga0501033_0315835	3300049570	Bacteria	1098
449	Ga0501034_0000001	3300049571	Bacteria	2184493
450	Ga0501034_0015548	3300049571	Bacteria	7816
451	Ga0501034_0031405	3300049571	Bacteria	5394
452	Ga0501034_0293100	3300049571	Bacteria	1565
453	Ga0501034_0461353	3300049571	Bacteria	1187
454	Ga0501036_0022549	3300049572	Bacteria	5297
455	Ga0501036_0544084	3300049572	Bacteria	965
456	Ga0501036_0691747	3300049572	Bacteria	843
457	Ga0501037_0105974	3300049573	Bacteria	2026
458	Ga0501037_0200256	3300049573	Bacteria	1411
459	Ga0501038_0001269	3300049574	Bacteria	22944
460	Ga0501039_0000016	3300049575	Bacteria	211521
461	Ga0501043_0037228	3300049579	Bacteria	3827
462	Ga0501043_0274766	3300049579	Bacteria	1293
463	Ga0501043_0498484	3300049579	Bacteria	910
464	Ga0501047_0004679	3300049581	Bacteria	12871
465	Ga0501047_0175966	3300049581	Bacteria	2007
466	Ga0501047_0387327	3300049581	Bacteria	1232
467	Ga0501067_0099236	3300049583	Bacteria	1617
468	Ga0501072_0016766	3300049588	Bacteria	5628
469	Ga0501072_0564560	3300049588	Bacteria	898
470	Ga0501073_0079603	3300049589	Bacteria	2280
471	Ga0501238_000465	3300049671	Bacteria	4664
472	Ga0501257_006381	3300049686	Bacteria	2616
473	Ga0501080_0003474	3300049742	Bacteria	13882
474	Ga0501080_0028114	3300049742	Bacteria	5229
475	Ga0501080_0037718	3300049742	Bacteria	4513
476	Ga0501083_0003439	3300049744	Bacteria	11054
477	Ga0501083_0059955	3300049744	Bacteria	2544
478	Ga0501263_027811	3300049760	Bacteria	787
479	Ga0501035_0007791	3300049822	Bacteria	10008
480	Ga0501035_0031186	3300049822	Bacteria	4855
481	Ga0501035_0161667	3300049822	Bacteria	1938
482	Ga0501044_0001387	3300049823	Bacteria	28410
483	Ga0501044_0001630	3300049823	Bacteria	26311
484	Ga0501044_0113490	3300049823	Bacteria	2717
485	Ga0501044_0204626	3300049823	Bacteria	1931
486	Ga0501044_0326106	3300049823	Bacteria	1459
487	Ga0501044_0507094	3300049823	Bacteria	1107
488	Ga0501044_0552563	3300049823	Bacteria	1048
489	nmdc:mga03n38_24900_c1	3300050490	Bacteria	2451
490	nmdc:mga03n38_51906_c1	3300050490	Bacteria	1833
491	nmdc:mga00v17_21419_c1	3300050491	Bacteria	3716
492	nmdc:mga0k408_22344_c1	3300050493	Bacteria	3561
493	nmdc:mga0k408_290480_c1	3300050493	Bacteria	976
494	nmdc:mga06z11_63275_c1	3300050494	Bacteria	1936
495	nmdc:mga07m45_108889_c1	3300050496	Bacteria	1595
496	nmdc:mga0sz30_822_c1	3300050516	Bacteria	11216
497	Ga0500635_0000418	3300053080	Bacteria	12557
498	Ga0500578_0000059	3300053086	Bacteria	119108
499	Ga0500643_002629	3300053087	Bacteria	9093
500	Ga0500643_010354	3300053087	Bacteria	3476
501	Ga0500643_019279	3300053087	Bacteria	2248
502	Ga0500643_025786	3300053087	Bacteria	1849
503	Ga0500644_0000116	3300053088	Bacteria	49989
504	Ga0500651_0006865	3300053093	Bacteria	6599
505	Ga0500566_0041546	3300053094	Bacteria	2655
506	Ga0500641_0000136	3300053096	Bacteria	27409
507	Ga0500641_0000407	3300053096	Bacteria	15966
508	Ga0500641_0148725	3300053096	Bacteria	1011
509	Ga0500554_004136	3300053102	Bacteria	3047
510	Ga0500555_001502	3300053103	Bacteria	7087
511	Ga0500556_0000872	3300053104	Bacteria	17069
512	Ga0500556_0001246	3300053104	Bacteria	11763
513	Ga0500562_000501	3300053108	Bacteria	9535
514	Ga0500562_002182	3300053108	Bacteria	4894
515	Ga0500572_000653	3300053111	Bacteria	11481
516	Ga0500594_0000016	3300053118	Bacteria	64151
517	Ga0500595_003421	3300053119	Bacteria	7420
518	Ga0500595_009164	3300053119	Bacteria	4008
519	Ga0500595_011141	3300053119	Bacteria	3534
520	Ga0500595_025554	3300053119	Bacteria	2045
521	Ga0500608_000063	3300053122	Bacteria	46532
522	Ga0500614_001684	3300053123	Bacteria	5164
523	Ga0500614_026769	3300053123	Bacteria	1381
524	Ga0500618_000341	3300053125	Bacteria	33449
525	Ga0500658_0001359	3300053134	Bacteria	9896
526	Ga0500658_0081694	3300053134	Bacteria	1383
527	Ga0500559_0000026	3300053136	Bacteria	120494
528	Ga0500559_0001648	3300053136	Bacteria	12355
529	Ga0500559_0015652	3300053136	Bacteria	3202
530	Ga0500559_0045493	3300053136	Bacteria	1922
531	Ga0500564_000005	3300053138	Bacteria	99735
532	Ga0500573_0012643	3300053140	Bacteria	4744
533	Ga0500577_0066048	3300053142	Bacteria	1406
534	Ga0500590_002482	3300053148	Bacteria	8207
535	Ga0500616_0022673	3300053153	Bacteria	3503
536	Ga0500622_0000184	3300053156	Bacteria	67149
537	Ga0500622_0013617	3300053156	Bacteria	4384
538	Ga0500622_0015663	3300053156	Bacteria	4058
539	Ga0500622_0038512	3300053156	Bacteria	2493
540	Ga0500622_0042578	3300053156	Bacteria	2358
541	Ga0500622_0045030	3300053156	Bacteria	2285
542	Ga0500622_0191052	3300053156	Bacteria	938
543	Ga0500627_0001727	3300053158	Bacteria	6194
544	Ga0500639_084816	3300053163	Bacteria	1589
545	Ga0500636_0008860	3300053177	Bacteria	5839
546	Ga0500636_0058427	3300053177	Bacteria	2254
547	Ga0500637_0011096	3300053178	Bacteria	4643
548	Ga0500576_112773	3300053725	Bacteria	1087
549	Ga0500625_160452	3300053729	Bacteria	827
550	Ga0500645_002123	3300053730	Bacteria	9144
551	Ga0500645_005931	3300053730	Bacteria	4426
552	Ga0500645_019632	3300053730	Bacteria	2101
553	Ga0500645_027356	3300053730	Bacteria	1729
554	Ga0501084_0048754	3300054114	Bacteria	3545
555	Ga0501084_0274760	3300054114	Bacteria	1423
556	Ga0501082_0018455	3300060353	Bacteria	6009
557	Ga0466962_0010990	3300061719	Bacteria	4357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300053136	Ga0500559_0001648	Ga0500559_0001648_2321_3286	233
2	3300053163	Ga0500639_084816	Ga0500639_084816_139_1104	233
3	3300053177	Ga0500636_0008860	Ga0500636_0008860_1063_1869	233
4	3300028800	Ga0265338_10030173	Ga0265338_100301734	235
5	3300049574	Ga0501038_0001269	Ga0501038_0001269_10160_10909	236
6	3300053156	Ga0500622_0013617	Ga0500622_0013617_3486_4268	236
7	3300005614	Ga0068856_100432170	Ga0068856_1004321702	237
8	3300009551	Ga0105238_10002048	Ga0105238_100020483	237
9	3300009551	Ga0105238_10085395	Ga0105238_100853953	237
10	3300014325	Ga0163163_10298028	Ga0163163_102980282	237
11	3300025924	Ga0207694_10004714	Ga0207694_100047144	237
12	3300028379	Ga0268266_10000769	Ga0268266_1000076937	237
13	3300031711	Ga0265314_10067955	Ga0265314_100679552	237
14	3300038443	Ga0395901_0163054	Ga0395901_0163054_886_1623	237
15	3300048918	Ga0496115_0655482	Ga0496115_0655482_79_816	237
16	3300049823	Ga0501044_0552563	Ga0501044_0552563_27_761	237
17	3300046694	Ga0495649_0000137	Ga0495649_0000137_38229_38999	238
18	3300005841	Ga0068863_100182651	Ga0068863_1001826512	239
19	3300028380	Ga0268265_10095150	Ga0268265_100951504	239
20	3300049760	Ga0501263_027811	Ga0501263_027811_30_770	239
21	3300053730	Ga0500645_027356	Ga0500645_027356_527_1288	239
22	3300049822	Ga0501035_0161667	Ga0501035_0161667_563_1321	240
23	3300035724	Ga0373933_0182420	Ga0373933_0182420_164_904	241
24	3300047472	Ga0495686_0000871	Ga0495686_0000871_15856_16668	241
25	3300049571	Ga0501034_0031405	Ga0501034_0031405_2265_3083	241
26	3300049571	Ga0501034_0461353	Ga0501034_0461353_272_1015	241
27	3300049573	Ga0501037_0200256	Ga0501037_0200256_89_907	241
28	3300049579	Ga0501043_0037228	Ga0501043_0037228_599_1417	241
29	3300049742	Ga0501080_0003474	Ga0501080_0003474_7600_8418	241
30	3300049744	Ga0501083_0059955	Ga0501083_0059955_523_1341	241
31	3300049822	Ga0501035_0031186	Ga0501035_0031186_737_1555	241
32	3300053119	Ga0500595_011141	Ga0500595_011141_1618_2436	241
33	3300046616	Ga0495668_0102603	Ga0495668_0102603_242_982	242
34	3300048915	Ga0496112_0922996	Ga0496112_0922996_40_777	242
35	3300049583	Ga0501067_0099236	Ga0501067_0099236_566_1315	242
36	3300049588	Ga0501072_0016766	Ga0501072_0016766_243_992	242
37	3300049589	Ga0501073_0079603	Ga0501073_0079603_438_1187	242
38	3300049742	Ga0501080_0037718	Ga0501080_0037718_3558_4307	242
39	3300054114	Ga0501084_0048754	Ga0501084_0048754_2146_2895	242
40	3300060353	Ga0501082_0018455	Ga0501082_0018455_1894_2643	242
41	3300009177	Ga0105248_10000125	Ga0105248_1000012513	243
42	3300038443	Ga0395901_0161554	Ga0395901_0161554_128_898	243
43	3300044735	Ga0466968_0028850	Ga0466968_0028850_46_798	243
44	3300046462	Ga0495651_0365562	Ga0495651_0365562_39_815	243
45	3300046689	Ga0495613_0005854	Ga0495613_0005854_7535_8311	243
46	3300053111	Ga0500572_000653	Ga0500572_000653_7355_8104	243
47	3300053730	Ga0500645_019632	Ga0500645_019632_1198_1950	243
48	3300021384	Ga0213876_10208521	Ga0213876_102085211	244
49	3300049572	Ga0501036_0544084	Ga0501036_0544084_94_873	244
50	3300049823	Ga0501044_0113490	Ga0501044_0113490_480_1259	244
51	3300005844	Ga0068862_100007992	Ga0068862_1000079928	246
52	3300009551	Ga0105238_10128740	Ga0105238_101287402	246
53	3300009553	Ga0105249_10002591	Ga0105249_100025918	246
54	3300028380	Ga0268265_10194196	Ga0268265_101941962	246
55	3300031903	Ga0307407_10170230	Ga0307407_101702302	246
56	3300037312	Ga0395899_0056850	Ga0395899_0056850_1059_1856	246
57	3300037418	Ga0395900_0521615	Ga0395900_0521615_24_821	246
58	3300039062	Ga0400483_141433	Ga0400483_141433_168_1079	246
59	3300039437	Ga0436365_0182940	Ga0436365_0182940_1100_1849	246
60	3300046459	Ga0495629_0022303	Ga0495629_0022303_1704_2453	246
61	3300046492	Ga0495585_0078654	Ga0495585_0078654_24_773	246
62	3300046520	Ga0495637_0066111	Ga0495637_0066111_385_1134	246
63	3300046522	Ga0495643_0107261	Ga0495643_0107261_642_1391	246
64	3300046542	Ga0495597_0001977	Ga0495597_0001977_6845_7594	246
65	3300046557	Ga0495622_0010571	Ga0495622_0010571_1991_2740	246
66	3300046616	Ga0495668_0011550	Ga0495668_0011550_4516_5265	246
67	3300048091	Ga0495626_0179617	Ga0495626_0179617_23_772	246
68	3300049569	Ga0501032_0000014	Ga0501032_0000014_86195_86971	246
69	3300049571	Ga0501034_0000001	Ga0501034_0000001_305196_305972	246
70	3300049572	Ga0501036_0022549	Ga0501036_0022549_4125_4901	246
71	3300049575	Ga0501039_0000016	Ga0501039_0000016_77966_78742	246
72	3300049742	Ga0501080_0028114	Ga0501080_0028114_2417_3316	246
73	3300049744	Ga0501083_0003439	Ga0501083_0003439_6835_7734	246
74	3300053080	Ga0500635_0000418	Ga0500635_0000418_6922_7671	246
75	3300053093	Ga0500651_0006865	Ga0500651_0006865_3037_3786	246
76	3300053094	Ga0500566_0041546	Ga0500566_0041546_1863_2612	246
77	3300053103	Ga0500555_001502	Ga0500555_001502_978_1727	246
78	3300053119	Ga0500595_009164	Ga0500595_009164_1212_1961	246
79	3300053123	Ga0500614_001684	Ga0500614_001684_3867_4616	246
80	3300053134	Ga0500658_0081694	Ga0500658_0081694_41_790	246
81	3300053136	Ga0500559_0045493	Ga0500559_0045493_715_1464	246
82	3300053148	Ga0500590_002482	Ga0500590_002482_2707_3456	246
83	3300053177	Ga0500636_0058427	Ga0500636_0058427_855_1604	246
84	3300053178	Ga0500637_0011096	Ga0500637_0011096_3135_3884	246
85	3300053725	Ga0500576_112773	Ga0500576_112773_34_783	246
86	3300053729	Ga0500625_160452	Ga0500625_160452_51_800	246
87	3300042876	Ga0451577_0507048	Ga0451577_0507048_92_892	247
88	iso_pu_bacteria	2643221598	2644000663	247
89	iso_pu_bacteria	2643221614	2644088098	247
90	iso_pu_bacteria	2643221661	2644343336	247
91	iso_pu_bacteria	2643221663	2644352853	247
92	iso_pu_bacteria	2643221666	2644369187	247
93	iso_pu_bacteria	2941485952	2941488640	247
94	3300005844	Ga0068862_100508581	Ga0068862_1005085811	248
95	3300005937	Ga0081455_10075337	Ga0081455_100753372	248
96	3300009176	Ga0105242_10351630	Ga0105242_103516302	248
97	3300026035	Ga0207703_10528379	Ga0207703_105283791	248
98	3300028558	Ga0265326_10063163	Ga0265326_100631631	248
99	3300028573	Ga0265334_10070208	Ga0265334_100702081	248
100	3300028800	Ga0265338_10009945	Ga0265338_100099458	248
101	3300028800	Ga0265338_10016959	Ga0265338_100169597	248
102	3300031711	Ga0265314_10077878	Ga0265314_100778782	248
103	3300031903	Ga0307407_10163559	Ga0307407_101635592	248
104	3300054114	Ga0501084_0274760	Ga0501084_0274760_382_1146	248
105	iso_pu_bacteria	2739367756	2739792246	248
106	3300031456	Ga0307513_10009427	Ga0307513_1000942712	249
107	3300049588	Ga0501072_0564560	Ga0501072_0564560_20_775	249
108	iso_pu_bacteria	2643221574	2643882945	249
109	iso_pu_bacteria	2643221699	2644552709	249
110	iso_pu_bacteria	2928972540	2928973670	249
111	iso_pu_bacteria	2977240413	2977241378	249
112	3300005563	Ga0068855_100253647	Ga0068855_1002536472	250
113	3300005617	Ga0068859_100370012	Ga0068859_1003700122	250
114	3300006931	Ga0097620_100370015	Ga0097620_1003700152	250
115	3300009093	Ga0105240_10003447	Ga0105240_1000344718	250
116	3300021361	Ga0213872_10034862	Ga0213872_100348622	250
117	3300021384	Ga0213876_10000125	Ga0213876_1000012584	250
118	3300025913	Ga0207695_10025639	Ga0207695_100256397	250
119	3300025949	Ga0207667_10093674	Ga0207667_100936742	250
120	3300028577	Ga0265318_10041941	Ga0265318_100419412	250
121	3300028800	Ga0265338_10036690	Ga0265338_100366904	250
122	3300031240	Ga0265320_10163775	Ga0265320_101637751	250
123	3300031711	Ga0265314_10253257	Ga0265314_102532571	250
124	3300037418	Ga0395900_0171582	Ga0395900_0171582_1393_2154	250
125	3300037853	Ga0436364_1359030	Ga0436364_1359030_152_913	250
126	3300037853	Ga0436364_1400341	Ga0436364_1400341_57_821	250
127	3300038443	Ga0395901_0060679	Ga0395901_0060679_1444_2211	250
128	3300039437	Ga0436365_0749742	Ga0436365_0749742_66423_67181	250
129	3300039437	Ga0436365_1059193	Ga0436365_1059193_523_1287	250
130	3300039447	Ga0436361_0547178	Ga0436361_0547178_1365_2123	250
131	3300039447	Ga0436361_0746645	Ga0436361_0746645_1904_2698	250
132	3300049581	Ga0501047_0387327	Ga0501047_0387327_399_1163	250
133	3300049823	Ga0501044_0204626	Ga0501044_0204626_741_1505	250
134	3300003791	Ga0055530_10000014	Ga0055530_10000014131	251
135	3300003794	Ga0055531_10002273	Ga0055531_100022739	251
136	3300003794	Ga0055531_10008889	Ga0055531_100088893	251
137	3300003794	Ga0055531_10018600	Ga0055531_100186001	251
138	3300005262	Ga0065165_1001235	Ga0065165_100123525	251
139	3300005262	Ga0065165_1017103	Ga0065165_10171031	251
140	3300005327	Ga0070658_10192444	Ga0070658_101924442	251
141	3300005331	Ga0070670_100037672	Ga0070670_1000376725	251
142	3300005334	Ga0068869_100414993	Ga0068869_1004149931	251
143	3300005335	Ga0070666_10016575	Ga0070666_100165752	251
144	3300005347	Ga0070668_100000549	Ga0070668_10000054911	251
145	3300005347	Ga0070668_100001852	Ga0070668_1000018523	251
146	3300005347	Ga0070668_100002629	Ga0070668_1000026297	251
147	3300005347	Ga0070668_100005544	Ga0070668_1000055444	251
148	3300005347	Ga0070668_100010967	Ga0070668_1000109675	251
149	3300005355	Ga0070671_100001249	Ga0070671_1000012494	251
150	3300005355	Ga0070671_100114705	Ga0070671_1001147052	251
151	3300005367	Ga0070667_100002898	Ga0070667_1000028988	251
152	3300005367	Ga0070667_100009964	Ga0070667_10000996410	251
153	3300005367	Ga0070667_100014299	Ga0070667_1000142991	251
154	3300005456	Ga0070678_100283053	Ga0070678_1002830531	251
155	3300005457	Ga0070662_100106182	Ga0070662_1001061821	251
156	3300005548	Ga0070665_100004470	Ga0070665_1000044706	251
157	3300005548	Ga0070665_100009325	Ga0070665_10000932510	251
158	3300005548	Ga0070665_100013500	Ga0070665_1000135004	251
159	3300005548	Ga0070665_100067171	Ga0070665_1000671713	251
160	3300005564	Ga0070664_100015805	Ga0070664_1000158058	251
161	3300005614	Ga0068856_100189760	Ga0068856_1001897602	251
162	3300005617	Ga0068859_100013177	Ga0068859_1000131774	251
163	3300005617	Ga0068859_100026452	Ga0068859_1000264522	251
164	3300005617	Ga0068859_100146460	Ga0068859_1001464605	251
165	3300005618	Ga0068864_100000488	Ga0068864_10000048812	251
166	3300005618	Ga0068864_100005053	Ga0068864_1000050532	251
167	3300005618	Ga0068864_100061557	Ga0068864_1000615573	251
168	3300005618	Ga0068864_100128308	Ga0068864_1001283083	251
169	3300005618	Ga0068864_100433316	Ga0068864_1004333161	251
170	3300005719	Ga0068861_100017527	Ga0068861_1000175273	251
171	3300005841	Ga0068863_100000023	Ga0068863_100000023168	251
172	3300005841	Ga0068863_100000391	Ga0068863_10000039113	251
173	3300005841	Ga0068863_100001912	Ga0068863_1000019124	251
174	3300005841	Ga0068863_100025578	Ga0068863_1000255785	251
175	3300005842	Ga0068858_100000322	Ga0068858_10000032231	251
176	3300005842	Ga0068858_100001187	Ga0068858_10000118714	251
177	3300005842	Ga0068858_100022098	Ga0068858_1000220985	251
178	3300005843	Ga0068860_100000032	Ga0068860_10000003215	251
179	3300005843	Ga0068860_100000763	Ga0068860_10000076311	251
180	3300005843	Ga0068860_100015252	Ga0068860_1000152522	251
181	3300005843	Ga0068860_100199107	Ga0068860_1001991072	251
182	3300005844	Ga0068862_100000442	Ga0068862_10000044210	251
183	3300005844	Ga0068862_100005614	Ga0068862_1000056144	251
184	3300005844	Ga0068862_100019555	Ga0068862_1000195555	251
185	3300006038	Ga0075365_10287628	Ga0075365_102876281	251
186	3300006048	Ga0075363_100056453	Ga0075363_1000564534	251
187	3300006051	Ga0075364_10033386	Ga0075364_100333862	251
188	3300006177	Ga0075362_10070082	Ga0075362_100700822	251
189	3300006178	Ga0075367_10001045	Ga0075367_100010454	251
190	3300006195	Ga0075366_10054039	Ga0075366_100540392	251
191	3300006881	Ga0068865_100003786	Ga0068865_1000037863	251
192	3300006931	Ga0097620_100001200	Ga0097620_1000012008	251
193	3300006931	Ga0097620_100013177	Ga0097620_1000131774	251
194	3300006931	Ga0097620_100026452	Ga0097620_1000264527	251
195	3300006931	Ga0097620_100146473	Ga0097620_1001464735	251
196	3300009092	Ga0105250_10035240	Ga0105250_100352403	251
197	3300009177	Ga0105248_10003711	Ga0105248_1000371110	251
198	3300009177	Ga0105248_10004666	Ga0105248_1000466612	251
199	3300009177	Ga0105248_10121530	Ga0105248_101215301	251
200	3300009177	Ga0105248_10230727	Ga0105248_102307271	251
201	3300009177	Ga0105248_10553441	Ga0105248_105534411	251
202	3300010375	Ga0105239_10253460	Ga0105239_102534602	251
203	3300010375	Ga0105239_10390954	Ga0105239_103909542	251
204	3300013100	Ga0157373_10001592	Ga0157373_100015928	251
205	3300013100	Ga0157373_10001665	Ga0157373_100016659	251
206	3300013308	Ga0157375_10144983	Ga0157375_101449833	251
207	3300014325	Ga0163163_10005186	Ga0163163_100051866	251
208	3300014325	Ga0163163_10086267	Ga0163163_100862673	251
209	3300014968	Ga0157379_10006756	Ga0157379_100067567	251
210	3300014968	Ga0157379_10026715	Ga0157379_100267154	251
211	3300021384	Ga0213876_10047427	Ga0213876_100474272	251
212	3300025250	Ga0209026_1000869	Ga0209026_10008694	251
213	3300025261	Ga0209233_1012633	Ga0209233_10126331	251
214	3300025292	Ga0209676_1000322	Ga0209676_100032292	251
215	3300025292	Ga0209676_1005156	Ga0209676_10051565	251
216	3300025297	Ga0209758_1000817	Ga0209758_100081716	251
217	3300025298	Ga0209050_1000034	Ga0209050_100003416	251
218	3300025304	Ga0209257_1000052	Ga0209257_1000052394	251
219	3300025304	Ga0209257_1001219	Ga0209257_100121918	251
220	3300025304	Ga0209257_1001730	Ga0209257_100173011	251
221	3300025711	Ga0207696_1024827	Ga0207696_10248271	251
222	3300025903	Ga0207680_10060263	Ga0207680_100602633	251
223	3300025923	Ga0207681_10021837	Ga0207681_100218375	251
224	3300025925	Ga0207650_10000129	Ga0207650_1000012997	251
225	3300025925	Ga0207650_10063239	Ga0207650_100632395	251
226	3300025931	Ga0207644_10018684	Ga0207644_100186844	251
227	3300025931	Ga0207644_10034456	Ga0207644_100344563	251
228	3300025932	Ga0207690_10006889	Ga0207690_100068892	251
229	3300025933	Ga0207706_10024354	Ga0207706_100243543	251
230	3300025938	Ga0207704_10004658	Ga0207704_100046583	251
231	3300025941	Ga0207711_10002777	Ga0207711_100027777	251
232	3300025941	Ga0207711_10012936	Ga0207711_100129363	251
233	3300025945	Ga0207679_10010679	Ga0207679_100106793	251
234	3300025960	Ga0207651_10050260	Ga0207651_100502603	251
235	3300025961	Ga0207712_10002817	Ga0207712_100028176	251
236	3300025972	Ga0207668_10000303	Ga0207668_1000030313	251
237	3300025972	Ga0207668_10001943	Ga0207668_100019435	251
238	3300025972	Ga0207668_10007393	Ga0207668_100073935	251
239	3300025972	Ga0207668_10008642	Ga0207668_100086427	251
240	3300025972	Ga0207668_10013928	Ga0207668_100139284	251
241	3300025972	Ga0207668_10052642	Ga0207668_100526422	251
242	3300025986	Ga0207658_10002315	Ga0207658_100023158	251
243	3300025986	Ga0207658_10145582	Ga0207658_101455823	251
244	3300026035	Ga0207703_10000532	Ga0207703_100005325	251
245	3300026035	Ga0207703_10002122	Ga0207703_100021226	251
246	3300026035	Ga0207703_10003504	Ga0207703_100035048	251
247	3300026067	Ga0207678_10222918	Ga0207678_102229181	251
248	3300026088	Ga0207641_10000286	Ga0207641_1000028641	251
249	3300026088	Ga0207641_10001269	Ga0207641_1000126913	251
250	3300026088	Ga0207641_10016109	Ga0207641_100161095	251
251	3300026088	Ga0207641_10029859	Ga0207641_100298594	251
252	3300026095	Ga0207676_10000077	Ga0207676_100000778	251
253	3300026095	Ga0207676_10167951	Ga0207676_101679512	251
254	3300026095	Ga0207676_10235175	Ga0207676_102351752	251
255	3300026118	Ga0207675_100035930	Ga0207675_1000359302	251
256	3300026118	Ga0207675_100480199	Ga0207675_1004801991	251
257	3300026121	Ga0207683_10452604	Ga0207683_104526042	251
258	3300026142	Ga0207698_10252065	Ga0207698_102520651	251
259	3300027543	Ga0209999_1003272	Ga0209999_10032722	251
260	3300028379	Ga0268266_10003751	Ga0268266_100037517	251
261	3300028379	Ga0268266_10027029	Ga0268266_100270295	251
262	3300028379	Ga0268266_10030220	Ga0268266_100302203	251
263	3300028379	Ga0268266_10163951	Ga0268266_101639512	251
264	3300028380	Ga0268265_10001261	Ga0268265_1000126113	251
265	3300028380	Ga0268265_10004220	Ga0268265_100042203	251
266	3300028380	Ga0268265_10037730	Ga0268265_100377303	251
267	3300028380	Ga0268265_10619665	Ga0268265_106196651	251
268	3300028381	Ga0268264_10000045	Ga0268264_10000045337	251
269	3300028381	Ga0268264_10000445	Ga0268264_1000044539	251
270	3300028381	Ga0268264_10040737	Ga0268264_100407372	251
271	3300028381	Ga0268264_10088274	Ga0268264_100882741	251
272	3300028786	Ga0307517_10219669	Ga0307517_102196691	251
273	3300031251	Ga0265327_10001324	Ga0265327_1000132410	251
274	3300031251	Ga0265327_10001771	Ga0265327_100017718	251
275	3300031456	Ga0307513_10003571	Ga0307513_1000357120	251
276	3300031456	Ga0307513_10290934	Ga0307513_102909342	251
277	3300031730	Ga0307516_10000002	Ga0307516_10000002325	251
278	3300031901	Ga0307406_10011583	Ga0307406_100115835	251
279	3300031911	Ga0307412_10001935	Ga0307412_100019352	251
280	3300031911	Ga0307412_10280682	Ga0307412_102806821	251
281	3300032004	Ga0307414_10128759	Ga0307414_101287592	251
282	3300035170	Ga0373943_0216148	Ga0373943_0216148_62_829	251
283	3300035691	Ga0373931_0036196	Ga0373931_0036196_1001_1765	251
284	3300035695	Ga0373927_0022577	Ga0373927_0022577_2824_3591	251
285	3300037068	Ga0373925_0004589	Ga0373925_0004589_2824_3591	251
286	3300037312	Ga0395899_0000960	Ga0395899_0000960_6570_7334	251
287	3300037418	Ga0395900_0000004	Ga0395900_0000004_547874_548638	251
288	3300037466	Ga0395898_0029800	Ga0395898_0029800_4230_4994	251
289	3300037471	Ga0395905_0007167	Ga0395905_0007167_7481_8245	251
290	3300037471	Ga0395905_0239147	Ga0395905_0239147_316_1092	251
291	3300038443	Ga0395901_0000005	Ga0395901_0000005_16955_17719	251
292	3300038443	Ga0395901_0149786	Ga0395901_0149786_262_1026	251
293	3300039437	Ga0436365_1182578	Ga0436365_1182578_1360_2124	251
294	3300046506	Ga0495583_0144446	Ga0495583_0144446_166_930	251
295	3300046528	Ga0495642_0022882	Ga0495642_0022882_678_1442	251
296	3300046616	Ga0495668_0060292	Ga0495668_0060292_363_1127	251
297	3300046660	Ga0495625_0045080	Ga0495625_0045080_1674_2450	251
298	3300046674	Ga0495588_0049608	Ga0495588_0049608_824_1600	251
299	3300046679	Ga0495623_0295809	Ga0495623_0295809_102_866	251
300	3300046684	Ga0495669_0000034	Ga0495669_0000034_81639_82415	251
301	3300046684	Ga0495669_0007979	Ga0495669_0007979_818_1582	251
302	3300046684	Ga0495669_0055557	Ga0495669_0055557_834_1598	251
303	3300046691	Ga0495670_0174209	Ga0495670_0174209_235_999	251
304	3300047445	Ga0495677_0056034	Ga0495677_0056034_79_855	251
305	3300047445	Ga0495677_0083053	Ga0495677_0083053_327_1091	251
306	3300048903	Ga0496100_0470946	Ga0496100_0470946_144_908	251
307	3300048904	Ga0496101_0326525	Ga0496101_0326525_285_1088	251
308	3300048905	Ga0496102_0045745	Ga0496102_0045745_2375_3139	251
309	3300048906	Ga0496103_0288134	Ga0496103_0288134_270_1034	251
310	3300048906	Ga0496103_0296007	Ga0496103_0296007_252_1016	251
311	3300048909	Ga0496106_0137981	Ga0496106_0137981_481_1254	251
312	3300048910	Ga0496107_0109502	Ga0496107_0109502_883_1647	251
313	3300048910	Ga0496107_0340176	Ga0496107_0340176_85_858	251
314	3300048911	Ga0496108_0337597	Ga0496108_0337597_40_804	251
315	3300048912	Ga0496109_0089391	Ga0496109_0089391_586_1350	251
316	3300048913	Ga0496110_0288560	Ga0496110_0288560_370_1134	251
317	3300048914	Ga0496111_0214503	Ga0496111_0214503_638_1402	251
318	3300048919	Ga0496116_0041906	Ga0496116_0041906_787_1551	251
319	3300048920	Ga0496117_0074802	Ga0496117_0074802_1228_1992	251
320	3300048921	Ga0496118_0023454	Ga0496118_0023454_499_1263	251
321	3300048922	Ga0496119_0010818	Ga0496119_0010818_6481_7245	251
322	3300048924	Ga0496121_0000053	Ga0496121_0000053_6859_7623	251
323	3300048928	Ga0496125_0000387	Ga0496125_0000387_30574_31338	251
324	3300048928	Ga0496125_0260473	Ga0496125_0260473_245_1009	251
325	3300049571	Ga0501034_0015548	Ga0501034_0015548_2931_3698	251
326	3300049571	Ga0501034_0293100	Ga0501034_0293100_130_894	251
327	3300049573	Ga0501037_0105974	Ga0501037_0105974_1165_1932	251
328	3300049579	Ga0501043_0274766	Ga0501043_0274766_61_828	251
329	3300049686	Ga0501257_006381	Ga0501257_006381_821_1585	251
330	3300049822	Ga0501035_0007791	Ga0501035_0007791_5077_5847	251
331	3300049823	Ga0501044_0001387	Ga0501044_0001387_1917_2684	251
332	3300049823	Ga0501044_0326106	Ga0501044_0326106_448_1212	251
333	3300049823	Ga0501044_0507094	Ga0501044_0507094_118_882	251
334	3300050490	nmdc:mga03n38_24900_c1	nmdc:mga03n38_24900_c1_882_1646	251
335	3300050490	nmdc:mga03n38_51906_c1	nmdc:mga03n38_51906_c1_100_864	251
336	3300050491	nmdc:mga00v17_21419_c1	nmdc:mga00v17_21419_c1_925_1689	251
337	3300050493	nmdc:mga0k408_22344_c1	nmdc:mga0k408_22344_c1_638_1402	251
338	3300050494	nmdc:mga06z11_63275_c1	nmdc:mga06z11_63275_c1_1062_1826	251
339	3300050496	nmdc:mga07m45_108889_c1	nmdc:mga07m45_108889_c1_528_1292	251
340	3300053087	Ga0500643_010354	Ga0500643_010354_230_1015	251
341	3300053087	Ga0500643_025786	Ga0500643_025786_134_922	251
342	3300053096	Ga0500641_0000136	Ga0500641_0000136_25028_25816	251
343	3300053104	Ga0500556_0001246	Ga0500556_0001246_7098_7886	251
344	3300053119	Ga0500595_003421	Ga0500595_003421_6531_7298	251
345	3300053153	Ga0500616_0022673	Ga0500616_0022673_1420_2208	251
346	3300053156	Ga0500622_0015663	Ga0500622_0015663_1431_2219	251
347	3300053156	Ga0500622_0191052	Ga0500622_0191052_74_862	251
348	3300053730	Ga0500645_002123	Ga0500645_002123_7390_8154	251
349	3300053730	Ga0500645_005931	Ga0500645_005931_135_923	251
350	iso_pu_bacteria	2791355048	2792459411	251
351	iso_pu_bacteria	2843744320	2843744660	251
352	iso_pu_bacteria	2849560528	2849563412	251
353	iso_pu_bacteria	2849573788	2849577594	251
354	iso_pu_bacteria	2851153111	2851154401	251
355	iso_pu_bacteria	2898329390	2898330676	251
356	3300003320	rootH2_10017394	rootH2_100173942	252
357	3300003320	rootH2_10058366	rootH2_100583663	252
358	3300005327	Ga0070658_10112567	Ga0070658_101125674	252
359	3300005458	Ga0070681_10012089	Ga0070681_100120895	252
360	3300005548	Ga0070665_100035485	Ga0070665_1000354853	252
361	3300005563	Ga0068855_100076437	Ga0068855_1000764374	252
362	3300005563	Ga0068855_100161031	Ga0068855_1001610312	252
363	3300005842	Ga0068858_100089856	Ga0068858_1000898563	252
364	3300009093	Ga0105240_10040274	Ga0105240_100402746	252
365	3300013104	Ga0157370_10311140	Ga0157370_103111401	252
366	3300013307	Ga0157372_10027211	Ga0157372_100272112	252
367	3300021384	Ga0213876_10038177	Ga0213876_100381773	252
368	3300025909	Ga0207705_10080756	Ga0207705_100807561	252
369	3300025912	Ga0207707_10098472	Ga0207707_100984724	252
370	3300025913	Ga0207695_10003472	Ga0207695_100034721	252
371	3300025941	Ga0207711_10000728	Ga0207711_1000072817	252
372	3300025949	Ga0207667_10039711	Ga0207667_100397113	252
373	3300028786	Ga0307517_10023982	Ga0307517_1002398210	252
374	3300031251	Ga0265327_10016176	Ga0265327_100161764	252
375	3300031456	Ga0307513_10002328	Ga0307513_100023288	252
376	3300035692	Ga0373935_0174490	Ga0373935_0174490_680_1447	252
377	3300037068	Ga0373925_0649534	Ga0373925_0649534_45_824	252
378	3300037312	Ga0395899_0000016	Ga0395899_0000016_53256_54038	252
379	3300037418	Ga0395900_0087092	Ga0395900_0087092_476_1240	252
380	3300037466	Ga0395898_0210657	Ga0395898_0210657_309_1076	252
381	3300037471	Ga0395905_0007297	Ga0395905_0007297_4132_4899	252
382	3300037471	Ga0395905_0047263	Ga0395905_0047263_1456_2223	252
383	3300038443	Ga0395901_0147214	Ga0395901_0147214_597_1361	252
384	3300039437	Ga0436365_0597400	Ga0436365_0597400_4968_5741	252
385	3300044656	Ga0466969_0000099	Ga0466969_0000099_2533_3309	252
386	3300044684	Ga0466966_0000192	Ga0466966_0000192_37571_38347	252
387	3300044684	Ga0466966_0100236	Ga0466966_0100236_896_1663	252
388	3300044693	Ga0466961_0005537	Ga0466961_0005537_2649_3425	252
389	3300044735	Ga0466968_0132854	Ga0466968_0132854_165_932	252
390	3300044842	Ga0466957_0041658	Ga0466957_0041658_1945_2721	252
391	3300045049	Ga0466959_0003290	Ga0466959_0003290_7254_8030	252
392	3300045836	Ga0466958_0025202	Ga0466958_0025202_2474_3250	252
393	3300049570	Ga0501033_0315835	Ga0501033_0315835_96_908	252
394	3300049572	Ga0501036_0691747	Ga0501036_0691747_34_801	252
395	3300049581	Ga0501047_0175966	Ga0501047_0175966_360_1127	252
396	3300049823	Ga0501044_0001630	Ga0501044_0001630_10103_10870	252
397	3300053096	Ga0500641_0000407	Ga0500641_0000407_13024_13809	252
398	3300053108	Ga0500562_000501	Ga0500562_000501_8134_8910	252
399	3300053119	Ga0500595_025554	Ga0500595_025554_643_1407	252
400	3300061719	Ga0466962_0010990	Ga0466962_0010990_2504_3280	252
401	iso_pu_bacteria	2510917020	2511121945	252
402	iso_pu_bacteria	2643221584	2643927703	252
403	3300005327	Ga0070658_10258032	Ga0070658_102580322	253
404	3300005336	Ga0070680_100000322	Ga0070680_10000032227	253
405	3300005336	Ga0070680_100022180	Ga0070680_1000221805	253
406	3300005341	Ga0070691_10010796	Ga0070691_100107965	253
407	3300005366	Ga0070659_100003660	Ga0070659_1000036605	253
408	3300005366	Ga0070659_100008802	Ga0070659_1000088025	253
409	3300005458	Ga0070681_10141926	Ga0070681_101419263	253
410	3300005530	Ga0070679_100029584	Ga0070679_1000295847	253
411	3300005548	Ga0070665_100000183	Ga0070665_10000018396	253
412	3300005563	Ga0068855_100060821	Ga0068855_1000608215	253
413	3300005616	Ga0068852_100049841	Ga0068852_1000498414	253
414	3300009093	Ga0105240_10109257	Ga0105240_101092571	253
415	3300009551	Ga0105238_10008495	Ga0105238_100084954	253
416	3300009551	Ga0105238_10008886	Ga0105238_100088863	253
417	3300009551	Ga0105238_10069113	Ga0105238_100691135	253
418	3300009551	Ga0105238_10279346	Ga0105238_102793461	253
419	3300013102	Ga0157371_10043248	Ga0157371_100432483	253
420	3300013104	Ga0157370_10025016	Ga0157370_100250165	253
421	3300013104	Ga0157370_10067096	Ga0157370_100670963	253
422	3300013105	Ga0157369_10205528	Ga0157369_102055282	253
423	3300013105	Ga0157369_10495305	Ga0157369_104953051	253
424	3300025909	Ga0207705_10006327	Ga0207705_100063277	253
425	3300025912	Ga0207707_10230491	Ga0207707_102304911	253
426	3300025912	Ga0207707_10247633	Ga0207707_102476332	253
427	3300025913	Ga0207695_10002876	Ga0207695_1000287617	253
428	3300025913	Ga0207695_10006049	Ga0207695_100060495	253
429	3300025913	Ga0207695_10098075	Ga0207695_100980752	253
430	3300025914	Ga0207671_10495293	Ga0207671_104952931	253
431	3300025917	Ga0207660_10131344	Ga0207660_101313441	253
432	3300025919	Ga0207657_10011618	Ga0207657_100116188	253
433	3300025921	Ga0207652_10018087	Ga0207652_100180876	253
434	3300025921	Ga0207652_10106127	Ga0207652_101061273	253
435	3300025924	Ga0207694_10012288	Ga0207694_100122886	253
436	3300025924	Ga0207694_10249649	Ga0207694_102496492	253
437	3300025932	Ga0207690_10000307	Ga0207690_1000030723	253
438	3300025949	Ga0207667_10361429	Ga0207667_103614291	253
439	3300025981	Ga0207640_10250965	Ga0207640_102509652	253
440	3300028379	Ga0268266_10000062	Ga0268266_10000062226	253
441	3300032004	Ga0307414_10712962	Ga0307414_107129621	253
442	3300037471	Ga0395905_0000674	Ga0395905_0000674_43371_44144	253
443	3300038443	Ga0395901_0554038	Ga0395901_0554038_246_1022	253
444	3300039447	Ga0436361_0166979	Ga0436361_0166979_3347_4132	253
445	3300045049	Ga0466959_0018628	Ga0466959_0018628_1099_1872	253
446	3300046516	Ga0495628_0024993	Ga0495628_0024993_28_798	253
447	3300046543	Ga0495645_0014524	Ga0495645_0014524_4386_5156	253
448	3300046558	Ga0495633_0000833	Ga0495633_0000833_7744_8523	253
449	3300047319	Ga0495674_0087124	Ga0495674_0087124_243_1013	253
450	3300048915	Ga0496112_0110252	Ga0496112_0110252_1119_1889	253
451	3300048918	Ga0496115_0068829	Ga0496115_0068829_271_1041	253
452	3300048926	Ga0496123_0009903	Ga0496123_0009903_920_1699	253
453	3300049579	Ga0501043_0498484	Ga0501043_0498484_74_850	253
454	3300053140	Ga0500573_0012643	Ga0500573_0012643_3945_4730	253
455	iso_pu_bacteria	2582581279	2585147439	253
456	iso_pu_bacteria	2582581280	2585154432	253
457	iso_pu_bacteria	2582581293	2585197905	253
458	iso_pu_bacteria	2585428106	2587918197	253
459	iso_pu_bacteria	2643221545	2643749900	253
460	iso_pu_bacteria	2643221552	2643779737	253
461	iso_pu_bacteria	2643221583	2643923276	253
462	iso_pu_bacteria	2643221640	2644224673	253
463	iso_pu_bacteria	2643221642	2644234392	253
464	iso_pu_bacteria	2643221691	2644510945	253
465	iso_pu_bacteria	2818991435	2819535792	253
466	iso_pu_bacteria	2818991454	2819645106	253
467	iso_pu_bacteria	2857504554	2857508170	253
468	iso_pu_bacteria	2884960567	2884962166	253
469	iso_pu_bacteria	2928531327	2928535807	253
470	3300009093	Ga0105240_10036716	Ga0105240_100367165	254
471	3300014325	Ga0163163_10190996	Ga0163163_101909963	254
472	3300047320	Ga0495672_0039179	Ga0495672_0039179_359_1138	254
473	3300048918	Ga0496115_0006189	Ga0496115_0006189_1731_2507	254
474	3300053087	Ga0500643_002629	Ga0500643_002629_7218_8009	254
475	3300028794	Ga0307515_10059624	Ga0307515_100596242	255
476	3300046471	Ga0495650_0082119	Ga0495650_0082119_320_1102	255
477	3300046660	Ga0495625_0000887	Ga0495625_0000887_18255_19037	255
478	3300049581	Ga0501047_0004679	Ga0501047_0004679_503_1291	255
479	3300012512	Ga0157327_1007196	Ga0157327_10071961	256
480	3300025299	Ga0209256_1001374	Ga0209256_10013744	256
481	3300046452	Ga0495617_092459	Ga0495617_092459_19_801	256
482	3300046460	Ga0495638_0000460	Ga0495638_0000460_27818_28600	256
483	3300046460	Ga0495638_0009849	Ga0495638_0009849_4157_4939	256
484	3300046460	Ga0495638_0025250	Ga0495638_0025250_2756_3541	256
485	3300046492	Ga0495585_0059238	Ga0495585_0059238_493_1275	256
486	3300046506	Ga0495583_0000005	Ga0495583_0000005_617668_618450	256
487	3300046512	Ga0495610_0003603	Ga0495610_0003603_6674_7456	256
488	3300046513	Ga0495616_0000495	Ga0495616_0000495_10102_10872	256
489	3300046519	Ga0495632_0004547	Ga0495632_0004547_5982_6764	256
490	3300046520	Ga0495637_0024530	Ga0495637_0024530_1718_2500	256
491	3300046522	Ga0495643_0051811	Ga0495643_0051811_189_971	256
492	3300046524	Ga0495648_0000184	Ga0495648_0000184_44625_45425	256
493	3300046524	Ga0495648_0157978	Ga0495648_0157978_173_955	256
494	3300046538	Ga0495609_0018850	Ga0495609_0018850_330_1112	256
495	3300046558	Ga0495633_0144497	Ga0495633_0144497_202_984	256
496	3300046616	Ga0495668_0004346	Ga0495668_0004346_2685_3467	256
497	3300046810	Ga0495660_0007529	Ga0495660_0007529_4722_5504	256
498	3300047323	Ga0495683_0017151	Ga0495683_0017151_2209_2991	256
499	3300047469	Ga0495673_0000209	Ga0495673_0000209_26744_27544	256
500	3300047469	Ga0495673_0000869	Ga0495673_0000869_9390_10172	256
501	3300053087	Ga0500643_019279	Ga0500643_019279_924_1724	256
502	3300053088	Ga0500644_0000116	Ga0500644_0000116_27710_28510	256
503	3300053125	Ga0500618_000341	Ga0500618_000341_13981_14763	256
504	3300053136	Ga0500559_0000026	Ga0500559_0000026_102911_103693	256
505	3300053138	Ga0500564_000005	Ga0500564_000005_44587_45387	256
506	3300053156	Ga0500622_0042578	Ga0500622_0042578_857_1639	256
507	3300003215	JGI25153J46596_10010891	JGI25153J46596_100108913	257
508	3300003773	Ga0055537_1003294	Ga0055537_10032943	257
509	3300003775	Ga0055524_1011767	Ga0055524_10117673	257
510	3300003781	Ga0055536_1000678	Ga0055536_100067827	257
511	3300003781	Ga0055536_1000767	Ga0055536_100076723	257
512	3300003790	Ga0055528_1002069	Ga0055528_10020692	257
513	3300003791	Ga0055530_10002649	Ga0055530_100026491	257
514	3300003791	Ga0055530_10020492	Ga0055530_100204921	257
515	3300003794	Ga0055531_10001084	Ga0055531_1000108423	257
516	3300003794	Ga0055531_10019031	Ga0055531_100190314	257
517	3300005262	Ga0065165_1000421	Ga0065165_100042141	257
518	3300006195	Ga0075366_10026425	Ga0075366_100264252	257
519	3300025263	Ga0209565_1000297	Ga0209565_100029711	257
520	3300025273	Ga0209673_1001080	Ga0209673_100108015	257
521	3300025291	Ga0209675_1009763	Ga0209675_10097631	257
522	3300025292	Ga0209676_1000207	Ga0209676_100020724	257
523	3300025292	Ga0209676_1000233	Ga0209676_1000233102	257
524	3300025297	Ga0209758_1001315	Ga0209758_100131512	257
525	3300025297	Ga0209758_1002814	Ga0209758_100281416	257
526	3300025298	Ga0209050_1000056	Ga0209050_100005624	257
527	3300025298	Ga0209050_1000624	Ga0209050_100062453	257
528	3300025299	Ga0209256_1006204	Ga0209256_10062043	257
529	3300025303	Ga0209051_1001830	Ga0209051_100183012	257
530	3300025304	Ga0209257_1000074	Ga0209257_1000074285	257
531	3300025304	Ga0209257_1000265	Ga0209257_1000265102	257
532	3300028794	Ga0307515_10182687	Ga0307515_101826873	257
533	3300042436	Ga0439435_0012803	Ga0439435_0012803_440_1225	257
534	3300044683	Ga0466965_0095129	Ga0466965_0095129_506_1300	257
535	3300044706	Ga0466964_0009639	Ga0466964_0009639_191_985	257
536	3300046453	Ga0495627_000956	Ga0495627_000956_1736_2521	257
537	3300046457	Ga0495590_0000897	Ga0495590_0000897_3758_4561	257
538	3300046460	Ga0495638_0001412	Ga0495638_0001412_2815_3618	257
539	3300046471	Ga0495650_0000160	Ga0495650_0000160_136098_136883	257
540	3300046507	Ga0495606_0079300	Ga0495606_0079300_820_1611	257
541	3300046507	Ga0495606_0121711	Ga0495606_0121711_63_848	257
542	3300046512	Ga0495610_0000073	Ga0495610_0000073_18249_19034	257
543	3300046512	Ga0495610_0014304	Ga0495610_0014304_2548_3351	257
544	3300046515	Ga0495620_0089639	Ga0495620_0089639_180_965	257
545	3300046518	Ga0495631_0007161	Ga0495631_0007161_4198_5001	257
546	3300046520	Ga0495637_0029098	Ga0495637_0029098_950_1735	257
547	3300046520	Ga0495637_0054642	Ga0495637_0054642_431_1234	257
548	3300046522	Ga0495643_0167002	Ga0495643_0167002_79_864	257
549	3300046524	Ga0495648_0012352	Ga0495648_0012352_4530_5315	257
550	3300046525	Ga0495663_0032974	Ga0495663_0032974_598_1383	257
551	3300046530	Ga0495654_0000018	Ga0495654_0000018_275458_276243	257
552	3300046542	Ga0495597_0140561	Ga0495597_0140561_154_939	257
553	3300046616	Ga0495668_0000511	Ga0495668_0000511_19402_20205	257
554	3300046616	Ga0495668_0003276	Ga0495668_0003276_124_927	257
555	3300046616	Ga0495668_0008970	Ga0495668_0008970_4596_5399	257
556	3300046660	Ga0495625_0005074	Ga0495625_0005074_9135_9920	257
557	3300046660	Ga0495625_0007046	Ga0495625_0007046_4101_4886	257
558	3300046660	Ga0495625_0012948	Ga0495625_0012948_903_1688	257
559	3300046660	Ga0495625_0107073	Ga0495625_0107073_726_1529	257
560	3300046692	Ga0495671_0113693	Ga0495671_0113693_269_1054	257
561	3300046794	Ga0495589_0025453	Ga0495589_0025453_868_1653	257
562	3300047320	Ga0495672_0001798	Ga0495672_0001798_14449_15234	257
563	3300047469	Ga0495673_0000532	Ga0495673_0000532_15576_16361	257
564	3300047472	Ga0495686_0001341	Ga0495686_0001341_17812_18615	257
565	3300047472	Ga0495686_0011755	Ga0495686_0011755_1369_2154	257
566	3300048910	Ga0496107_0002879	Ga0496107_0002879_4505_5290	257
567	3300048918	Ga0496115_0004836	Ga0496115_0004836_8140_8925	257
568	3300048924	Ga0496121_0001744	Ga0496121_0001744_4395_5180	257
569	3300048924	Ga0496121_0184070	Ga0496121_0184070_297_1100	257
570	3300048927	Ga0496124_0074109	Ga0496124_0074109_379_1182	257
571	3300048928	Ga0496125_0008806	Ga0496125_0008806_2934_3737	257
572	3300048929	Ga0496126_0002440	Ga0496126_0002440_21466_22269	257
573	3300049459	Ga0495678_000400	Ga0495678_000400_10481_11284	257
574	3300049671	Ga0501238_000465	Ga0501238_000465_542_1327	257
575	3300050493	nmdc:mga0k408_290480_c1	nmdc:mga0k408_290480_c1_137_922	257
576	3300050516	nmdc:mga0sz30_822_c1	nmdc:mga0sz30_822_c1_3899_4702	257
577	3300053086	Ga0500578_0000059	Ga0500578_0000059_39309_40112	257
578	3300053096	Ga0500641_0148725	Ga0500641_0148725_52_855	257
579	3300053102	Ga0500554_004136	Ga0500554_004136_134_919	257
580	3300053104	Ga0500556_0000872	Ga0500556_0000872_16186_16971	257
581	3300053108	Ga0500562_002182	Ga0500562_002182_312_1115	257
582	3300053118	Ga0500594_0000016	Ga0500594_0000016_36374_37177	257
583	3300053122	Ga0500608_000063	Ga0500608_000063_19444_20247	257
584	3300053123	Ga0500614_026769	Ga0500614_026769_64_849	257
585	3300053134	Ga0500658_0001359	Ga0500658_0001359_125_910	257
586	3300053136	Ga0500559_0015652	Ga0500559_0015652_462_1265	257
587	3300053142	Ga0500577_0066048	Ga0500577_0066048_53_838	257
588	3300053156	Ga0500622_0000184	Ga0500622_0000184_497_1300	257
589	3300053156	Ga0500622_0038512	Ga0500622_0038512_1406_2209	257
590	3300053156	Ga0500622_0045030	Ga0500622_0045030_880_1683	257
591	3300053158	Ga0500627_0001727	Ga0500627_0001727_2260_3045	257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02562

PhoH

PhoH-like protein

102

304

0.98 PF13604

AAA_30

AAA domain

105

263

0.86 PF01695

IstB_IS21

IstB-like ATP binding protein

42

183

0.85 PF13245

AAA_19

AAA domain

110

261

0.8 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3b85-assembly1.cif.gz_B	crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum	0.8826	55	256
3b85-assembly1.cif.gz_A	crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum	0.874	55	256
3b85-assembly1.cif.gz_B	crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum	0.869	55	256
3b85-assembly1.cif.gz_A	crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum	0.8606	55	256
3gpl-assembly2.cif.gz_B	crystal structure of the ternary complex of recd2 with dna and adpnp	0.7126	57	250

ID	Description	Score	Start	End	Superfamily
af_Q2FY01_105_312_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8814	55	255	3.40.50.300
af_P0A9K1_146_354_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8802	55	256	3.40.50.300
3b85B00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8703	55	256	3.40.50.300
3b85B00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.8565	55	256	3.40.50.300
af_Q2FY01_105_312_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.849	55	255	3.40.50.300

ID	Description	Score	Start	End	GO Terms
AF-A0A7W1AB53-F1-model_v4	PhoH-like protein	0.9318	56	239	GO:0005524 GO:0005829
AF-A0A847HKW5-F1-model_v4	PhoH-like protein	0.9233	56	256	GO:0005524 GO:0005829
AF-R7DAA0-F1-model_v4	PhoH-like protein	0.9184	56	256	GO:0005524 GO:0005829
AF-H8NW34-F1-model_v4	deleted	0.9133	55	256
AF-A0A7Y1VNX9-F1-model_v4	deleted	0.9127	53	256

Feature Viewer

pLDDT	pTM	Quality
76.55	0.72	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F467040

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02562

PhoH

PhoH-like protein

102

304

0.98

PF13604

AAA_30

AAA domain

105

263

0.86

PF01695

IstB_IS21

IstB-like ATP binding protein

42

183

0.85

PF13245

AAA_19

AAA domain

110

261

0.8

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map