F467041

General Info

Members Datasets Scaffolds Average Seq Length
591 222 591 205

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100146222|Ga0070712_1001462222
Length 210
Sequence MQRAPVVRTSHSIRRDVEELASREPAFARVVEQHGVPEPRNSKRGAETLLRTIVGQQVSVAAARSMWAKLGAAFGSPPDLNLLLAASDEALRAAGMSRQKSGYIRSLASLVISGELDLDNLPEDDEEAIALLTKIKGIGRWSAEIYLLFAEGRGDVFPAGDLAVLIELGRLLGLPEKPSEKQLRERAEAWRPYRGAAAVLAWHSYNSAVL

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
172 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
173 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
212 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
213 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
214 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
217 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 4.91
Rhizosphere 94.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10030783 3300001979 Bacteria 1740
2 JGI24740J21852_10037395 3300001979 Bacteria 1499
3 JGI24739J22299_10049822 3300001989 Bacteria 1356
4 JGI24744J21845_10000623 3300002077 Bacteria 6456
5 JGI25406J46586_10047432 3300003203 Bacteria 1464
6 Ga0065712_10107291 3300005290 Bacteria 1899
7 Ga0070658_10001359 3300005327 Bacteria 20917
8 Ga0070658_10011801 3300005327 Bacteria 7011
9 Ga0070658_10035301 3300005327 Bacteria 4027
10 Ga0070658_10133812 3300005327 Bacteria 2067
11 Ga0070658_10219490 3300005327 Bacteria 1607
12 Ga0070658_10586394 3300005327 Bacteria 966
13 Ga0070676_10083076 3300005328 Bacteria 1947
14 Ga0070683_100029406 3300005329 Bacteria 4974
15 Ga0070690_100006574 3300005330 Bacteria 6603
16 Ga0070690_100244072 3300005330 Bacteria 1268
17 Ga0070670_100001791 3300005331 Bacteria 17491
18 Ga0070670_100092640 3300005331 Bacteria 2598
19 Ga0070677_10058376 3300005333 Bacteria 1584
20 Ga0068869_100041710 3300005334 Bacteria 3287
21 Ga0068869_100119827 3300005334 Bacteria 2011
22 Ga0070666_10001341 3300005335 Bacteria 14928
23 Ga0070666_10007313 3300005335 Bacteria 6802
24 Ga0070666_10058269 3300005335 Bacteria 2612
25 Ga0070666_10279869 3300005335 Bacteria 1186
26 Ga0070666_10292425 3300005335 Bacteria 1159
27 Ga0070680_100043881 3300005336 Bacteria 3633
28 Ga0070680_100121337 3300005336 Bacteria 2182
29 Ga0070682_100101917 3300005337 Bacteria 1896
30 Ga0068868_100000579 3300005338 Bacteria 24551
31 Ga0068868_100255635 3300005338 Bacteria 1476
32 Ga0068868_100320535 3300005338 Bacteria 1320
33 Ga0068868_100814294 3300005338 Bacteria 843
34 Ga0070660_100028807 3300005339 Bacteria 4158
35 Ga0070660_100034505 3300005339 Bacteria 3823
36 Ga0070660_100047884 3300005339 Bacteria 3282
37 Ga0070660_100077102 3300005339 Bacteria 2611
38 Ga0070660_100094735 3300005339 Bacteria 2359
39 Ga0070660_100124472 3300005339 Bacteria 2059
40 Ga0070689_100085464 3300005340 Bacteria 2481
41 Ga0070661_100002170 3300005344 Bacteria 13519
42 Ga0070661_100046713 3300005344 Bacteria 3168
43 Ga0070661_100120580 3300005344 Bacteria 1964
44 Ga0070661_100147671 3300005344 Bacteria 1776
45 Ga0070661_100319443 3300005344 Bacteria 1212
46 Ga0070661_100381395 3300005344 Bacteria 1111
47 Ga0070661_100619919 3300005344 Bacteria 876
48 Ga0070661_100674095 3300005344 Bacteria 841
49 Ga0070692_10010852 3300005345 Bacteria 4165
50 Ga0070668_100378192 3300005347 Bacteria 1205
51 Ga0070669_100034164 3300005353 Bacteria 3682
52 Ga0070669_100102101 3300005353 Bacteria 2165
53 Ga0070669_100144484 3300005353 Bacteria 1837
54 Ga0070675_100011209 3300005354 Bacteria 7016
55 Ga0070675_100011801 3300005354 Bacteria 6846
56 Ga0070675_100089381 3300005354 Bacteria 2579
57 Ga0070675_100288631 3300005354 Bacteria 1443
58 Ga0070671_100000987 3300005355 Bacteria 20885
59 Ga0070671_100009923 3300005355 Bacteria 7649
60 Ga0070671_100014278 3300005355 Bacteria 6412
61 Ga0070671_100055553 3300005355 Bacteria 3293
62 Ga0070671_100066553 3300005355 Bacteria 3003
63 Ga0070674_100005831 3300005356 Bacteria 7157
64 Ga0070674_100047256 3300005356 Bacteria 2947
65 Ga0070674_100054790 3300005356 Bacteria 2759
66 Ga0070674_100121824 3300005356 Bacteria 1932
67 Ga0070674_100736168 3300005356 Bacteria 846
68 Ga0070673_100023161 3300005364 Bacteria 4534
69 Ga0070673_100089514 3300005364 Bacteria 2512
70 Ga0070673_100300719 3300005364 Bacteria 1412
71 Ga0070673_100428911 3300005364 Bacteria 1186
72 Ga0070673_100476825 3300005364 Bacteria 1126
73 Ga0070673_100525821 3300005364 Bacteria 1072
74 Ga0070673_101096028 3300005364 Bacteria 744
75 Ga0070659_100003994 3300005366 Bacteria 10503
76 Ga0070659_100007475 3300005366 Bacteria 7937
77 Ga0070659_100011740 3300005366 Bacteria 6484
78 Ga0070659_100110851 3300005366 Bacteria 2215
79 Ga0070659_100160043 3300005366 Bacteria 1840
80 Ga0070659_100227514 3300005366 Bacteria 1541
81 Ga0070659_100401450 3300005366 Bacteria 1157
82 Ga0070659_100414569 3300005366 Bacteria 1138
83 Ga0070667_100000512 3300005367 Bacteria 39082
84 Ga0070667_100019694 3300005367 Bacteria 5597
85 Ga0070667_100026508 3300005367 Bacteria 4822
86 Ga0070667_100047027 3300005367 Bacteria 3630
87 Ga0070667_100146063 3300005367 Bacteria 2074
88 Ga0070667_100149555 3300005367 Bacteria 2050
89 Ga0070667_100364356 3300005367 Bacteria 1310
90 Ga0070714_100017393 3300005435 Bacteria 5824
91 Ga0070714_100069392 3300005435 Bacteria 3044
92 Ga0070713_100186577 3300005436 Bacteria 1866
93 Ga0070663_100004988 3300005455 Bacteria 7840
94 Ga0070663_100086691 3300005455 Bacteria 2312
95 Ga0070663_100178975 3300005455 Bacteria 1643
96 Ga0070663_100229210 3300005455 Bacteria 1462
97 Ga0070663_100638161 3300005455 Bacteria 899
98 Ga0070678_100021616 3300005456 Bacteria 4247
99 Ga0070678_100076038 3300005456 Bacteria 2528
100 Ga0070678_100155206 3300005456 Bacteria 1848
101 Ga0070662_100034078 3300005457 Bacteria 3589
102 Ga0070662_100056350 3300005457 Bacteria 2853
103 Ga0070662_100071034 3300005457 Bacteria 2566
104 Ga0070662_100094798 3300005457 Bacteria 2248
105 Ga0070662_100228214 3300005457 Bacteria 1488
106 Ga0070662_100317061 3300005457 Bacteria 1270
107 Ga0070681_10070301 3300005458 Bacteria 3466
108 Ga0070681_10126037 3300005458 Bacteria 2493
109 Ga0070681_10368110 3300005458 Bacteria 1347
110 Ga0068867_100039243 3300005459 Bacteria 3451
111 Ga0068867_100079413 3300005459 Bacteria 2469
112 Ga0068867_100721249 3300005459 Bacteria 882
113 Ga0070679_100077233 3300005530 Bacteria 3319
114 Ga0070679_100112719 3300005530 Bacteria 2705
115 Ga0070679_100541676 3300005530 Bacteria 1108
116 Ga0070679_100824951 3300005530 Bacteria 870
117 Ga0068853_100017118 3300005539 Bacteria 5979
118 Ga0068853_100065515 3300005539 Bacteria 3153
119 Ga0068853_100224456 3300005539 Bacteria 1717
120 Ga0068853_100363764 3300005539 Bacteria 1348
121 Ga0068853_100802408 3300005539 Bacteria 901
122 Ga0070672_100010538 3300005543 Bacteria 6415
123 Ga0070672_100011841 3300005543 Bacteria 6094
124 Ga0070672_100073288 3300005543 Bacteria 2729
125 Ga0070672_100162199 3300005543 Bacteria 1855
126 Ga0070693_100037272 3300005547 Bacteria 2710
127 Ga0070665_100012566 3300005548 Bacteria 8526
128 Ga0070665_100055960 3300005548 Bacteria 3955
129 Ga0070665_100113092 3300005548 Bacteria 2718
130 Ga0070665_100281383 3300005548 Bacteria 1665
131 Ga0070665_100901726 3300005548 Bacteria 897
132 Ga0068855_100021387 3300005563 Bacteria 7757
133 Ga0068855_100654929 3300005563 Bacteria 1127
134 Ga0070664_100002681 3300005564 Bacteria 14366
135 Ga0070664_100008006 3300005564 Bacteria 8537
136 Ga0070664_100009014 3300005564 Bacteria 8093
137 Ga0070664_100028888 3300005564 Bacteria 4618
138 Ga0070664_100264631 3300005564 Bacteria 1547
139 Ga0070664_100344210 3300005564 Bacteria 1355
140 Ga0070664_100531328 3300005564 Bacteria 1086
141 Ga0068857_100212059 3300005577 Bacteria 1767
142 Ga0068857_100275304 3300005577 Bacteria 1547
143 Ga0068857_100298793 3300005577 Bacteria 1484
144 Ga0068854_100060204 3300005578 Bacteria 2746
145 Ga0068854_100081363 3300005578 Bacteria 2392
146 Ga0068856_100064237 3300005614 Bacteria 3627
147 Ga0068856_100114959 3300005614 Bacteria 2690
148 Ga0068856_100606574 3300005614 Bacteria 1115
149 Ga0068856_100785655 3300005614 Bacteria 972
150 Ga0068852_100017235 3300005616 Bacteria 5663
151 Ga0068852_100035280 3300005616 Bacteria 4170
152 Ga0068852_100057228 3300005616 Bacteria 3373
153 Ga0068852_100108013 3300005616 Bacteria 2525
154 Ga0068852_100133613 3300005616 Bacteria 2288
155 Ga0068852_100564067 3300005616 Bacteria 1140
156 Ga0068859_100019836 3300005617 Bacteria 6749
157 Ga0068859_100038438 3300005617 Bacteria 4802
158 Ga0068859_100125473 3300005617 Bacteria 2636
159 Ga0068859_101079533 3300005617 Bacteria 883
160 Ga0068864_100081724 3300005618 Bacteria 2833
161 Ga0068866_10007967 3300005718 Bacteria 4448
162 Ga0068866_10012838 3300005718 Bacteria 3659
163 Ga0068851_10000795 3300005834 Bacteria 13623
164 Ga0068851_10068072 3300005834 Bacteria 1837
165 Ga0068870_10083508 3300005840 Bacteria 1771
166 Ga0068863_100047687 3300005841 Bacteria 4063
167 Ga0068863_100062024 3300005841 Bacteria 3535
168 Ga0068863_100063432 3300005841 Bacteria 3495
169 Ga0068863_100070449 3300005841 Bacteria 3307
170 Ga0068858_100000855 3300005842 Bacteria 31513
171 Ga0068858_100046354 3300005842 Bacteria 4030
172 Ga0068858_100058218 3300005842 Bacteria 3572
173 Ga0068858_100156188 3300005842 Bacteria 2146
174 Ga0068858_100338981 3300005842 Bacteria 1439
175 Ga0068860_100133013 3300005843 Bacteria 2388
176 Ga0068860_100294085 3300005843 Bacteria 1590
177 Ga0068862_100576318 3300005844 Bacteria 1077
178 Ga0068862_101310948 3300005844 Bacteria 725
179 Ga0081539_10010258 3300005985 Bacteria 7652
180 Ga0075364_10290261 3300006051 Bacteria 1113
181 Ga0070716_100031705 3300006173 Bacteria 2877
182 Ga0070712_100146222 3300006175 Bacteria 1809
183 Ga0097621_100478316 3300006237 Bacteria 1125
184 Ga0068871_100293400 3300006358 Bacteria 1425
185 Ga0075433_10002953 3300006852 Bacteria 13056
186 Ga0068865_100146761 3300006881 Bacteria 1785
187 Ga0097620_100019837 3300006931 Bacteria 6749
188 Ga0097620_100038439 3300006931 Bacteria 4802
189 Ga0097620_100125476 3300006931 Bacteria 2636
190 Ga0097620_101079604 3300006931 Bacteria 883
191 Ga0075435_100186166 3300007076 Bacteria 1756
192 Ga0105245_10080047 3300009098 Bacteria 2984
193 Ga0105245_10116186 3300009098 Bacteria 2495
194 Ga0105245_10273180 3300009098 Bacteria 1649
195 Ga0105243_10105116 3300009148 Bacteria 2351
196 Ga0105241_10055738 3300009174 Bacteria 3029
197 Ga0105241_10092158 3300009174 Bacteria 2392
198 Ga0105242_10056605 3300009176 Bacteria 3209
199 Ga0105242_10521544 3300009176 Bacteria 1134
200 Ga0105248_10001030 3300009177 Bacteria 30868
201 Ga0105248_10006248 3300009177 Bacteria 13062
202 Ga0105248_10030185 3300009177 Bacteria 6051
203 Ga0105248_10111708 3300009177 Bacteria 3082
204 Ga0105248_10178177 3300009177 Bacteria 2395
205 Ga0105237_10029775 3300009545 Bacteria 5547
206 Ga0105237_10302677 3300009545 Bacteria 1602
207 Ga0105238_10013165 3300009551 Bacteria 8347
208 Ga0105238_10172508 3300009551 Bacteria 2139
209 Ga0105238_10438681 3300009551 Bacteria 1302
210 Ga0105249_10241890 3300009553 Bacteria 1785
211 Ga0105239_10258983 3300010375 Bacteria 1955
212 Ga0105246_10051840 3300011119 Bacteria 2819
213 Ga0105246_10935520 3300011119 Bacteria 780
214 Ga0157373_10020929 3300013100 Bacteria 4750
215 Ga0157373_10024749 3300013100 Bacteria 4346
216 Ga0157373_10200876 3300013100 Bacteria 1405
217 Ga0157373_10285966 3300013100 Bacteria 1169
218 Ga0157371_10100090 3300013102 Bacteria 2056
219 Ga0157371_10123037 3300013102 Bacteria 1845
220 Ga0157370_10213768 3300013104 Bacteria 1787
221 Ga0157370_10237342 3300013104 Bacteria 1687
222 Ga0157369_10002175 3300013105 Bacteria 23611
223 Ga0157369_10002814 3300013105 Bacteria 20759
224 Ga0157369_10128744 3300013105 Bacteria 2683
225 Ga0157369_10933751 3300013105 Bacteria 889
226 Ga0157374_10044797 3300013296 Bacteria 4090
227 Ga0157374_10368316 3300013296 Bacteria 1430
228 Ga0157374_10759774 3300013296 Bacteria 984
229 Ga0157378_10007917 3300013297 Bacteria 9271
230 Ga0157378_10852806 3300013297 Bacteria 939
231 Ga0163162_10026291 3300013306 Bacteria 5752
232 Ga0157372_10499115 3300013307 Bacteria 1419
233 Ga0157372_11000107 3300013307 Bacteria 969
234 Ga0157375_10006437 3300013308 Bacteria 10232
235 Ga0157375_10025418 3300013308 Bacteria 5502
236 Ga0157375_10294825 3300013308 Bacteria 1785
237 Ga0157375_10476264 3300013308 Bacteria 1413
238 Ga0163163_10623592 3300014325 Bacteria 1142
239 Ga0182008_10019125 3300014497 Bacteria 3539
240 Ga0157377_10117034 3300014745 Bacteria 1610
241 Ga0157379_10004998 3300014968 Bacteria 11381
242 Ga0157379_10097627 3300014968 Bacteria 2638
243 Ga0207697_10010718 3300025315 Bacteria 3907
244 Ga0207697_10024570 3300025315 Bacteria 2466
245 Ga0207642_10009906 3300025899 Bacteria 3335
246 Ga0207642_10119734 3300025899 Bacteria 1356
247 Ga0207688_10011227 3300025901 Bacteria 4874
248 Ga0207688_10301164 3300025901 Bacteria 980
249 Ga0207688_10442566 3300025901 Bacteria 809
250 Ga0207680_10000274 3300025903 Bacteria 24714
251 Ga0207680_10009481 3300025903 Bacteria 4831
252 Ga0207680_10043671 3300025903 Bacteria 2630
253 Ga0207680_10198298 3300025903 Bacteria 1366
254 Ga0207680_10290508 3300025903 Bacteria 1138
255 Ga0207647_10000786 3300025904 Bacteria 24627
256 Ga0207647_10038047 3300025904 Bacteria 3045
257 Ga0207699_10188303 3300025906 Bacteria 1391
258 Ga0207645_10031446 3300025907 Bacteria 3414
259 Ga0207645_10060266 3300025907 Bacteria 2423
260 Ga0207645_10358826 3300025907 Bacteria 976
261 Ga0207643_10097532 3300025908 Bacteria 1720
262 Ga0207705_10003585 3300025909 Bacteria 11829
263 Ga0207705_10004261 3300025909 Bacteria 10832
264 Ga0207705_10009376 3300025909 Bacteria 7117
265 Ga0207705_10042224 3300025909 Bacteria 3274
266 Ga0207705_10050546 3300025909 Bacteria 2993
267 Ga0207705_10126458 3300025909 Bacteria 1900
268 Ga0207705_10399716 3300025909 Bacteria 1063
269 Ga0207654_10425804 3300025911 Bacteria 927
270 Ga0207707_10079318 3300025912 Bacteria 2867
271 Ga0207707_10590811 3300025912 Bacteria 940
272 Ga0207693_10057403 3300025915 Bacteria 3051
273 Ga0207660_10088028 3300025917 Bacteria 2296
274 Ga0207660_10900112 3300025917 Bacteria 722
275 Ga0207657_10001891 3300025919 Bacteria 22626
276 Ga0207657_10013795 3300025919 Bacteria 7910
277 Ga0207657_10018695 3300025919 Bacteria 6604
278 Ga0207657_10025902 3300025919 Bacteria 5400
279 Ga0207657_10026016 3300025919 Bacteria 5386
280 Ga0207657_10046642 3300025919 Bacteria 3795
281 Ga0207657_10068185 3300025919 Bacteria 3022
282 Ga0207657_10072787 3300025919 Bacteria 2906
283 Ga0207657_10337020 3300025919 Bacteria 1191
284 Ga0207657_10683104 3300025919 Bacteria 798
285 Ga0207649_10069044 3300025920 Bacteria 2249
286 Ga0207649_10105005 3300025920 Bacteria 1877
287 Ga0207649_10372175 3300025920 Bacteria 1063
288 Ga0207649_10398879 3300025920 Bacteria 1029
289 Ga0207652_10282547 3300025921 Bacteria 1497
290 Ga0207652_10564626 3300025921 Bacteria 1022
291 Ga0207681_10059443 3300025923 Bacteria 2620
292 Ga0207681_10130694 3300025923 Bacteria 1856
293 Ga0207681_10430157 3300025923 Bacteria 1071
294 Ga0207681_10808122 3300025923 Bacteria 783
295 Ga0207694_10016883 3300025924 Bacteria 5514
296 Ga0207694_10139202 3300025924 Bacteria 1951
297 Ga0207650_10018978 3300025925 Bacteria 4832
298 Ga0207650_10085819 3300025925 Bacteria 2395
299 Ga0207659_10001607 3300025926 Bacteria 13404
300 Ga0207659_10041904 3300025926 Bacteria 3208
301 Ga0207659_10132682 3300025926 Bacteria 1925
302 Ga0207659_10204997 3300025926 Bacteria 1577
303 Ga0207687_10158712 3300025927 Bacteria 1733
304 Ga0207687_10219999 3300025927 Bacteria 1494
305 Ga0207700_10081616 3300025928 Bacteria 2525
306 Ga0207664_10043416 3300025929 Bacteria 3516
307 Ga0207664_10222508 3300025929 Bacteria 1637
308 Ga0207644_10003573 3300025931 Bacteria 10058
309 Ga0207644_10024586 3300025931 Bacteria 4136
310 Ga0207644_10355422 3300025931 Bacteria 1190
311 Ga0207690_10022209 3300025932 Bacteria 3945
312 Ga0207690_10046385 3300025932 Bacteria 2878
313 Ga0207690_10142801 3300025932 Bacteria 1766
314 Ga0207690_10155479 3300025932 Bacteria 1699
315 Ga0207690_10163202 3300025932 Bacteria 1663
316 Ga0207690_10340272 3300025932 Bacteria 1184
317 Ga0207706_10016452 3300025933 Bacteria 6677
318 Ga0207706_10026447 3300025933 Bacteria 5194
319 Ga0207706_10073430 3300025933 Bacteria 3008
320 Ga0207706_10111576 3300025933 Bacteria 2406
321 Ga0207706_10137967 3300025933 Bacteria 2145
322 Ga0207706_10251882 3300025933 Bacteria 1542
323 Ga0207706_10284200 3300025933 Bacteria 1442
324 Ga0207686_10013065 3300025934 Bacteria 4585
325 Ga0207686_10401824 3300025934 Bacteria 1044
326 Ga0207709_10066644 3300025935 Bacteria 2269
327 Ga0207709_10682132 3300025935 Bacteria 821
328 Ga0207669_10023063 3300025937 Bacteria 3317
329 Ga0207669_10036842 3300025937 Bacteria 2799
330 Ga0207669_10046827 3300025937 Bacteria 2558
331 Ga0207669_10110975 3300025937 Bacteria 1838
332 Ga0207704_10061904 3300025938 Bacteria 2324
333 Ga0207704_10073728 3300025938 Bacteria 2175
334 Ga0207704_10456101 3300025938 Bacteria 1021
335 Ga0207665_10094980 3300025939 Bacteria 2071
336 Ga0207691_10040872 3300025940 Bacteria 4284
337 Ga0207691_10050673 3300025940 Bacteria 3800
338 Ga0207691_10053759 3300025940 Bacteria 3676
339 Ga0207691_10359326 3300025940 Bacteria 1245
340 Ga0207691_10583716 3300025940 Bacteria 946
341 Ga0207711_10000107 3300025941 Bacteria 87146
342 Ga0207711_10008860 3300025941 Bacteria 8413
343 Ga0207711_10033544 3300025941 Bacteria 4345
344 Ga0207711_10047052 3300025941 Bacteria 3687
345 Ga0207711_10104473 3300025941 Bacteria 2510
346 Ga0207689_10021312 3300025942 Bacteria 5449
347 Ga0207689_10021341 3300025942 Bacteria 5446
348 Ga0207661_10292078 3300025944 Bacteria 1459
349 Ga0207679_10015436 3300025945 Bacteria 5047
350 Ga0207679_10106745 3300025945 Bacteria 2202
351 Ga0207679_10111817 3300025945 Bacteria 2157
352 Ga0207679_10134976 3300025945 Bacteria 1986
353 Ga0207679_10403247 3300025945 Bacteria 1203
354 Ga0207679_10571285 3300025945 Bacteria 1016
355 Ga0207679_10896260 3300025945 Bacteria 811
356 Ga0207667_10029298 3300025949 Bacteria 5971
357 Ga0207667_10071745 3300025949 Bacteria 3600
358 Ga0207667_10729694 3300025949 Bacteria 991
359 Ga0207651_10004804 3300025960 Bacteria 6875
360 Ga0207651_10024248 3300025960 Bacteria 3748
361 Ga0207651_10029994 3300025960 Bacteria 3456
362 Ga0207651_10171229 3300025960 Bacteria 1713
363 Ga0207651_10176426 3300025960 Bacteria 1691
364 Ga0207651_10207185 3300025960 Bacteria 1576
365 Ga0207668_10399764 3300025972 Bacteria 1161
366 Ga0207640_10144986 3300025981 Bacteria 1736
367 Ga0207640_10220151 3300025981 Bacteria 1453
368 Ga0207640_10543593 3300025981 Bacteria 975
369 Ga0207640_10871249 3300025981 Bacteria 785
370 Ga0207658_10001125 3300025986 Bacteria 21560
371 Ga0207658_10001869 3300025986 Bacteria 15760
372 Ga0207658_10026353 3300025986 Bacteria 4075
373 Ga0207658_10038298 3300025986 Bacteria 3453
374 Ga0207658_10093905 3300025986 Bacteria 2333
375 Ga0207658_10518670 3300025986 Bacteria 1063
376 Ga0207658_10692748 3300025986 Bacteria 920
377 Ga0207677_10002860 3300026023 Bacteria 9108
378 Ga0207677_10083870 3300026023 Bacteria 2295
379 Ga0207677_10116784 3300026023 Bacteria 1998
380 Ga0207677_10530586 3300026023 Bacteria 1022
381 Ga0207677_10656019 3300026023 Bacteria 927
382 Ga0207703_10001207 3300026035 Bacteria 24194
383 Ga0207703_10005640 3300026035 Bacteria 10054
384 Ga0207639_10025482 3300026041 Bacteria 4288
385 Ga0207639_10050345 3300026041 Bacteria 3164
386 Ga0207639_10065445 3300026041 Bacteria 2822
387 Ga0207678_10000736 3300026067 Bacteria 29995
388 Ga0207678_10016088 3300026067 Bacteria 6569
389 Ga0207678_10036653 3300026067 Bacteria 4269
390 Ga0207678_10042307 3300026067 Bacteria 3947
391 Ga0207678_10043642 3300026067 Bacteria 3879
392 Ga0207678_10056879 3300026067 Bacteria 3366
393 Ga0207678_10212402 3300026067 Bacteria 1655
394 Ga0207702_10126457 3300026078 Bacteria 2295
395 Ga0207702_10519032 3300026078 Bacteria 1163
396 Ga0207702_11083857 3300026078 Bacteria 795
397 Ga0207641_10031630 3300026088 Bacteria 4389
398 Ga0207641_10034319 3300026088 Bacteria 4219
399 Ga0207641_10244443 3300026088 Bacteria 1673
400 Ga0207641_10283640 3300026088 Bacteria 1559
401 Ga0207648_10008511 3300026089 Bacteria 9928
402 Ga0207648_10061172 3300026089 Bacteria 3283
403 Ga0207648_10596361 3300026089 Bacteria 1018
404 Ga0207676_10023980 3300026095 Bacteria 4510
405 Ga0207676_10065074 3300026095 Bacteria 2902
406 Ga0207676_10477093 3300026095 Bacteria 1181
407 Ga0207674_10000583 3300026116 Bacteria 48003
408 Ga0207674_10039372 3300026116 Bacteria 4901
409 Ga0207674_10065319 3300026116 Bacteria 3668
410 Ga0207674_10216030 3300026116 Bacteria 1866
411 Ga0207675_100100832 3300026118 Bacteria 2720
412 Ga0207683_10017280 3300026121 Bacteria 6145
413 Ga0207683_10087425 3300026121 Bacteria 2772
414 Ga0207683_10110127 3300026121 Bacteria 2465
415 Ga0207698_10037814 3300026142 Bacteria 3559
416 Ga0207698_10042377 3300026142 Bacteria 3400
417 Ga0207698_10110137 3300026142 Bacteria 2306
418 Ga0268266_10085752 3300028379 Bacteria 2752
419 Ga0268266_10114263 3300028379 Bacteria 2395
420 Ga0268266_10153667 3300028379 Bacteria 2077
421 Ga0268266_10521968 3300028379 Bacteria 1136
422 Ga0268265_10018027 3300028380 Bacteria 4886
423 Ga0268264_10135838 3300028381 Bacteria 2186
424 Ga0307408_100035753 3300031548 Bacteria 3487
425 Ga0307408_100052533 3300031548 Bacteria 2940
426 Ga0307408_100550798 3300031548 Bacteria 1018
427 Ga0307405_10168794 3300031731 Bacteria 1558
428 Ga0307410_10004840 3300031852 Bacteria 7036
429 Ga0307410_10011482 3300031852 Bacteria 5068
430 Ga0307406_10018687 3300031901 Bacteria 4054
431 Ga0307407_10010399 3300031903 Bacteria 4387
432 Ga0307412_10170072 3300031911 Bacteria 1628
433 Ga0307409_100072213 3300031995 Bacteria 2747
434 Ga0307409_100272655 3300031995 Bacteria 1559
435 Ga0307416_100139496 3300032002 Bacteria 2200
436 Ga0307414_10024096 3300032004 Bacteria 3874
437 Ga0307414_10034829 3300032004 Bacteria 3343
438 Ga0307411_10017265 3300032005 Bacteria 4106
439 Ga0307411_10087640 3300032005 Bacteria 2162
440 Ga0307415_100008636 3300032126 Bacteria 5659
441 Ga0307415_100099351 3300032126 Bacteria 2130
442 Ga0307415_100312367 3300032126 Bacteria 1307
443 Ga0373934_0136267 3300035086 Bacteria 1003
444 Ga0373940_0066734 3300035088 Bacteria 1040
445 Ga0373923_0045261 3300035111 Bacteria 1827
446 Ga0373954_0009159 3300035118 Bacteria 4356
447 Ga0373956_0080332 3300035119 Bacteria 1496
448 Ga0373957_0020711 3300035120 Bacteria 2327
449 Ga0373943_0328259 3300035170 Bacteria 873
450 Ga0373955_0096913 3300035172 Bacteria 1688
451 Ga0373935_0003260 3300035692 Bacteria 9385
452 Ga0373937_0038960 3300036401 Bacteria 4330
453 Ga0395899_0000132 3300037312 Bacteria 115455
454 Ga0395899_0011033 3300037312 Bacteria 6921
455 Ga0395899_0120538 3300037312 Bacteria 1879
456 Ga0395899_0121878 3300037312 Bacteria 1867
457 Ga0395899_0155360 3300037312 Bacteria 1619
458 Ga0395899_0158467 3300037312 Bacteria 1600
459 Ga0395899_0163697 3300037312 Bacteria 1570
460 Ga0395900_0000359 3300037418 Bacteria 66277
461 Ga0395900_0004142 3300037418 Bacteria 15438
462 Ga0395900_0043298 3300037418 Bacteria 4640
463 Ga0395900_0046606 3300037418 Bacteria 4465
464 Ga0395900_0089840 3300037418 Bacteria 3157
465 Ga0395900_0104796 3300037418 Bacteria 2905
466 Ga0395900_0126384 3300037418 Bacteria 2622
467 Ga0395900_0127400 3300037418 Bacteria 2610
468 Ga0395900_0231942 3300037418 Bacteria 1856
469 Ga0395900_0488640 3300037418 Bacteria 1183
470 Ga0395900_0543429 3300037418 Bacteria 1107
471 Ga0395900_0616719 3300037418 Bacteria 1024
472 Ga0395898_0010002 3300037466 Bacteria 9930
473 Ga0395898_0135792 3300037466 Bacteria 2355
474 Ga0395898_0158717 3300037466 Bacteria 2163
475 Ga0395898_0319701 3300037466 Bacteria 1481
476 Ga0395898_0365682 3300037466 Bacteria 1375
477 Ga0395898_1016515 3300037466 Bacteria 764
478 Ga0395905_0000946 3300037471 Bacteria 37278
479 Ga0395905_0002968 3300037471 Bacteria 18443
480 Ga0395905_0009091 3300037471 Bacteria 9741
481 Ga0395905_0010496 3300037471 Bacteria 9008
482 Ga0395905_0044358 3300037471 Bacteria 4173
483 Ga0395905_0046644 3300037471 Bacteria 4063
484 Ga0395905_0064484 3300037471 Bacteria 3428
485 Ga0395905_0071803 3300037471 Bacteria 3245
486 Ga0395905_0122316 3300037471 Bacteria 2447
487 Ga0395905_0125456 3300037471 Bacteria 2414
488 Ga0395905_0142992 3300037471 Bacteria 2250
489 Ga0395905_0203853 3300037471 Bacteria 1854
490 Ga0395905_0292748 3300037471 Bacteria 1515
491 Ga0395905_0351975 3300037471 Bacteria 1365
492 Ga0395905_0394374 3300037471 Unclassified 1279
493 Ga0395905_0470426 3300037471 Bacteria 1156
494 Ga0395905_0513028 3300037471 Bacteria 1099
495 Ga0395905_0656709 3300037471 Bacteria 951
496 Ga0395905_0709055 3300037471 Bacteria 908
497 Ga0395905_0929650 3300037471 Bacteria 773
498 Ga0395901_0000897 3300038443 Bacteria 32720
499 Ga0395901_0021404 3300038443 Bacteria 6625
500 Ga0395901_0045698 3300038443 Bacteria 4546
501 Ga0395901_0108982 3300038443 Bacteria 2907
502 Ga0395901_0176279 3300038443 Bacteria 2242
503 Ga0395901_0363682 3300038443 Bacteria 1491
504 Ga0439433_0109678 3300041999 Bacteria 690
505 Ga0439445_0015299 3300042004 Bacteria 1877
506 Ga0439432_031221 3300042006 Bacteria 1724
507 Ga0439449_0043738 3300042007 Bacteria 1662
508 Ga0439458_0017996 3300042157 Bacteria 1616
509 Ga0466966_0000059 3300044684 Bacteria 80975
510 Ga0466961_0128828 3300044693 Bacteria 1586
511 Ga0466961_0337016 3300044693 Bacteria 919
512 Ga0466963_0022845 3300044694 Bacteria 3965
513 Ga0466963_0032583 3300044694 Bacteria 3376
514 Ga0466964_0039545 3300044706 Bacteria 1901
515 Ga0466970_0168005 3300044765 Bacteria 1215
516 Ga0466959_0662865 3300045049 Bacteria 700
517 Ga0466958_0342071 3300045836 Bacteria 962
518 Ga0466958_0371273 3300045836 Bacteria 922
519 Ga0466967_0015403 3300045976 Bacteria 5991
520 Ga0466967_0061806 3300045976 Bacteria 3324
521 Ga0466967_0066838 3300045976 Bacteria 3204
522 Ga0466967_0069417 3300045976 Bacteria 3149
523 Ga0466967_0071591 3300045976 Bacteria 3105
524 Ga0466967_0118690 3300045976 Bacteria 2440
525 Ga0466967_0153381 3300045976 Bacteria 2155
526 Ga0466967_0174524 3300045976 Bacteria 2024
527 Ga0466967_0250014 3300045976 Bacteria 1693
528 Ga0466967_0324667 3300045976 Bacteria 1485
529 Ga0466967_0794828 3300045976 Bacteria 939
530 Ga0466967_1321520 3300045976 Bacteria 718
531 Ga0495582_0127107 3300046473 Bacteria 1439
532 Ga0495620_0083492 3300046515 Bacteria 1289
533 Ga0495663_0025509 3300046525 Bacteria 1724
534 Ga0495642_0034021 3300046528 Bacteria 2051
535 Ga0495598_0000477 3300046537 Bacteria 7347
536 Ga0495633_0203131 3300046558 Bacteria 909
537 Ga0495656_0212138 3300046615 Bacteria 965
538 Ga0495668_0038047 3300046616 Bacteria 2690
539 Ga0495659_0185205 3300046664 Bacteria 849
540 Ga0495669_0000249 3300046684 Bacteria 31437
541 Ga0495669_0001045 3300046684 Bacteria 11523
542 Ga0495669_0007911 3300046684 Bacteria 4464
543 Ga0495669_0054776 3300046684 Bacteria 1796
544 Ga0495669_0154681 3300046684 Bacteria 1087
545 Ga0495669_0177269 3300046684 Bacteria 1015
546 Ga0495670_0002609 3300046691 Bacteria 8900
547 Ga0495602_0085923 3300048088 Bacteria 2627
548 Ga0496101_0166436 3300048904 Bacteria 1693
549 Ga0496102_0032003 3300048905 Bacteria 4723
550 Ga0496102_0115104 3300048905 Bacteria 2509
551 Ga0496102_0240646 3300048905 Bacteria 1706
552 Ga0496103_0097744 3300048906 Bacteria 1856
553 Ga0496104_0270368 3300048907 Bacteria 1612
554 Ga0496106_0246613 3300048909 Bacteria 1427
555 Ga0496106_0253236 3300048909 Bacteria 1408
556 Ga0496107_0016436 3300048910 Bacteria 5197
557 Ga0496107_0111752 3300048910 Bacteria 2008
558 Ga0496108_0000498 3300048911 Bacteria 31214
559 Ga0496108_0018570 3300048911 Bacteria 5695
560 Ga0496109_0012910 3300048912 Bacteria 7222
561 Ga0496110_0000806 3300048913 Bacteria 21970
562 Ga0496110_0123075 3300048913 Bacteria 2339
563 Ga0496110_0223234 3300048913 Bacteria 1713
564 Ga0496111_0003369 3300048914 Bacteria 9880
565 Ga0496111_0161866 3300048914 Bacteria 1662
566 Ga0496111_0631757 3300048914 Bacteria 782
567 Ga0496111_0648273 3300048914 Bacteria 770
568 Ga0496112_0018938 3300048915 Bacteria 6487
569 Ga0496112_0365822 3300048915 Bacteria 1384
570 Ga0496112_0392815 3300048915 Bacteria 1327
571 Ga0496113_0004483 3300048916 Bacteria 8593
572 Ga0496113_0197128 3300048916 Bacteria 1600
573 Ga0496113_0322089 3300048916 Bacteria 1239
574 Ga0496114_0118518 3300048917 Bacteria 2274
575 Ga0496114_0646602 3300048917 Bacteria 930
576 Ga0496115_0021804 3300048918 Bacteria 4952
577 Ga0501067_0054019 3300049583 Bacteria 2226
578 Ga0501223_052616 3300049663 Bacteria 791
579 Ga0501249_033123 3300049679 Bacteria 1157
580 Ga0501257_023306 3300049686 Bacteria 1468
581 Ga0501221_035086 3300049704 Bacteria 1068
582 Ga0501225_0042962 3300049705 Bacteria 1249
583 Ga0501268_000371 3300049765 Bacteria 4738
584 Ga0501268_036816 3300049765 Bacteria 907
585 Ga0501283_013110 3300049779 Bacteria 1253
586 nmdc:mga0n895_458030_c1 3300050512 Bacteria 1287
587 nmdc:mga0rr50_116467_c1 3300050513 Bacteria 2121
588 nmdc:mga0a205_11551_c1 3300050515 Bacteria 8136
589 Ga0495612_0121835 3300053078 Bacteria 1122
590 Ga0466962_0171742 3300061719 Bacteria 1056
591 Ga0466962_0199004 3300061719 Bacteria 979

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041999 Ga0439433_0109678 Ga0439433_0109678_34_561 175
2 3300046664 Ga0495659_0185205 Ga0495659_0185205_263_808 181
3 3300061719 Ga0466962_0171742 Ga0466962_0171742_501_1046 181
4 3300046473 Ga0495582_0127107 Ga0495582_0127107_23_598 191
5 3300037418 Ga0395900_0126384 Ga0395900_0126384_452_1069 193
6 3300038443 Ga0395901_0176279 Ga0395901_0176279_709_1326 193
7 3300046515 Ga0495620_0083492 Ga0495620_0083492_371_967 198
8 3300001979 JGI24740J21852_10030783 JGI24740J21852_100307832 205
9 3300001979 JGI24740J21852_10037395 JGI24740J21852_100373952 205
10 3300001989 JGI24739J22299_10049822 JGI24739J22299_100498222 205
11 3300002077 JGI24744J21845_10000623 JGI24744J21845_100006236 205
12 3300003203 JGI25406J46586_10047432 JGI25406J46586_100474322 205
13 3300005290 Ga0065712_10107291 Ga0065712_101072911 205
14 3300005327 Ga0070658_10001359 Ga0070658_1000135919 205
15 3300005327 Ga0070658_10011801 Ga0070658_1001180111 205
16 3300005327 Ga0070658_10035301 Ga0070658_100353016 205
17 3300005327 Ga0070658_10133812 Ga0070658_101338122 205
18 3300005327 Ga0070658_10219490 Ga0070658_102194902 205
19 3300005327 Ga0070658_10586394 Ga0070658_105863942 205
20 3300005328 Ga0070676_10083076 Ga0070676_100830762 205
21 3300005329 Ga0070683_100029406 Ga0070683_1000294064 205
22 3300005330 Ga0070690_100006574 Ga0070690_1000065744 205
23 3300005330 Ga0070690_100244072 Ga0070690_1002440722 205
24 3300005331 Ga0070670_100001791 Ga0070670_10000179111 205
25 3300005331 Ga0070670_100092640 Ga0070670_1000926403 205
26 3300005333 Ga0070677_10058376 Ga0070677_100583762 205
27 3300005334 Ga0068869_100041710 Ga0068869_1000417106 205
28 3300005334 Ga0068869_100119827 Ga0068869_1001198272 205
29 3300005335 Ga0070666_10001341 Ga0070666_1000134114 205
30 3300005335 Ga0070666_10007313 Ga0070666_100073132 205
31 3300005335 Ga0070666_10058269 Ga0070666_100582692 205
32 3300005335 Ga0070666_10279869 Ga0070666_102798692 205
33 3300005335 Ga0070666_10292425 Ga0070666_102924252 205
34 3300005336 Ga0070680_100043881 Ga0070680_1000438815 205
35 3300005336 Ga0070680_100121337 Ga0070680_1001213372 205
36 3300005337 Ga0070682_100101917 Ga0070682_1001019172 205
37 3300005338 Ga0068868_100000579 Ga0068868_1000005795 205
38 3300005338 Ga0068868_100255635 Ga0068868_1002556352 205
39 3300005338 Ga0068868_100320535 Ga0068868_1003205352 205
40 3300005338 Ga0068868_100814294 Ga0068868_1008142941 205
41 3300005339 Ga0070660_100028807 Ga0070660_1000288072 205
42 3300005339 Ga0070660_100034505 Ga0070660_1000345056 205
43 3300005339 Ga0070660_100047884 Ga0070660_1000478843 205
44 3300005339 Ga0070660_100077102 Ga0070660_1000771022 205
45 3300005339 Ga0070660_100094735 Ga0070660_1000947353 205
46 3300005339 Ga0070660_100124472 Ga0070660_1001244723 205
47 3300005340 Ga0070689_100085464 Ga0070689_1000854642 205
48 3300005344 Ga0070661_100002170 Ga0070661_10000217016 205
49 3300005344 Ga0070661_100046713 Ga0070661_1000467132 205
50 3300005344 Ga0070661_100120580 Ga0070661_1001205802 205
51 3300005344 Ga0070661_100147671 Ga0070661_1001476712 205
52 3300005344 Ga0070661_100319443 Ga0070661_1003194432 205
53 3300005344 Ga0070661_100381395 Ga0070661_1003813952 205
54 3300005344 Ga0070661_100619919 Ga0070661_1006199192 205
55 3300005344 Ga0070661_100674095 Ga0070661_1006740952 205
56 3300005345 Ga0070692_10010852 Ga0070692_100108525 205
57 3300005347 Ga0070668_100378192 Ga0070668_1003781922 205
58 3300005353 Ga0070669_100034164 Ga0070669_1000341642 205
59 3300005353 Ga0070669_100102101 Ga0070669_1001021013 205
60 3300005353 Ga0070669_100144484 Ga0070669_1001444841 205
61 3300005354 Ga0070675_100011209 Ga0070675_10001120910 205
62 3300005354 Ga0070675_100011801 Ga0070675_10001180111 205
63 3300005354 Ga0070675_100089381 Ga0070675_1000893813 205
64 3300005354 Ga0070675_100288631 Ga0070675_1002886312 205
65 3300005355 Ga0070671_100000987 Ga0070671_10000098722 205
66 3300005355 Ga0070671_100009923 Ga0070671_1000099236 205
67 3300005355 Ga0070671_100014278 Ga0070671_1000142788 205
68 3300005355 Ga0070671_100055553 Ga0070671_1000555536 205
69 3300005355 Ga0070671_100066553 Ga0070671_1000665532 205
70 3300005356 Ga0070674_100005831 Ga0070674_10000583111 205
71 3300005356 Ga0070674_100047256 Ga0070674_1000472562 205
72 3300005356 Ga0070674_100054790 Ga0070674_1000547904 205
73 3300005356 Ga0070674_100121824 Ga0070674_1001218242 205
74 3300005356 Ga0070674_100736168 Ga0070674_1007361681 205
75 3300005364 Ga0070673_100023161 Ga0070673_1000231614 205
76 3300005364 Ga0070673_100089514 Ga0070673_1000895142 205
77 3300005364 Ga0070673_100300719 Ga0070673_1003007192 205
78 3300005364 Ga0070673_100428911 Ga0070673_1004289112 205
79 3300005364 Ga0070673_100476825 Ga0070673_1004768251 205
80 3300005364 Ga0070673_100525821 Ga0070673_1005258212 205
81 3300005364 Ga0070673_101096028 Ga0070673_1010960281 205
82 3300005366 Ga0070659_100003994 Ga0070659_10000399411 205
83 3300005366 Ga0070659_100007475 Ga0070659_1000074756 205
84 3300005366 Ga0070659_100011740 Ga0070659_1000117405 205
85 3300005366 Ga0070659_100110851 Ga0070659_1001108512 205
86 3300005366 Ga0070659_100160043 Ga0070659_1001600432 205
87 3300005366 Ga0070659_100227514 Ga0070659_1002275142 205
88 3300005366 Ga0070659_100401450 Ga0070659_1004014502 205
89 3300005366 Ga0070659_100414569 Ga0070659_1004145692 205
90 3300005367 Ga0070667_100000512 Ga0070667_10000051215 205
91 3300005367 Ga0070667_100019694 Ga0070667_1000196946 205
92 3300005367 Ga0070667_100026508 Ga0070667_1000265082 205
93 3300005367 Ga0070667_100047027 Ga0070667_1000470272 205
94 3300005367 Ga0070667_100146063 Ga0070667_1001460632 205
95 3300005367 Ga0070667_100149555 Ga0070667_1001495552 205
96 3300005367 Ga0070667_100364356 Ga0070667_1003643562 205
97 3300005435 Ga0070714_100017393 Ga0070714_1000173934 205
98 3300005435 Ga0070714_100069392 Ga0070714_1000693925 205
99 3300005436 Ga0070713_100186577 Ga0070713_1001865772 205
100 3300005455 Ga0070663_100004988 Ga0070663_10000498811 205
101 3300005455 Ga0070663_100086691 Ga0070663_1000866912 205
102 3300005455 Ga0070663_100178975 Ga0070663_1001789752 205
103 3300005455 Ga0070663_100229210 Ga0070663_1002292102 205
104 3300005455 Ga0070663_100638161 Ga0070663_1006381611 205
105 3300005456 Ga0070678_100021616 Ga0070678_1000216162 205
106 3300005456 Ga0070678_100076038 Ga0070678_1000760382 205
107 3300005456 Ga0070678_100155206 Ga0070678_1001552062 205
108 3300005457 Ga0070662_100034078 Ga0070662_1000340783 205
109 3300005457 Ga0070662_100056350 Ga0070662_1000563503 205
110 3300005457 Ga0070662_100071034 Ga0070662_1000710342 205
111 3300005457 Ga0070662_100094798 Ga0070662_1000947982 205
112 3300005457 Ga0070662_100228214 Ga0070662_1002282142 205
113 3300005457 Ga0070662_100317061 Ga0070662_1003170612 205
114 3300005458 Ga0070681_10070301 Ga0070681_100703012 205
115 3300005458 Ga0070681_10126037 Ga0070681_101260373 205
116 3300005458 Ga0070681_10368110 Ga0070681_103681102 205
117 3300005459 Ga0068867_100039243 Ga0068867_1000392435 205
118 3300005459 Ga0068867_100079413 Ga0068867_1000794132 205
119 3300005459 Ga0068867_100721249 Ga0068867_1007212491 205
120 3300005530 Ga0070679_100077233 Ga0070679_1000772333 205
121 3300005530 Ga0070679_100112719 Ga0070679_1001127192 205
122 3300005530 Ga0070679_100541676 Ga0070679_1005416761 205
123 3300005530 Ga0070679_100824951 Ga0070679_1008249512 205
124 3300005539 Ga0068853_100017118 Ga0068853_1000171187 205
125 3300005539 Ga0068853_100065515 Ga0068853_1000655153 205
126 3300005539 Ga0068853_100224456 Ga0068853_1002244562 205
127 3300005539 Ga0068853_100363764 Ga0068853_1003637642 205
128 3300005539 Ga0068853_100802408 Ga0068853_1008024082 205
129 3300005543 Ga0070672_100010538 Ga0070672_1000105385 205
130 3300005543 Ga0070672_100011841 Ga0070672_1000118416 205
131 3300005543 Ga0070672_100073288 Ga0070672_1000732881 205
132 3300005543 Ga0070672_100162199 Ga0070672_1001621992 205
133 3300005547 Ga0070693_100037272 Ga0070693_1000372724 205
134 3300005548 Ga0070665_100012566 Ga0070665_1000125667 205
135 3300005548 Ga0070665_100055960 Ga0070665_1000559603 205
136 3300005548 Ga0070665_100113092 Ga0070665_1001130922 205
137 3300005548 Ga0070665_100281383 Ga0070665_1002813832 205
138 3300005548 Ga0070665_100901726 Ga0070665_1009017262 205
139 3300005563 Ga0068855_100021387 Ga0068855_1000213876 205
140 3300005563 Ga0068855_100654929 Ga0068855_1006549292 205
141 3300005564 Ga0070664_100002681 Ga0070664_10000268110 205
142 3300005564 Ga0070664_100008006 Ga0070664_1000080069 205
143 3300005564 Ga0070664_100009014 Ga0070664_1000090144 205
144 3300005564 Ga0070664_100028888 Ga0070664_1000288887 205
145 3300005564 Ga0070664_100264631 Ga0070664_1002646312 205
146 3300005564 Ga0070664_100344210 Ga0070664_1003442102 205
147 3300005564 Ga0070664_100531328 Ga0070664_1005313282 205
148 3300005577 Ga0068857_100212059 Ga0068857_1002120592 205
149 3300005577 Ga0068857_100275304 Ga0068857_1002753042 205
150 3300005577 Ga0068857_100298793 Ga0068857_1002987932 205
151 3300005578 Ga0068854_100060204 Ga0068854_1000602043 205
152 3300005578 Ga0068854_100081363 Ga0068854_1000813634 205
153 3300005614 Ga0068856_100064237 Ga0068856_1000642372 205
154 3300005614 Ga0068856_100114959 Ga0068856_1001149592 205
155 3300005614 Ga0068856_100606574 Ga0068856_1006065742 205
156 3300005614 Ga0068856_100785655 Ga0068856_1007856552 205
157 3300005616 Ga0068852_100017235 Ga0068852_1000172357 205
158 3300005616 Ga0068852_100035280 Ga0068852_1000352803 205
159 3300005616 Ga0068852_100057228 Ga0068852_1000572286 205
160 3300005616 Ga0068852_100108013 Ga0068852_1001080133 205
161 3300005616 Ga0068852_100133613 Ga0068852_1001336133 205
162 3300005616 Ga0068852_100564067 Ga0068852_1005640672 205
163 3300005617 Ga0068859_100019836 Ga0068859_1000198368 205
164 3300005617 Ga0068859_100038438 Ga0068859_1000384386 205
165 3300005617 Ga0068859_100125473 Ga0068859_1001254732 205
166 3300005617 Ga0068859_101079533 Ga0068859_1010795332 205
167 3300005618 Ga0068864_100081724 Ga0068864_1000817244 205
168 3300005718 Ga0068866_10007967 Ga0068866_100079672 205
169 3300005718 Ga0068866_10012838 Ga0068866_100128384 205
170 3300005834 Ga0068851_10000795 Ga0068851_1000079512 205
171 3300005834 Ga0068851_10068072 Ga0068851_100680722 205
172 3300005840 Ga0068870_10083508 Ga0068870_100835082 205
173 3300005841 Ga0068863_100047687 Ga0068863_1000476872 205
174 3300005841 Ga0068863_100062024 Ga0068863_1000620245 205
175 3300005841 Ga0068863_100063432 Ga0068863_1000634322 205
176 3300005841 Ga0068863_100070449 Ga0068863_1000704492 205
177 3300005842 Ga0068858_100000855 Ga0068858_1000008558 205
178 3300005842 Ga0068858_100046354 Ga0068858_1000463542 205
179 3300005842 Ga0068858_100058218 Ga0068858_1000582184 205
180 3300005842 Ga0068858_100156188 Ga0068858_1001561882 205
181 3300005842 Ga0068858_100338981 Ga0068858_1003389812 205
182 3300005843 Ga0068860_100133013 Ga0068860_1001330132 205
183 3300005843 Ga0068860_100294085 Ga0068860_1002940852 205
184 3300005844 Ga0068862_100576318 Ga0068862_1005763181 205
185 3300005844 Ga0068862_101310948 Ga0068862_1013109482 205
186 3300005985 Ga0081539_10010258 Ga0081539_100102586 205
187 3300006051 Ga0075364_10290261 Ga0075364_102902612 205
188 3300006173 Ga0070716_100031705 Ga0070716_1000317052 205
189 3300006175 Ga0070712_100146222 Ga0070712_1001462222 205
190 3300006237 Ga0097621_100478316 Ga0097621_1004783161 205
191 3300006358 Ga0068871_100293400 Ga0068871_1002934002 205
192 3300006852 Ga0075433_10002953 Ga0075433_1000295310 205
193 3300006881 Ga0068865_100146761 Ga0068865_1001467612 205
194 3300006931 Ga0097620_100019837 Ga0097620_1000198378 205
195 3300006931 Ga0097620_100038439 Ga0097620_1000384396 205
196 3300006931 Ga0097620_100125476 Ga0097620_1001254762 205
197 3300006931 Ga0097620_101079604 Ga0097620_1010796042 205
198 3300007076 Ga0075435_100186166 Ga0075435_1001861662 205
199 3300009098 Ga0105245_10080047 Ga0105245_100800472 205
200 3300009098 Ga0105245_10116186 Ga0105245_101161864 205
201 3300009098 Ga0105245_10273180 Ga0105245_102731802 205
202 3300009148 Ga0105243_10105116 Ga0105243_101051162 205
203 3300009174 Ga0105241_10055738 Ga0105241_100557385 205
204 3300009174 Ga0105241_10092158 Ga0105241_100921582 205
205 3300009176 Ga0105242_10056605 Ga0105242_100566053 205
206 3300009176 Ga0105242_10521544 Ga0105242_105215442 205
207 3300009177 Ga0105248_10001030 Ga0105248_1000103030 205
208 3300009177 Ga0105248_10006248 Ga0105248_1000624814 205
209 3300009177 Ga0105248_10030185 Ga0105248_100301856 205
210 3300009177 Ga0105248_10111708 Ga0105248_101117082 205
211 3300009177 Ga0105248_10178177 Ga0105248_101781772 205
212 3300009545 Ga0105237_10029775 Ga0105237_100297755 205
213 3300009545 Ga0105237_10302677 Ga0105237_103026772 205
214 3300009551 Ga0105238_10013165 Ga0105238_100131655 205
215 3300009551 Ga0105238_10172508 Ga0105238_101725082 205
216 3300009551 Ga0105238_10438681 Ga0105238_104386812 205
217 3300009553 Ga0105249_10241890 Ga0105249_102418902 205
218 3300010375 Ga0105239_10258983 Ga0105239_102589832 205
219 3300011119 Ga0105246_10051840 Ga0105246_100518402 205
220 3300011119 Ga0105246_10935520 Ga0105246_109355201 205
221 3300013100 Ga0157373_10020929 Ga0157373_100209295 205
222 3300013100 Ga0157373_10024749 Ga0157373_100247493 205
223 3300013100 Ga0157373_10200876 Ga0157373_102008762 205
224 3300013100 Ga0157373_10285966 Ga0157373_102859662 205
225 3300013102 Ga0157371_10100090 Ga0157371_101000902 205
226 3300013102 Ga0157371_10123037 Ga0157371_101230372 205
227 3300013104 Ga0157370_10213768 Ga0157370_102137682 205
228 3300013104 Ga0157370_10237342 Ga0157370_102373422 205
229 3300013105 Ga0157369_10002175 Ga0157369_100021756 205
230 3300013105 Ga0157369_10002814 Ga0157369_100028149 205
231 3300013105 Ga0157369_10128744 Ga0157369_101287444 205
232 3300013105 Ga0157369_10933751 Ga0157369_109337512 205
233 3300013296 Ga0157374_10044797 Ga0157374_100447975 205
234 3300013296 Ga0157374_10368316 Ga0157374_103683162 205
235 3300013296 Ga0157374_10759774 Ga0157374_107597742 205
236 3300013297 Ga0157378_10007917 Ga0157378_100079178 205
237 3300013297 Ga0157378_10852806 Ga0157378_108528062 205
238 3300013306 Ga0163162_10026291 Ga0163162_100262915 205
239 3300013307 Ga0157372_10499115 Ga0157372_104991152 205
240 3300013307 Ga0157372_11000107 Ga0157372_110001072 205
241 3300013308 Ga0157375_10006437 Ga0157375_100064373 205
242 3300013308 Ga0157375_10025418 Ga0157375_100254187 205
243 3300013308 Ga0157375_10294825 Ga0157375_102948252 205
244 3300013308 Ga0157375_10476264 Ga0157375_104762642 205
245 3300014325 Ga0163163_10623592 Ga0163163_106235922 205
246 3300014497 Ga0182008_10019125 Ga0182008_100191252 205
247 3300014745 Ga0157377_10117034 Ga0157377_101170342 205
248 3300014968 Ga0157379_10004998 Ga0157379_100049986 205
249 3300014968 Ga0157379_10097627 Ga0157379_100976274 205
250 3300025315 Ga0207697_10010718 Ga0207697_100107182 205
251 3300025315 Ga0207697_10024570 Ga0207697_100245702 205
252 3300025899 Ga0207642_10009906 Ga0207642_100099063 205
253 3300025899 Ga0207642_10119734 Ga0207642_101197342 205
254 3300025901 Ga0207688_10011227 Ga0207688_100112277 205
255 3300025901 Ga0207688_10301164 Ga0207688_103011642 205
256 3300025901 Ga0207688_10442566 Ga0207688_104425661 205
257 3300025903 Ga0207680_10000274 Ga0207680_1000027411 205
258 3300025903 Ga0207680_10009481 Ga0207680_100094813 205
259 3300025903 Ga0207680_10043671 Ga0207680_100436712 205
260 3300025903 Ga0207680_10198298 Ga0207680_101982982 205
261 3300025903 Ga0207680_10290508 Ga0207680_102905082 205
262 3300025904 Ga0207647_10000786 Ga0207647_1000078625 205
263 3300025904 Ga0207647_10038047 Ga0207647_100380475 205
264 3300025906 Ga0207699_10188303 Ga0207699_101883032 205
265 3300025907 Ga0207645_10031446 Ga0207645_100314462 205
266 3300025907 Ga0207645_10060266 Ga0207645_100602662 205
267 3300025907 Ga0207645_10358826 Ga0207645_103588262 205
268 3300025908 Ga0207643_10097532 Ga0207643_100975322 205
269 3300025909 Ga0207705_10003585 Ga0207705_1000358512 205
270 3300025909 Ga0207705_10004261 Ga0207705_100042613 205
271 3300025909 Ga0207705_10009376 Ga0207705_100093762 205
272 3300025909 Ga0207705_10042224 Ga0207705_100422242 205
273 3300025909 Ga0207705_10050546 Ga0207705_100505464 205
274 3300025909 Ga0207705_10126458 Ga0207705_101264581 205
275 3300025909 Ga0207705_10399716 Ga0207705_103997161 205
276 3300025911 Ga0207654_10425804 Ga0207654_104258042 205
277 3300025912 Ga0207707_10079318 Ga0207707_100793183 205
278 3300025912 Ga0207707_10590811 Ga0207707_105908112 205
279 3300025915 Ga0207693_10057403 Ga0207693_100574033 205
280 3300025917 Ga0207660_10088028 Ga0207660_100880282 205
281 3300025917 Ga0207660_10900112 Ga0207660_109001121 205
282 3300025919 Ga0207657_10001891 Ga0207657_100018916 205
283 3300025919 Ga0207657_10013795 Ga0207657_100137955 205
284 3300025919 Ga0207657_10018695 Ga0207657_100186954 205
285 3300025919 Ga0207657_10025902 Ga0207657_100259024 205
286 3300025919 Ga0207657_10026016 Ga0207657_100260168 205
287 3300025919 Ga0207657_10046642 Ga0207657_100466425 205
288 3300025919 Ga0207657_10068185 Ga0207657_100681852 205
289 3300025919 Ga0207657_10072787 Ga0207657_100727873 205
290 3300025919 Ga0207657_10337020 Ga0207657_103370202 205
291 3300025919 Ga0207657_10683104 Ga0207657_106831041 205
292 3300025920 Ga0207649_10069044 Ga0207649_100690442 205
293 3300025920 Ga0207649_10105005 Ga0207649_101050053 205
294 3300025920 Ga0207649_10372175 Ga0207649_103721751 205
295 3300025920 Ga0207649_10398879 Ga0207649_103988792 205
296 3300025921 Ga0207652_10282547 Ga0207652_102825472 205
297 3300025921 Ga0207652_10564626 Ga0207652_105646262 205
298 3300025923 Ga0207681_10059443 Ga0207681_100594432 205
299 3300025923 Ga0207681_10130694 Ga0207681_101306943 205
300 3300025923 Ga0207681_10430157 Ga0207681_104301572 205
301 3300025923 Ga0207681_10808122 Ga0207681_108081221 205
302 3300025924 Ga0207694_10016883 Ga0207694_100168836 205
303 3300025924 Ga0207694_10139202 Ga0207694_101392022 205
304 3300025925 Ga0207650_10018978 Ga0207650_100189782 205
305 3300025925 Ga0207650_10085819 Ga0207650_100858193 205
306 3300025926 Ga0207659_10001607 Ga0207659_100016072 205
307 3300025926 Ga0207659_10041904 Ga0207659_100419042 205
308 3300025926 Ga0207659_10132682 Ga0207659_101326822 205
309 3300025926 Ga0207659_10204997 Ga0207659_102049972 205
310 3300025927 Ga0207687_10158712 Ga0207687_101587122 205
311 3300025927 Ga0207687_10219999 Ga0207687_102199992 205
312 3300025928 Ga0207700_10081616 Ga0207700_100816163 205
313 3300025929 Ga0207664_10043416 Ga0207664_100434165 205
314 3300025929 Ga0207664_10222508 Ga0207664_102225083 205
315 3300025931 Ga0207644_10003573 Ga0207644_100035738 205
316 3300025931 Ga0207644_10024586 Ga0207644_100245865 205
317 3300025931 Ga0207644_10355422 Ga0207644_103554222 205
318 3300025932 Ga0207690_10022209 Ga0207690_100222096 205
319 3300025932 Ga0207690_10046385 Ga0207690_100463852 205
320 3300025932 Ga0207690_10142801 Ga0207690_101428011 205
321 3300025932 Ga0207690_10155479 Ga0207690_101554792 205
322 3300025932 Ga0207690_10163202 Ga0207690_101632022 205
323 3300025932 Ga0207690_10340272 Ga0207690_103402722 205
324 3300025933 Ga0207706_10016452 Ga0207706_100164526 205
325 3300025933 Ga0207706_10026447 Ga0207706_100264473 205
326 3300025933 Ga0207706_10073430 Ga0207706_100734302 205
327 3300025933 Ga0207706_10111576 Ga0207706_101115764 205
328 3300025933 Ga0207706_10137967 Ga0207706_101379672 205
329 3300025933 Ga0207706_10251882 Ga0207706_102518822 205
330 3300025933 Ga0207706_10284200 Ga0207706_102842002 205
331 3300025934 Ga0207686_10013065 Ga0207686_100130652 205
332 3300025934 Ga0207686_10401824 Ga0207686_104018242 205
333 3300025935 Ga0207709_10066644 Ga0207709_100666442 205
334 3300025935 Ga0207709_10682132 Ga0207709_106821322 205
335 3300025937 Ga0207669_10023063 Ga0207669_100230632 205
336 3300025937 Ga0207669_10036842 Ga0207669_100368422 205
337 3300025937 Ga0207669_10046827 Ga0207669_100468273 205
338 3300025937 Ga0207669_10110975 Ga0207669_101109752 205
339 3300025938 Ga0207704_10061904 Ga0207704_100619042 205
340 3300025938 Ga0207704_10073728 Ga0207704_100737282 205
341 3300025938 Ga0207704_10456101 Ga0207704_104561012 205
342 3300025939 Ga0207665_10094980 Ga0207665_100949802 205
343 3300025940 Ga0207691_10040872 Ga0207691_100408724 205
344 3300025940 Ga0207691_10050673 Ga0207691_100506732 205
345 3300025940 Ga0207691_10053759 Ga0207691_100537594 205
346 3300025940 Ga0207691_10359326 Ga0207691_103593262 205
347 3300025940 Ga0207691_10583716 Ga0207691_105837161 205
348 3300025941 Ga0207711_10000107 Ga0207711_1000010714 205
349 3300025941 Ga0207711_10008860 Ga0207711_1000886013 205
350 3300025941 Ga0207711_10033544 Ga0207711_100335446 205
351 3300025941 Ga0207711_10047052 Ga0207711_100470527 205
352 3300025941 Ga0207711_10104473 Ga0207711_101044732 205
353 3300025942 Ga0207689_10021312 Ga0207689_100213128 205
354 3300025942 Ga0207689_10021341 Ga0207689_100213415 205
355 3300025944 Ga0207661_10292078 Ga0207661_102920782 205
356 3300025945 Ga0207679_10015436 Ga0207679_100154366 205
357 3300025945 Ga0207679_10106745 Ga0207679_101067453 205
358 3300025945 Ga0207679_10111817 Ga0207679_101118172 205
359 3300025945 Ga0207679_10134976 Ga0207679_101349762 205
360 3300025945 Ga0207679_10403247 Ga0207679_104032471 205
361 3300025945 Ga0207679_10571285 Ga0207679_105712852 205
362 3300025945 Ga0207679_10896260 Ga0207679_108962602 205
363 3300025949 Ga0207667_10029298 Ga0207667_100292986 205
364 3300025949 Ga0207667_10071745 Ga0207667_100717454 205
365 3300025949 Ga0207667_10729694 Ga0207667_107296942 205
366 3300025960 Ga0207651_10004804 Ga0207651_100048048 205
367 3300025960 Ga0207651_10024248 Ga0207651_100242487 205
368 3300025960 Ga0207651_10029994 Ga0207651_100299946 205
369 3300025960 Ga0207651_10171229 Ga0207651_101712292 205
370 3300025960 Ga0207651_10176426 Ga0207651_101764262 205
371 3300025960 Ga0207651_10207185 Ga0207651_102071852 205
372 3300025972 Ga0207668_10399764 Ga0207668_103997642 205
373 3300025981 Ga0207640_10144986 Ga0207640_101449862 205
374 3300025981 Ga0207640_10220151 Ga0207640_102201511 205
375 3300025981 Ga0207640_10543593 Ga0207640_105435932 205
376 3300025981 Ga0207640_10871249 Ga0207640_108712492 205
377 3300025986 Ga0207658_10001125 Ga0207658_100011255 205
378 3300025986 Ga0207658_10001869 Ga0207658_1000186916 205
379 3300025986 Ga0207658_10026353 Ga0207658_100263536 205
380 3300025986 Ga0207658_10038298 Ga0207658_100382982 205
381 3300025986 Ga0207658_10093905 Ga0207658_100939053 205
382 3300025986 Ga0207658_10518670 Ga0207658_105186702 205
383 3300025986 Ga0207658_10692748 Ga0207658_106927482 205
384 3300026023 Ga0207677_10002860 Ga0207677_1000286010 205
385 3300026023 Ga0207677_10083870 Ga0207677_100838702 205
386 3300026023 Ga0207677_10116784 Ga0207677_101167842 205
387 3300026023 Ga0207677_10530586 Ga0207677_105305862 205
388 3300026023 Ga0207677_10656019 Ga0207677_106560192 205
389 3300026035 Ga0207703_10001207 Ga0207703_100012076 205
390 3300026035 Ga0207703_10005640 Ga0207703_100056408 205
391 3300026041 Ga0207639_10025482 Ga0207639_100254822 205
392 3300026041 Ga0207639_10050345 Ga0207639_100503452 205
393 3300026041 Ga0207639_10065445 Ga0207639_100654452 205
394 3300026067 Ga0207678_10000736 Ga0207678_1000073617 205
395 3300026067 Ga0207678_10016088 Ga0207678_100160886 205
396 3300026067 Ga0207678_10036653 Ga0207678_100366535 205
397 3300026067 Ga0207678_10042307 Ga0207678_100423077 205
398 3300026067 Ga0207678_10043642 Ga0207678_100436422 205
399 3300026067 Ga0207678_10056879 Ga0207678_100568794 205
400 3300026067 Ga0207678_10212402 Ga0207678_102124022 205
401 3300026078 Ga0207702_10126457 Ga0207702_101264572 205
402 3300026078 Ga0207702_10519032 Ga0207702_105190322 205
403 3300026078 Ga0207702_11083857 Ga0207702_110838571 205
404 3300026088 Ga0207641_10031630 Ga0207641_100316302 205
405 3300026088 Ga0207641_10034319 Ga0207641_100343192 205
406 3300026088 Ga0207641_10244443 Ga0207641_102444432 205
407 3300026088 Ga0207641_10283640 Ga0207641_102836402 205
408 3300026089 Ga0207648_10008511 Ga0207648_100085115 205
409 3300026089 Ga0207648_10061172 Ga0207648_100611722 205
410 3300026089 Ga0207648_10596361 Ga0207648_105963612 205
411 3300026095 Ga0207676_10023980 Ga0207676_100239802 205
412 3300026095 Ga0207676_10065074 Ga0207676_100650743 205
413 3300026095 Ga0207676_10477093 Ga0207676_104770932 205
414 3300026116 Ga0207674_10000583 Ga0207674_100005833 205
415 3300026116 Ga0207674_10039372 Ga0207674_100393725 205
416 3300026116 Ga0207674_10065319 Ga0207674_100653193 205
417 3300026116 Ga0207674_10216030 Ga0207674_102160302 205
418 3300026118 Ga0207675_100100832 Ga0207675_1001008322 205
419 3300026121 Ga0207683_10017280 Ga0207683_100172806 205
420 3300026121 Ga0207683_10087425 Ga0207683_100874252 205
421 3300026121 Ga0207683_10110127 Ga0207683_101101273 205
422 3300026142 Ga0207698_10037814 Ga0207698_100378145 205
423 3300026142 Ga0207698_10042377 Ga0207698_100423773 205
424 3300026142 Ga0207698_10110137 Ga0207698_101101372 205
425 3300028379 Ga0268266_10085752 Ga0268266_100857522 205
426 3300028379 Ga0268266_10114263 Ga0268266_101142632 205
427 3300028379 Ga0268266_10153667 Ga0268266_101536673 205
428 3300028379 Ga0268266_10521968 Ga0268266_105219682 205
429 3300028380 Ga0268265_10018027 Ga0268265_100180277 205
430 3300028381 Ga0268264_10135838 Ga0268264_101358382 205
431 3300031548 Ga0307408_100035753 Ga0307408_1000357533 205
432 3300031548 Ga0307408_100052533 Ga0307408_1000525334 205
433 3300031548 Ga0307408_100550798 Ga0307408_1005507982 205
434 3300031731 Ga0307405_10168794 Ga0307405_101687942 205
435 3300031852 Ga0307410_10004840 Ga0307410_100048407 205
436 3300031852 Ga0307410_10011482 Ga0307410_100114825 205
437 3300031901 Ga0307406_10018687 Ga0307406_100186872 205
438 3300031903 Ga0307407_10010399 Ga0307407_100103994 205
439 3300031911 Ga0307412_10170072 Ga0307412_101700722 205
440 3300031995 Ga0307409_100072213 Ga0307409_1000722133 205
441 3300031995 Ga0307409_100272655 Ga0307409_1002726552 205
442 3300032002 Ga0307416_100139496 Ga0307416_1001394962 205
443 3300032004 Ga0307414_10024096 Ga0307414_100240962 205
444 3300032004 Ga0307414_10034829 Ga0307414_100348294 205
445 3300032005 Ga0307411_10017265 Ga0307411_100172653 205
446 3300032005 Ga0307411_10087640 Ga0307411_100876403 205
447 3300032126 Ga0307415_100008636 Ga0307415_1000086366 205
448 3300032126 Ga0307415_100099351 Ga0307415_1000993512 205
449 3300032126 Ga0307415_100312367 Ga0307415_1003123672 205
450 3300035086 Ga0373934_0136267 Ga0373934_0136267_191_808 205
451 3300035088 Ga0373940_0066734 Ga0373940_0066734_286_903 205
452 3300035111 Ga0373923_0045261 Ga0373923_0045261_1186_1803 205
453 3300035118 Ga0373954_0009159 Ga0373954_0009159_348_965 205
454 3300035119 Ga0373956_0080332 Ga0373956_0080332_503_1120 205
455 3300035120 Ga0373957_0020711 Ga0373957_0020711_1636_2253 205
456 3300035170 Ga0373943_0328259 Ga0373943_0328259_222_839 205
457 3300035172 Ga0373955_0096913 Ga0373955_0096913_220_837 205
458 3300035692 Ga0373935_0003260 Ga0373935_0003260_1388_2005 205
459 3300036401 Ga0373937_0038960 Ga0373937_0038960_895_1512 205
460 3300037312 Ga0395899_0000132 Ga0395899_0000132_112665_113285 205
461 3300037312 Ga0395899_0011033 Ga0395899_0011033_5711_6328 205
462 3300037312 Ga0395899_0120538 Ga0395899_0120538_891_1508 205
463 3300037312 Ga0395899_0121878 Ga0395899_0121878_830_1447 205
464 3300037312 Ga0395899_0155360 Ga0395899_0155360_813_1430 205
465 3300037312 Ga0395899_0158467 Ga0395899_0158467_797_1414 205
466 3300037312 Ga0395899_0163697 Ga0395899_0163697_24_641 205
467 3300037418 Ga0395900_0000359 Ga0395900_0000359_41407_42027 205
468 3300037418 Ga0395900_0004142 Ga0395900_0004142_4800_5417 205
469 3300037418 Ga0395900_0043298 Ga0395900_0043298_1082_1699 205
470 3300037418 Ga0395900_0046606 Ga0395900_0046606_873_1490 205
471 3300037418 Ga0395900_0089840 Ga0395900_0089840_374_991 205
472 3300037418 Ga0395900_0104796 Ga0395900_0104796_1497_2114 205
473 3300037418 Ga0395900_0127400 Ga0395900_0127400_1397_2014 205
474 3300037418 Ga0395900_0231942 Ga0395900_0231942_1052_1669 205
475 3300037418 Ga0395900_0488640 Ga0395900_0488640_217_834 205
476 3300037418 Ga0395900_0543429 Ga0395900_0543429_35_652 205
477 3300037418 Ga0395900_0616719 Ga0395900_0616719_130_747 205
478 3300037466 Ga0395898_0010002 Ga0395898_0010002_2288_2908 205
479 3300037466 Ga0395898_0135792 Ga0395898_0135792_1581_2198 205
480 3300037466 Ga0395898_0158717 Ga0395898_0158717_1115_1732 205
481 3300037466 Ga0395898_0319701 Ga0395898_0319701_519_1136 205
482 3300037466 Ga0395898_0365682 Ga0395898_0365682_736_1353 205
483 3300037466 Ga0395898_1016515 Ga0395898_1016515_101_718 205
484 3300037471 Ga0395905_0000946 Ga0395905_0000946_20487_21104 205
485 3300037471 Ga0395905_0002968 Ga0395905_0002968_5746_6363 205
486 3300037471 Ga0395905_0009091 Ga0395905_0009091_6515_7132 205
487 3300037471 Ga0395905_0010496 Ga0395905_0010496_6724_7341 205
488 3300037471 Ga0395905_0044358 Ga0395905_0044358_2501_3118 205
489 3300037471 Ga0395905_0046644 Ga0395905_0046644_2681_3298 205
490 3300037471 Ga0395905_0064484 Ga0395905_0064484_301_918 205
491 3300037471 Ga0395905_0071803 Ga0395905_0071803_2232_2849 205
492 3300037471 Ga0395905_0122316 Ga0395905_0122316_641_1258 205
493 3300037471 Ga0395905_0125456 Ga0395905_0125456_1173_1790 205
494 3300037471 Ga0395905_0142992 Ga0395905_0142992_1096_1728 205
495 3300037471 Ga0395905_0203853 Ga0395905_0203853_1118_1738 205
496 3300037471 Ga0395905_0292748 Ga0395905_0292748_403_1020 205
497 3300037471 Ga0395905_0351975 Ga0395905_0351975_721_1338 205
498 3300037471 Ga0395905_0394374 Ga0395905_0394374_637_1254 205
499 3300037471 Ga0395905_0470426 Ga0395905_0470426_293_910 205
500 3300037471 Ga0395905_0513028 Ga0395905_0513028_62_679 205
501 3300037471 Ga0395905_0656709 Ga0395905_0656709_127_744 205
502 3300037471 Ga0395905_0709055 Ga0395905_0709055_256_873 205
503 3300037471 Ga0395905_0929650 Ga0395905_0929650_138_755 205
504 3300038443 Ga0395901_0000897 Ga0395901_0000897_31474_32094 205
505 3300038443 Ga0395901_0021404 Ga0395901_0021404_3653_4270 205
506 3300038443 Ga0395901_0045698 Ga0395901_0045698_2411_3028 205
507 3300038443 Ga0395901_0108982 Ga0395901_0108982_2090_2707 205
508 3300038443 Ga0395901_0363682 Ga0395901_0363682_667_1284 205
509 3300042004 Ga0439445_0015299 Ga0439445_0015299_45_662 205
510 3300042006 Ga0439432_031221 Ga0439432_031221_871_1488 205
511 3300042007 Ga0439449_0043738 Ga0439449_0043738_950_1567 205
512 3300042157 Ga0439458_0017996 Ga0439458_0017996_517_1134 205
513 3300044684 Ga0466966_0000059 Ga0466966_0000059_65152_65769 205
514 3300044693 Ga0466961_0128828 Ga0466961_0128828_654_1289 205
515 3300044693 Ga0466961_0337016 Ga0466961_0337016_278_895 205
516 3300044694 Ga0466963_0022845 Ga0466963_0022845_1679_2296 205
517 3300044694 Ga0466963_0032583 Ga0466963_0032583_857_1474 205
518 3300044706 Ga0466964_0039545 Ga0466964_0039545_528_1145 205
519 3300044765 Ga0466970_0168005 Ga0466970_0168005_236_853 205
520 3300045049 Ga0466959_0662865 Ga0466959_0662865_48_665 205
521 3300045836 Ga0466958_0342071 Ga0466958_0342071_182_799 205
522 3300045836 Ga0466958_0371273 Ga0466958_0371273_131_748 205
523 3300045976 Ga0466967_0015403 Ga0466967_0015403_5032_5649 205
524 3300045976 Ga0466967_0061806 Ga0466967_0061806_1176_1793 205
525 3300045976 Ga0466967_0066838 Ga0466967_0066838_702_1319 205
526 3300045976 Ga0466967_0069417 Ga0466967_0069417_1299_1916 205
527 3300045976 Ga0466967_0071591 Ga0466967_0071591_2424_3041 205
528 3300045976 Ga0466967_0118690 Ga0466967_0118690_1026_1643 205
529 3300045976 Ga0466967_0153381 Ga0466967_0153381_830_1447 205
530 3300045976 Ga0466967_0174524 Ga0466967_0174524_221_838 205
531 3300045976 Ga0466967_0250014 Ga0466967_0250014_230_847 205
532 3300045976 Ga0466967_0324667 Ga0466967_0324667_822_1439 205
533 3300045976 Ga0466967_0794828 Ga0466967_0794828_279_896 205
534 3300045976 Ga0466967_1321520 Ga0466967_1321520_35_652 205
535 3300046525 Ga0495663_0025509 Ga0495663_0025509_927_1544 205
536 3300046528 Ga0495642_0034021 Ga0495642_0034021_1086_1703 205
537 3300046537 Ga0495598_0000477 Ga0495598_0000477_2532_3149 205
538 3300046558 Ga0495633_0203131 Ga0495633_0203131_156_773 205
539 3300046615 Ga0495656_0212138 Ga0495656_0212138_72_689 205
540 3300046616 Ga0495668_0038047 Ga0495668_0038047_1390_2007 205
541 3300046684 Ga0495669_0000249 Ga0495669_0000249_5011_5628 205
542 3300046684 Ga0495669_0001045 Ga0495669_0001045_8996_9613 205
543 3300046684 Ga0495669_0007911 Ga0495669_0007911_1877_2494 205
544 3300046684 Ga0495669_0054776 Ga0495669_0054776_709_1326 205
545 3300046684 Ga0495669_0154681 Ga0495669_0154681_426_1043 205
546 3300046684 Ga0495669_0177269 Ga0495669_0177269_208_825 205
547 3300046691 Ga0495670_0002609 Ga0495670_0002609_3518_4135 205
548 3300048088 Ga0495602_0085923 Ga0495602_0085923_964_1581 205
549 3300048904 Ga0496101_0166436 Ga0496101_0166436_130_747 205
550 3300048905 Ga0496102_0032003 Ga0496102_0032003_2420_3037 205
551 3300048905 Ga0496102_0115104 Ga0496102_0115104_116_733 205
552 3300048905 Ga0496102_0240646 Ga0496102_0240646_174_791 205
553 3300048906 Ga0496103_0097744 Ga0496103_0097744_142_759 205
554 3300048907 Ga0496104_0270368 Ga0496104_0270368_263_880 205
555 3300048909 Ga0496106_0246613 Ga0496106_0246613_272_889 205
556 3300048909 Ga0496106_0253236 Ga0496106_0253236_108_725 205
557 3300048910 Ga0496107_0016436 Ga0496107_0016436_4136_4753 205
558 3300048910 Ga0496107_0111752 Ga0496107_0111752_887_1504 205
559 3300048911 Ga0496108_0000498 Ga0496108_0000498_29924_30541 205
560 3300048911 Ga0496108_0018570 Ga0496108_0018570_4936_5553 205
561 3300048912 Ga0496109_0012910 Ga0496109_0012910_1039_1656 205
562 3300048913 Ga0496110_0000806 Ga0496110_0000806_13067_13684 205
563 3300048913 Ga0496110_0123075 Ga0496110_0123075_1159_1776 205
564 3300048913 Ga0496110_0223234 Ga0496110_0223234_825_1442 205
565 3300048914 Ga0496111_0003369 Ga0496111_0003369_950_1567 205
566 3300048914 Ga0496111_0161866 Ga0496111_0161866_650_1267 205
567 3300048914 Ga0496111_0631757 Ga0496111_0631757_91_708 205
568 3300048914 Ga0496111_0648273 Ga0496111_0648273_22_639 205
569 3300048915 Ga0496112_0018938 Ga0496112_0018938_5496_6113 205
570 3300048915 Ga0496112_0365822 Ga0496112_0365822_429_1046 205
571 3300048915 Ga0496112_0392815 Ga0496112_0392815_158_775 205
572 3300048916 Ga0496113_0004483 Ga0496113_0004483_2456_3073 205
573 3300048916 Ga0496113_0197128 Ga0496113_0197128_541_1158 205
574 3300048916 Ga0496113_0322089 Ga0496113_0322089_563_1180 205
575 3300048917 Ga0496114_0118518 Ga0496114_0118518_643_1260 205
576 3300048917 Ga0496114_0646602 Ga0496114_0646602_179_796 205
577 3300048918 Ga0496115_0021804 Ga0496115_0021804_96_713 205
578 3300049583 Ga0501067_0054019 Ga0501067_0054019_1355_1972 205
579 3300049663 Ga0501223_052616 Ga0501223_052616_93_710 205
580 3300049679 Ga0501249_033123 Ga0501249_033123_327_944 205
581 3300049686 Ga0501257_023306 Ga0501257_023306_420_1037 205
582 3300049704 Ga0501221_035086 Ga0501221_035086_363_980 205
583 3300049705 Ga0501225_0042962 Ga0501225_0042962_493_1110 205
584 3300049765 Ga0501268_000371 Ga0501268_000371_3367_3984 205
585 3300049765 Ga0501268_036816 Ga0501268_036816_212_829 205
586 3300049779 Ga0501283_013110 Ga0501283_013110_427_1044 205
587 3300050512 nmdc:mga0n895_458030_c1 nmdc:mga0n895_458030_c1_601_1218 205
588 3300050513 nmdc:mga0rr50_116467_c1 nmdc:mga0rr50_116467_c1_353_970 205
589 3300050515 nmdc:mga0a205_11551_c1 nmdc:mga0a205_11551_c1_5137_5754 205
590 3300053078 Ga0495612_0121835 Ga0495612_0121835_108_725 205
591 3300061719 Ga0466962_0199004 Ga0466962_0199004_316_933 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

50

192

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h56-assembly2.cif.gz_B crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution 0.902 11 204
2yg9-assembly2.cif.gz_B structure of an unusual 3-methyladenine dna glycosylase ii (alka) from deinococcus radiodurans 0.8819 10 203
2h56-assembly2.cif.gz_B crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution 0.853 11 204
2h56-assembly3.cif.gz_C crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution 0.844 11 204
4ejz-assembly2.cif.gz_B structure of mbogg1 in complex with low affinity dna ligand 0.8416 10 203
ID Description Score Start End Superfamily
af_B4FZ58_120_231_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9193 40 144 1.10.340.30
af_A0A1D8PI96_136_252_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.914 41 143 1.10.340.30
4ejzB02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9107 41 148 1.10.340.30
af_P22134_82_201_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8954 41 143 1.10.340.30
2h56B02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8903 37 143 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A516IQP4-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.983 1 201 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A1Y6E944-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9773 6 201 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A2G2D6Z0-F1-model_v4 deleted 0.9733 1 205
AF-A0A1B6Z8M6-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9724 1 205 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A5C6TT44-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9719 1 205 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916

Feature Viewer

pLDDT pTM Quality
94.97 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map