F467041
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 591 | 222 | 591 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300006175|Ga0070712_100146222|Ga0070712_1001462222 |
| Length | 210 |
| Sequence | MQRAPVVRTSHSIRRDVEELASREPAFARVVEQHGVPEPRNSKRGAETLLRTIVGQQVSVAAARSMWAKLGAAFGSPPDLNLLLAASDEALRAAGMSRQKSGYIRSLASLVISGELDLDNLPEDDEEAIALLTKIKGIGRWSAEIYLLFAEGRGDVFPAGDLAVLIELGRLLGLPEKPSEKQLRERAEAWRPYRGAAAVLAWHSYNSAVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 146 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 148 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 149 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 150 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 154 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 155 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 156 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 159 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 162 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 172 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 173 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 174 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 175 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 176 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 177 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 178 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 179 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 180 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 181 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 182 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 183 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 184 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 198 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 199 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 200 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 201 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 202 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 205 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 206 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 207 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 208 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 209 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 210 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 212 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 213 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 214 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 215 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 216 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 217 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 218 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.17 |
| Nodule | 0 |
| Rhizoplane | 4.91 |
| Rhizosphere | 94.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10030783 | 3300001979 | Bacteria | 1740 |
| 2 | JGI24740J21852_10037395 | 3300001979 | Bacteria | 1499 |
| 3 | JGI24739J22299_10049822 | 3300001989 | Bacteria | 1356 |
| 4 | JGI24744J21845_10000623 | 3300002077 | Bacteria | 6456 |
| 5 | JGI25406J46586_10047432 | 3300003203 | Bacteria | 1464 |
| 6 | Ga0065712_10107291 | 3300005290 | Bacteria | 1899 |
| 7 | Ga0070658_10001359 | 3300005327 | Bacteria | 20917 |
| 8 | Ga0070658_10011801 | 3300005327 | Bacteria | 7011 |
| 9 | Ga0070658_10035301 | 3300005327 | Bacteria | 4027 |
| 10 | Ga0070658_10133812 | 3300005327 | Bacteria | 2067 |
| 11 | Ga0070658_10219490 | 3300005327 | Bacteria | 1607 |
| 12 | Ga0070658_10586394 | 3300005327 | Bacteria | 966 |
| 13 | Ga0070676_10083076 | 3300005328 | Bacteria | 1947 |
| 14 | Ga0070683_100029406 | 3300005329 | Bacteria | 4974 |
| 15 | Ga0070690_100006574 | 3300005330 | Bacteria | 6603 |
| 16 | Ga0070690_100244072 | 3300005330 | Bacteria | 1268 |
| 17 | Ga0070670_100001791 | 3300005331 | Bacteria | 17491 |
| 18 | Ga0070670_100092640 | 3300005331 | Bacteria | 2598 |
| 19 | Ga0070677_10058376 | 3300005333 | Bacteria | 1584 |
| 20 | Ga0068869_100041710 | 3300005334 | Bacteria | 3287 |
| 21 | Ga0068869_100119827 | 3300005334 | Bacteria | 2011 |
| 22 | Ga0070666_10001341 | 3300005335 | Bacteria | 14928 |
| 23 | Ga0070666_10007313 | 3300005335 | Bacteria | 6802 |
| 24 | Ga0070666_10058269 | 3300005335 | Bacteria | 2612 |
| 25 | Ga0070666_10279869 | 3300005335 | Bacteria | 1186 |
| 26 | Ga0070666_10292425 | 3300005335 | Bacteria | 1159 |
| 27 | Ga0070680_100043881 | 3300005336 | Bacteria | 3633 |
| 28 | Ga0070680_100121337 | 3300005336 | Bacteria | 2182 |
| 29 | Ga0070682_100101917 | 3300005337 | Bacteria | 1896 |
| 30 | Ga0068868_100000579 | 3300005338 | Bacteria | 24551 |
| 31 | Ga0068868_100255635 | 3300005338 | Bacteria | 1476 |
| 32 | Ga0068868_100320535 | 3300005338 | Bacteria | 1320 |
| 33 | Ga0068868_100814294 | 3300005338 | Bacteria | 843 |
| 34 | Ga0070660_100028807 | 3300005339 | Bacteria | 4158 |
| 35 | Ga0070660_100034505 | 3300005339 | Bacteria | 3823 |
| 36 | Ga0070660_100047884 | 3300005339 | Bacteria | 3282 |
| 37 | Ga0070660_100077102 | 3300005339 | Bacteria | 2611 |
| 38 | Ga0070660_100094735 | 3300005339 | Bacteria | 2359 |
| 39 | Ga0070660_100124472 | 3300005339 | Bacteria | 2059 |
| 40 | Ga0070689_100085464 | 3300005340 | Bacteria | 2481 |
| 41 | Ga0070661_100002170 | 3300005344 | Bacteria | 13519 |
| 42 | Ga0070661_100046713 | 3300005344 | Bacteria | 3168 |
| 43 | Ga0070661_100120580 | 3300005344 | Bacteria | 1964 |
| 44 | Ga0070661_100147671 | 3300005344 | Bacteria | 1776 |
| 45 | Ga0070661_100319443 | 3300005344 | Bacteria | 1212 |
| 46 | Ga0070661_100381395 | 3300005344 | Bacteria | 1111 |
| 47 | Ga0070661_100619919 | 3300005344 | Bacteria | 876 |
| 48 | Ga0070661_100674095 | 3300005344 | Bacteria | 841 |
| 49 | Ga0070692_10010852 | 3300005345 | Bacteria | 4165 |
| 50 | Ga0070668_100378192 | 3300005347 | Bacteria | 1205 |
| 51 | Ga0070669_100034164 | 3300005353 | Bacteria | 3682 |
| 52 | Ga0070669_100102101 | 3300005353 | Bacteria | 2165 |
| 53 | Ga0070669_100144484 | 3300005353 | Bacteria | 1837 |
| 54 | Ga0070675_100011209 | 3300005354 | Bacteria | 7016 |
| 55 | Ga0070675_100011801 | 3300005354 | Bacteria | 6846 |
| 56 | Ga0070675_100089381 | 3300005354 | Bacteria | 2579 |
| 57 | Ga0070675_100288631 | 3300005354 | Bacteria | 1443 |
| 58 | Ga0070671_100000987 | 3300005355 | Bacteria | 20885 |
| 59 | Ga0070671_100009923 | 3300005355 | Bacteria | 7649 |
| 60 | Ga0070671_100014278 | 3300005355 | Bacteria | 6412 |
| 61 | Ga0070671_100055553 | 3300005355 | Bacteria | 3293 |
| 62 | Ga0070671_100066553 | 3300005355 | Bacteria | 3003 |
| 63 | Ga0070674_100005831 | 3300005356 | Bacteria | 7157 |
| 64 | Ga0070674_100047256 | 3300005356 | Bacteria | 2947 |
| 65 | Ga0070674_100054790 | 3300005356 | Bacteria | 2759 |
| 66 | Ga0070674_100121824 | 3300005356 | Bacteria | 1932 |
| 67 | Ga0070674_100736168 | 3300005356 | Bacteria | 846 |
| 68 | Ga0070673_100023161 | 3300005364 | Bacteria | 4534 |
| 69 | Ga0070673_100089514 | 3300005364 | Bacteria | 2512 |
| 70 | Ga0070673_100300719 | 3300005364 | Bacteria | 1412 |
| 71 | Ga0070673_100428911 | 3300005364 | Bacteria | 1186 |
| 72 | Ga0070673_100476825 | 3300005364 | Bacteria | 1126 |
| 73 | Ga0070673_100525821 | 3300005364 | Bacteria | 1072 |
| 74 | Ga0070673_101096028 | 3300005364 | Bacteria | 744 |
| 75 | Ga0070659_100003994 | 3300005366 | Bacteria | 10503 |
| 76 | Ga0070659_100007475 | 3300005366 | Bacteria | 7937 |
| 77 | Ga0070659_100011740 | 3300005366 | Bacteria | 6484 |
| 78 | Ga0070659_100110851 | 3300005366 | Bacteria | 2215 |
| 79 | Ga0070659_100160043 | 3300005366 | Bacteria | 1840 |
| 80 | Ga0070659_100227514 | 3300005366 | Bacteria | 1541 |
| 81 | Ga0070659_100401450 | 3300005366 | Bacteria | 1157 |
| 82 | Ga0070659_100414569 | 3300005366 | Bacteria | 1138 |
| 83 | Ga0070667_100000512 | 3300005367 | Bacteria | 39082 |
| 84 | Ga0070667_100019694 | 3300005367 | Bacteria | 5597 |
| 85 | Ga0070667_100026508 | 3300005367 | Bacteria | 4822 |
| 86 | Ga0070667_100047027 | 3300005367 | Bacteria | 3630 |
| 87 | Ga0070667_100146063 | 3300005367 | Bacteria | 2074 |
| 88 | Ga0070667_100149555 | 3300005367 | Bacteria | 2050 |
| 89 | Ga0070667_100364356 | 3300005367 | Bacteria | 1310 |
| 90 | Ga0070714_100017393 | 3300005435 | Bacteria | 5824 |
| 91 | Ga0070714_100069392 | 3300005435 | Bacteria | 3044 |
| 92 | Ga0070713_100186577 | 3300005436 | Bacteria | 1866 |
| 93 | Ga0070663_100004988 | 3300005455 | Bacteria | 7840 |
| 94 | Ga0070663_100086691 | 3300005455 | Bacteria | 2312 |
| 95 | Ga0070663_100178975 | 3300005455 | Bacteria | 1643 |
| 96 | Ga0070663_100229210 | 3300005455 | Bacteria | 1462 |
| 97 | Ga0070663_100638161 | 3300005455 | Bacteria | 899 |
| 98 | Ga0070678_100021616 | 3300005456 | Bacteria | 4247 |
| 99 | Ga0070678_100076038 | 3300005456 | Bacteria | 2528 |
| 100 | Ga0070678_100155206 | 3300005456 | Bacteria | 1848 |
| 101 | Ga0070662_100034078 | 3300005457 | Bacteria | 3589 |
| 102 | Ga0070662_100056350 | 3300005457 | Bacteria | 2853 |
| 103 | Ga0070662_100071034 | 3300005457 | Bacteria | 2566 |
| 104 | Ga0070662_100094798 | 3300005457 | Bacteria | 2248 |
| 105 | Ga0070662_100228214 | 3300005457 | Bacteria | 1488 |
| 106 | Ga0070662_100317061 | 3300005457 | Bacteria | 1270 |
| 107 | Ga0070681_10070301 | 3300005458 | Bacteria | 3466 |
| 108 | Ga0070681_10126037 | 3300005458 | Bacteria | 2493 |
| 109 | Ga0070681_10368110 | 3300005458 | Bacteria | 1347 |
| 110 | Ga0068867_100039243 | 3300005459 | Bacteria | 3451 |
| 111 | Ga0068867_100079413 | 3300005459 | Bacteria | 2469 |
| 112 | Ga0068867_100721249 | 3300005459 | Bacteria | 882 |
| 113 | Ga0070679_100077233 | 3300005530 | Bacteria | 3319 |
| 114 | Ga0070679_100112719 | 3300005530 | Bacteria | 2705 |
| 115 | Ga0070679_100541676 | 3300005530 | Bacteria | 1108 |
| 116 | Ga0070679_100824951 | 3300005530 | Bacteria | 870 |
| 117 | Ga0068853_100017118 | 3300005539 | Bacteria | 5979 |
| 118 | Ga0068853_100065515 | 3300005539 | Bacteria | 3153 |
| 119 | Ga0068853_100224456 | 3300005539 | Bacteria | 1717 |
| 120 | Ga0068853_100363764 | 3300005539 | Bacteria | 1348 |
| 121 | Ga0068853_100802408 | 3300005539 | Bacteria | 901 |
| 122 | Ga0070672_100010538 | 3300005543 | Bacteria | 6415 |
| 123 | Ga0070672_100011841 | 3300005543 | Bacteria | 6094 |
| 124 | Ga0070672_100073288 | 3300005543 | Bacteria | 2729 |
| 125 | Ga0070672_100162199 | 3300005543 | Bacteria | 1855 |
| 126 | Ga0070693_100037272 | 3300005547 | Bacteria | 2710 |
| 127 | Ga0070665_100012566 | 3300005548 | Bacteria | 8526 |
| 128 | Ga0070665_100055960 | 3300005548 | Bacteria | 3955 |
| 129 | Ga0070665_100113092 | 3300005548 | Bacteria | 2718 |
| 130 | Ga0070665_100281383 | 3300005548 | Bacteria | 1665 |
| 131 | Ga0070665_100901726 | 3300005548 | Bacteria | 897 |
| 132 | Ga0068855_100021387 | 3300005563 | Bacteria | 7757 |
| 133 | Ga0068855_100654929 | 3300005563 | Bacteria | 1127 |
| 134 | Ga0070664_100002681 | 3300005564 | Bacteria | 14366 |
| 135 | Ga0070664_100008006 | 3300005564 | Bacteria | 8537 |
| 136 | Ga0070664_100009014 | 3300005564 | Bacteria | 8093 |
| 137 | Ga0070664_100028888 | 3300005564 | Bacteria | 4618 |
| 138 | Ga0070664_100264631 | 3300005564 | Bacteria | 1547 |
| 139 | Ga0070664_100344210 | 3300005564 | Bacteria | 1355 |
| 140 | Ga0070664_100531328 | 3300005564 | Bacteria | 1086 |
| 141 | Ga0068857_100212059 | 3300005577 | Bacteria | 1767 |
| 142 | Ga0068857_100275304 | 3300005577 | Bacteria | 1547 |
| 143 | Ga0068857_100298793 | 3300005577 | Bacteria | 1484 |
| 144 | Ga0068854_100060204 | 3300005578 | Bacteria | 2746 |
| 145 | Ga0068854_100081363 | 3300005578 | Bacteria | 2392 |
| 146 | Ga0068856_100064237 | 3300005614 | Bacteria | 3627 |
| 147 | Ga0068856_100114959 | 3300005614 | Bacteria | 2690 |
| 148 | Ga0068856_100606574 | 3300005614 | Bacteria | 1115 |
| 149 | Ga0068856_100785655 | 3300005614 | Bacteria | 972 |
| 150 | Ga0068852_100017235 | 3300005616 | Bacteria | 5663 |
| 151 | Ga0068852_100035280 | 3300005616 | Bacteria | 4170 |
| 152 | Ga0068852_100057228 | 3300005616 | Bacteria | 3373 |
| 153 | Ga0068852_100108013 | 3300005616 | Bacteria | 2525 |
| 154 | Ga0068852_100133613 | 3300005616 | Bacteria | 2288 |
| 155 | Ga0068852_100564067 | 3300005616 | Bacteria | 1140 |
| 156 | Ga0068859_100019836 | 3300005617 | Bacteria | 6749 |
| 157 | Ga0068859_100038438 | 3300005617 | Bacteria | 4802 |
| 158 | Ga0068859_100125473 | 3300005617 | Bacteria | 2636 |
| 159 | Ga0068859_101079533 | 3300005617 | Bacteria | 883 |
| 160 | Ga0068864_100081724 | 3300005618 | Bacteria | 2833 |
| 161 | Ga0068866_10007967 | 3300005718 | Bacteria | 4448 |
| 162 | Ga0068866_10012838 | 3300005718 | Bacteria | 3659 |
| 163 | Ga0068851_10000795 | 3300005834 | Bacteria | 13623 |
| 164 | Ga0068851_10068072 | 3300005834 | Bacteria | 1837 |
| 165 | Ga0068870_10083508 | 3300005840 | Bacteria | 1771 |
| 166 | Ga0068863_100047687 | 3300005841 | Bacteria | 4063 |
| 167 | Ga0068863_100062024 | 3300005841 | Bacteria | 3535 |
| 168 | Ga0068863_100063432 | 3300005841 | Bacteria | 3495 |
| 169 | Ga0068863_100070449 | 3300005841 | Bacteria | 3307 |
| 170 | Ga0068858_100000855 | 3300005842 | Bacteria | 31513 |
| 171 | Ga0068858_100046354 | 3300005842 | Bacteria | 4030 |
| 172 | Ga0068858_100058218 | 3300005842 | Bacteria | 3572 |
| 173 | Ga0068858_100156188 | 3300005842 | Bacteria | 2146 |
| 174 | Ga0068858_100338981 | 3300005842 | Bacteria | 1439 |
| 175 | Ga0068860_100133013 | 3300005843 | Bacteria | 2388 |
| 176 | Ga0068860_100294085 | 3300005843 | Bacteria | 1590 |
| 177 | Ga0068862_100576318 | 3300005844 | Bacteria | 1077 |
| 178 | Ga0068862_101310948 | 3300005844 | Bacteria | 725 |
| 179 | Ga0081539_10010258 | 3300005985 | Bacteria | 7652 |
| 180 | Ga0075364_10290261 | 3300006051 | Bacteria | 1113 |
| 181 | Ga0070716_100031705 | 3300006173 | Bacteria | 2877 |
| 182 | Ga0070712_100146222 | 3300006175 | Bacteria | 1809 |
| 183 | Ga0097621_100478316 | 3300006237 | Bacteria | 1125 |
| 184 | Ga0068871_100293400 | 3300006358 | Bacteria | 1425 |
| 185 | Ga0075433_10002953 | 3300006852 | Bacteria | 13056 |
| 186 | Ga0068865_100146761 | 3300006881 | Bacteria | 1785 |
| 187 | Ga0097620_100019837 | 3300006931 | Bacteria | 6749 |
| 188 | Ga0097620_100038439 | 3300006931 | Bacteria | 4802 |
| 189 | Ga0097620_100125476 | 3300006931 | Bacteria | 2636 |
| 190 | Ga0097620_101079604 | 3300006931 | Bacteria | 883 |
| 191 | Ga0075435_100186166 | 3300007076 | Bacteria | 1756 |
| 192 | Ga0105245_10080047 | 3300009098 | Bacteria | 2984 |
| 193 | Ga0105245_10116186 | 3300009098 | Bacteria | 2495 |
| 194 | Ga0105245_10273180 | 3300009098 | Bacteria | 1649 |
| 195 | Ga0105243_10105116 | 3300009148 | Bacteria | 2351 |
| 196 | Ga0105241_10055738 | 3300009174 | Bacteria | 3029 |
| 197 | Ga0105241_10092158 | 3300009174 | Bacteria | 2392 |
| 198 | Ga0105242_10056605 | 3300009176 | Bacteria | 3209 |
| 199 | Ga0105242_10521544 | 3300009176 | Bacteria | 1134 |
| 200 | Ga0105248_10001030 | 3300009177 | Bacteria | 30868 |
| 201 | Ga0105248_10006248 | 3300009177 | Bacteria | 13062 |
| 202 | Ga0105248_10030185 | 3300009177 | Bacteria | 6051 |
| 203 | Ga0105248_10111708 | 3300009177 | Bacteria | 3082 |
| 204 | Ga0105248_10178177 | 3300009177 | Bacteria | 2395 |
| 205 | Ga0105237_10029775 | 3300009545 | Bacteria | 5547 |
| 206 | Ga0105237_10302677 | 3300009545 | Bacteria | 1602 |
| 207 | Ga0105238_10013165 | 3300009551 | Bacteria | 8347 |
| 208 | Ga0105238_10172508 | 3300009551 | Bacteria | 2139 |
| 209 | Ga0105238_10438681 | 3300009551 | Bacteria | 1302 |
| 210 | Ga0105249_10241890 | 3300009553 | Bacteria | 1785 |
| 211 | Ga0105239_10258983 | 3300010375 | Bacteria | 1955 |
| 212 | Ga0105246_10051840 | 3300011119 | Bacteria | 2819 |
| 213 | Ga0105246_10935520 | 3300011119 | Bacteria | 780 |
| 214 | Ga0157373_10020929 | 3300013100 | Bacteria | 4750 |
| 215 | Ga0157373_10024749 | 3300013100 | Bacteria | 4346 |
| 216 | Ga0157373_10200876 | 3300013100 | Bacteria | 1405 |
| 217 | Ga0157373_10285966 | 3300013100 | Bacteria | 1169 |
| 218 | Ga0157371_10100090 | 3300013102 | Bacteria | 2056 |
| 219 | Ga0157371_10123037 | 3300013102 | Bacteria | 1845 |
| 220 | Ga0157370_10213768 | 3300013104 | Bacteria | 1787 |
| 221 | Ga0157370_10237342 | 3300013104 | Bacteria | 1687 |
| 222 | Ga0157369_10002175 | 3300013105 | Bacteria | 23611 |
| 223 | Ga0157369_10002814 | 3300013105 | Bacteria | 20759 |
| 224 | Ga0157369_10128744 | 3300013105 | Bacteria | 2683 |
| 225 | Ga0157369_10933751 | 3300013105 | Bacteria | 889 |
| 226 | Ga0157374_10044797 | 3300013296 | Bacteria | 4090 |
| 227 | Ga0157374_10368316 | 3300013296 | Bacteria | 1430 |
| 228 | Ga0157374_10759774 | 3300013296 | Bacteria | 984 |
| 229 | Ga0157378_10007917 | 3300013297 | Bacteria | 9271 |
| 230 | Ga0157378_10852806 | 3300013297 | Bacteria | 939 |
| 231 | Ga0163162_10026291 | 3300013306 | Bacteria | 5752 |
| 232 | Ga0157372_10499115 | 3300013307 | Bacteria | 1419 |
| 233 | Ga0157372_11000107 | 3300013307 | Bacteria | 969 |
| 234 | Ga0157375_10006437 | 3300013308 | Bacteria | 10232 |
| 235 | Ga0157375_10025418 | 3300013308 | Bacteria | 5502 |
| 236 | Ga0157375_10294825 | 3300013308 | Bacteria | 1785 |
| 237 | Ga0157375_10476264 | 3300013308 | Bacteria | 1413 |
| 238 | Ga0163163_10623592 | 3300014325 | Bacteria | 1142 |
| 239 | Ga0182008_10019125 | 3300014497 | Bacteria | 3539 |
| 240 | Ga0157377_10117034 | 3300014745 | Bacteria | 1610 |
| 241 | Ga0157379_10004998 | 3300014968 | Bacteria | 11381 |
| 242 | Ga0157379_10097627 | 3300014968 | Bacteria | 2638 |
| 243 | Ga0207697_10010718 | 3300025315 | Bacteria | 3907 |
| 244 | Ga0207697_10024570 | 3300025315 | Bacteria | 2466 |
| 245 | Ga0207642_10009906 | 3300025899 | Bacteria | 3335 |
| 246 | Ga0207642_10119734 | 3300025899 | Bacteria | 1356 |
| 247 | Ga0207688_10011227 | 3300025901 | Bacteria | 4874 |
| 248 | Ga0207688_10301164 | 3300025901 | Bacteria | 980 |
| 249 | Ga0207688_10442566 | 3300025901 | Bacteria | 809 |
| 250 | Ga0207680_10000274 | 3300025903 | Bacteria | 24714 |
| 251 | Ga0207680_10009481 | 3300025903 | Bacteria | 4831 |
| 252 | Ga0207680_10043671 | 3300025903 | Bacteria | 2630 |
| 253 | Ga0207680_10198298 | 3300025903 | Bacteria | 1366 |
| 254 | Ga0207680_10290508 | 3300025903 | Bacteria | 1138 |
| 255 | Ga0207647_10000786 | 3300025904 | Bacteria | 24627 |
| 256 | Ga0207647_10038047 | 3300025904 | Bacteria | 3045 |
| 257 | Ga0207699_10188303 | 3300025906 | Bacteria | 1391 |
| 258 | Ga0207645_10031446 | 3300025907 | Bacteria | 3414 |
| 259 | Ga0207645_10060266 | 3300025907 | Bacteria | 2423 |
| 260 | Ga0207645_10358826 | 3300025907 | Bacteria | 976 |
| 261 | Ga0207643_10097532 | 3300025908 | Bacteria | 1720 |
| 262 | Ga0207705_10003585 | 3300025909 | Bacteria | 11829 |
| 263 | Ga0207705_10004261 | 3300025909 | Bacteria | 10832 |
| 264 | Ga0207705_10009376 | 3300025909 | Bacteria | 7117 |
| 265 | Ga0207705_10042224 | 3300025909 | Bacteria | 3274 |
| 266 | Ga0207705_10050546 | 3300025909 | Bacteria | 2993 |
| 267 | Ga0207705_10126458 | 3300025909 | Bacteria | 1900 |
| 268 | Ga0207705_10399716 | 3300025909 | Bacteria | 1063 |
| 269 | Ga0207654_10425804 | 3300025911 | Bacteria | 927 |
| 270 | Ga0207707_10079318 | 3300025912 | Bacteria | 2867 |
| 271 | Ga0207707_10590811 | 3300025912 | Bacteria | 940 |
| 272 | Ga0207693_10057403 | 3300025915 | Bacteria | 3051 |
| 273 | Ga0207660_10088028 | 3300025917 | Bacteria | 2296 |
| 274 | Ga0207660_10900112 | 3300025917 | Bacteria | 722 |
| 275 | Ga0207657_10001891 | 3300025919 | Bacteria | 22626 |
| 276 | Ga0207657_10013795 | 3300025919 | Bacteria | 7910 |
| 277 | Ga0207657_10018695 | 3300025919 | Bacteria | 6604 |
| 278 | Ga0207657_10025902 | 3300025919 | Bacteria | 5400 |
| 279 | Ga0207657_10026016 | 3300025919 | Bacteria | 5386 |
| 280 | Ga0207657_10046642 | 3300025919 | Bacteria | 3795 |
| 281 | Ga0207657_10068185 | 3300025919 | Bacteria | 3022 |
| 282 | Ga0207657_10072787 | 3300025919 | Bacteria | 2906 |
| 283 | Ga0207657_10337020 | 3300025919 | Bacteria | 1191 |
| 284 | Ga0207657_10683104 | 3300025919 | Bacteria | 798 |
| 285 | Ga0207649_10069044 | 3300025920 | Bacteria | 2249 |
| 286 | Ga0207649_10105005 | 3300025920 | Bacteria | 1877 |
| 287 | Ga0207649_10372175 | 3300025920 | Bacteria | 1063 |
| 288 | Ga0207649_10398879 | 3300025920 | Bacteria | 1029 |
| 289 | Ga0207652_10282547 | 3300025921 | Bacteria | 1497 |
| 290 | Ga0207652_10564626 | 3300025921 | Bacteria | 1022 |
| 291 | Ga0207681_10059443 | 3300025923 | Bacteria | 2620 |
| 292 | Ga0207681_10130694 | 3300025923 | Bacteria | 1856 |
| 293 | Ga0207681_10430157 | 3300025923 | Bacteria | 1071 |
| 294 | Ga0207681_10808122 | 3300025923 | Bacteria | 783 |
| 295 | Ga0207694_10016883 | 3300025924 | Bacteria | 5514 |
| 296 | Ga0207694_10139202 | 3300025924 | Bacteria | 1951 |
| 297 | Ga0207650_10018978 | 3300025925 | Bacteria | 4832 |
| 298 | Ga0207650_10085819 | 3300025925 | Bacteria | 2395 |
| 299 | Ga0207659_10001607 | 3300025926 | Bacteria | 13404 |
| 300 | Ga0207659_10041904 | 3300025926 | Bacteria | 3208 |
| 301 | Ga0207659_10132682 | 3300025926 | Bacteria | 1925 |
| 302 | Ga0207659_10204997 | 3300025926 | Bacteria | 1577 |
| 303 | Ga0207687_10158712 | 3300025927 | Bacteria | 1733 |
| 304 | Ga0207687_10219999 | 3300025927 | Bacteria | 1494 |
| 305 | Ga0207700_10081616 | 3300025928 | Bacteria | 2525 |
| 306 | Ga0207664_10043416 | 3300025929 | Bacteria | 3516 |
| 307 | Ga0207664_10222508 | 3300025929 | Bacteria | 1637 |
| 308 | Ga0207644_10003573 | 3300025931 | Bacteria | 10058 |
| 309 | Ga0207644_10024586 | 3300025931 | Bacteria | 4136 |
| 310 | Ga0207644_10355422 | 3300025931 | Bacteria | 1190 |
| 311 | Ga0207690_10022209 | 3300025932 | Bacteria | 3945 |
| 312 | Ga0207690_10046385 | 3300025932 | Bacteria | 2878 |
| 313 | Ga0207690_10142801 | 3300025932 | Bacteria | 1766 |
| 314 | Ga0207690_10155479 | 3300025932 | Bacteria | 1699 |
| 315 | Ga0207690_10163202 | 3300025932 | Bacteria | 1663 |
| 316 | Ga0207690_10340272 | 3300025932 | Bacteria | 1184 |
| 317 | Ga0207706_10016452 | 3300025933 | Bacteria | 6677 |
| 318 | Ga0207706_10026447 | 3300025933 | Bacteria | 5194 |
| 319 | Ga0207706_10073430 | 3300025933 | Bacteria | 3008 |
| 320 | Ga0207706_10111576 | 3300025933 | Bacteria | 2406 |
| 321 | Ga0207706_10137967 | 3300025933 | Bacteria | 2145 |
| 322 | Ga0207706_10251882 | 3300025933 | Bacteria | 1542 |
| 323 | Ga0207706_10284200 | 3300025933 | Bacteria | 1442 |
| 324 | Ga0207686_10013065 | 3300025934 | Bacteria | 4585 |
| 325 | Ga0207686_10401824 | 3300025934 | Bacteria | 1044 |
| 326 | Ga0207709_10066644 | 3300025935 | Bacteria | 2269 |
| 327 | Ga0207709_10682132 | 3300025935 | Bacteria | 821 |
| 328 | Ga0207669_10023063 | 3300025937 | Bacteria | 3317 |
| 329 | Ga0207669_10036842 | 3300025937 | Bacteria | 2799 |
| 330 | Ga0207669_10046827 | 3300025937 | Bacteria | 2558 |
| 331 | Ga0207669_10110975 | 3300025937 | Bacteria | 1838 |
| 332 | Ga0207704_10061904 | 3300025938 | Bacteria | 2324 |
| 333 | Ga0207704_10073728 | 3300025938 | Bacteria | 2175 |
| 334 | Ga0207704_10456101 | 3300025938 | Bacteria | 1021 |
| 335 | Ga0207665_10094980 | 3300025939 | Bacteria | 2071 |
| 336 | Ga0207691_10040872 | 3300025940 | Bacteria | 4284 |
| 337 | Ga0207691_10050673 | 3300025940 | Bacteria | 3800 |
| 338 | Ga0207691_10053759 | 3300025940 | Bacteria | 3676 |
| 339 | Ga0207691_10359326 | 3300025940 | Bacteria | 1245 |
| 340 | Ga0207691_10583716 | 3300025940 | Bacteria | 946 |
| 341 | Ga0207711_10000107 | 3300025941 | Bacteria | 87146 |
| 342 | Ga0207711_10008860 | 3300025941 | Bacteria | 8413 |
| 343 | Ga0207711_10033544 | 3300025941 | Bacteria | 4345 |
| 344 | Ga0207711_10047052 | 3300025941 | Bacteria | 3687 |
| 345 | Ga0207711_10104473 | 3300025941 | Bacteria | 2510 |
| 346 | Ga0207689_10021312 | 3300025942 | Bacteria | 5449 |
| 347 | Ga0207689_10021341 | 3300025942 | Bacteria | 5446 |
| 348 | Ga0207661_10292078 | 3300025944 | Bacteria | 1459 |
| 349 | Ga0207679_10015436 | 3300025945 | Bacteria | 5047 |
| 350 | Ga0207679_10106745 | 3300025945 | Bacteria | 2202 |
| 351 | Ga0207679_10111817 | 3300025945 | Bacteria | 2157 |
| 352 | Ga0207679_10134976 | 3300025945 | Bacteria | 1986 |
| 353 | Ga0207679_10403247 | 3300025945 | Bacteria | 1203 |
| 354 | Ga0207679_10571285 | 3300025945 | Bacteria | 1016 |
| 355 | Ga0207679_10896260 | 3300025945 | Bacteria | 811 |
| 356 | Ga0207667_10029298 | 3300025949 | Bacteria | 5971 |
| 357 | Ga0207667_10071745 | 3300025949 | Bacteria | 3600 |
| 358 | Ga0207667_10729694 | 3300025949 | Bacteria | 991 |
| 359 | Ga0207651_10004804 | 3300025960 | Bacteria | 6875 |
| 360 | Ga0207651_10024248 | 3300025960 | Bacteria | 3748 |
| 361 | Ga0207651_10029994 | 3300025960 | Bacteria | 3456 |
| 362 | Ga0207651_10171229 | 3300025960 | Bacteria | 1713 |
| 363 | Ga0207651_10176426 | 3300025960 | Bacteria | 1691 |
| 364 | Ga0207651_10207185 | 3300025960 | Bacteria | 1576 |
| 365 | Ga0207668_10399764 | 3300025972 | Bacteria | 1161 |
| 366 | Ga0207640_10144986 | 3300025981 | Bacteria | 1736 |
| 367 | Ga0207640_10220151 | 3300025981 | Bacteria | 1453 |
| 368 | Ga0207640_10543593 | 3300025981 | Bacteria | 975 |
| 369 | Ga0207640_10871249 | 3300025981 | Bacteria | 785 |
| 370 | Ga0207658_10001125 | 3300025986 | Bacteria | 21560 |
| 371 | Ga0207658_10001869 | 3300025986 | Bacteria | 15760 |
| 372 | Ga0207658_10026353 | 3300025986 | Bacteria | 4075 |
| 373 | Ga0207658_10038298 | 3300025986 | Bacteria | 3453 |
| 374 | Ga0207658_10093905 | 3300025986 | Bacteria | 2333 |
| 375 | Ga0207658_10518670 | 3300025986 | Bacteria | 1063 |
| 376 | Ga0207658_10692748 | 3300025986 | Bacteria | 920 |
| 377 | Ga0207677_10002860 | 3300026023 | Bacteria | 9108 |
| 378 | Ga0207677_10083870 | 3300026023 | Bacteria | 2295 |
| 379 | Ga0207677_10116784 | 3300026023 | Bacteria | 1998 |
| 380 | Ga0207677_10530586 | 3300026023 | Bacteria | 1022 |
| 381 | Ga0207677_10656019 | 3300026023 | Bacteria | 927 |
| 382 | Ga0207703_10001207 | 3300026035 | Bacteria | 24194 |
| 383 | Ga0207703_10005640 | 3300026035 | Bacteria | 10054 |
| 384 | Ga0207639_10025482 | 3300026041 | Bacteria | 4288 |
| 385 | Ga0207639_10050345 | 3300026041 | Bacteria | 3164 |
| 386 | Ga0207639_10065445 | 3300026041 | Bacteria | 2822 |
| 387 | Ga0207678_10000736 | 3300026067 | Bacteria | 29995 |
| 388 | Ga0207678_10016088 | 3300026067 | Bacteria | 6569 |
| 389 | Ga0207678_10036653 | 3300026067 | Bacteria | 4269 |
| 390 | Ga0207678_10042307 | 3300026067 | Bacteria | 3947 |
| 391 | Ga0207678_10043642 | 3300026067 | Bacteria | 3879 |
| 392 | Ga0207678_10056879 | 3300026067 | Bacteria | 3366 |
| 393 | Ga0207678_10212402 | 3300026067 | Bacteria | 1655 |
| 394 | Ga0207702_10126457 | 3300026078 | Bacteria | 2295 |
| 395 | Ga0207702_10519032 | 3300026078 | Bacteria | 1163 |
| 396 | Ga0207702_11083857 | 3300026078 | Bacteria | 795 |
| 397 | Ga0207641_10031630 | 3300026088 | Bacteria | 4389 |
| 398 | Ga0207641_10034319 | 3300026088 | Bacteria | 4219 |
| 399 | Ga0207641_10244443 | 3300026088 | Bacteria | 1673 |
| 400 | Ga0207641_10283640 | 3300026088 | Bacteria | 1559 |
| 401 | Ga0207648_10008511 | 3300026089 | Bacteria | 9928 |
| 402 | Ga0207648_10061172 | 3300026089 | Bacteria | 3283 |
| 403 | Ga0207648_10596361 | 3300026089 | Bacteria | 1018 |
| 404 | Ga0207676_10023980 | 3300026095 | Bacteria | 4510 |
| 405 | Ga0207676_10065074 | 3300026095 | Bacteria | 2902 |
| 406 | Ga0207676_10477093 | 3300026095 | Bacteria | 1181 |
| 407 | Ga0207674_10000583 | 3300026116 | Bacteria | 48003 |
| 408 | Ga0207674_10039372 | 3300026116 | Bacteria | 4901 |
| 409 | Ga0207674_10065319 | 3300026116 | Bacteria | 3668 |
| 410 | Ga0207674_10216030 | 3300026116 | Bacteria | 1866 |
| 411 | Ga0207675_100100832 | 3300026118 | Bacteria | 2720 |
| 412 | Ga0207683_10017280 | 3300026121 | Bacteria | 6145 |
| 413 | Ga0207683_10087425 | 3300026121 | Bacteria | 2772 |
| 414 | Ga0207683_10110127 | 3300026121 | Bacteria | 2465 |
| 415 | Ga0207698_10037814 | 3300026142 | Bacteria | 3559 |
| 416 | Ga0207698_10042377 | 3300026142 | Bacteria | 3400 |
| 417 | Ga0207698_10110137 | 3300026142 | Bacteria | 2306 |
| 418 | Ga0268266_10085752 | 3300028379 | Bacteria | 2752 |
| 419 | Ga0268266_10114263 | 3300028379 | Bacteria | 2395 |
| 420 | Ga0268266_10153667 | 3300028379 | Bacteria | 2077 |
| 421 | Ga0268266_10521968 | 3300028379 | Bacteria | 1136 |
| 422 | Ga0268265_10018027 | 3300028380 | Bacteria | 4886 |
| 423 | Ga0268264_10135838 | 3300028381 | Bacteria | 2186 |
| 424 | Ga0307408_100035753 | 3300031548 | Bacteria | 3487 |
| 425 | Ga0307408_100052533 | 3300031548 | Bacteria | 2940 |
| 426 | Ga0307408_100550798 | 3300031548 | Bacteria | 1018 |
| 427 | Ga0307405_10168794 | 3300031731 | Bacteria | 1558 |
| 428 | Ga0307410_10004840 | 3300031852 | Bacteria | 7036 |
| 429 | Ga0307410_10011482 | 3300031852 | Bacteria | 5068 |
| 430 | Ga0307406_10018687 | 3300031901 | Bacteria | 4054 |
| 431 | Ga0307407_10010399 | 3300031903 | Bacteria | 4387 |
| 432 | Ga0307412_10170072 | 3300031911 | Bacteria | 1628 |
| 433 | Ga0307409_100072213 | 3300031995 | Bacteria | 2747 |
| 434 | Ga0307409_100272655 | 3300031995 | Bacteria | 1559 |
| 435 | Ga0307416_100139496 | 3300032002 | Bacteria | 2200 |
| 436 | Ga0307414_10024096 | 3300032004 | Bacteria | 3874 |
| 437 | Ga0307414_10034829 | 3300032004 | Bacteria | 3343 |
| 438 | Ga0307411_10017265 | 3300032005 | Bacteria | 4106 |
| 439 | Ga0307411_10087640 | 3300032005 | Bacteria | 2162 |
| 440 | Ga0307415_100008636 | 3300032126 | Bacteria | 5659 |
| 441 | Ga0307415_100099351 | 3300032126 | Bacteria | 2130 |
| 442 | Ga0307415_100312367 | 3300032126 | Bacteria | 1307 |
| 443 | Ga0373934_0136267 | 3300035086 | Bacteria | 1003 |
| 444 | Ga0373940_0066734 | 3300035088 | Bacteria | 1040 |
| 445 | Ga0373923_0045261 | 3300035111 | Bacteria | 1827 |
| 446 | Ga0373954_0009159 | 3300035118 | Bacteria | 4356 |
| 447 | Ga0373956_0080332 | 3300035119 | Bacteria | 1496 |
| 448 | Ga0373957_0020711 | 3300035120 | Bacteria | 2327 |
| 449 | Ga0373943_0328259 | 3300035170 | Bacteria | 873 |
| 450 | Ga0373955_0096913 | 3300035172 | Bacteria | 1688 |
| 451 | Ga0373935_0003260 | 3300035692 | Bacteria | 9385 |
| 452 | Ga0373937_0038960 | 3300036401 | Bacteria | 4330 |
| 453 | Ga0395899_0000132 | 3300037312 | Bacteria | 115455 |
| 454 | Ga0395899_0011033 | 3300037312 | Bacteria | 6921 |
| 455 | Ga0395899_0120538 | 3300037312 | Bacteria | 1879 |
| 456 | Ga0395899_0121878 | 3300037312 | Bacteria | 1867 |
| 457 | Ga0395899_0155360 | 3300037312 | Bacteria | 1619 |
| 458 | Ga0395899_0158467 | 3300037312 | Bacteria | 1600 |
| 459 | Ga0395899_0163697 | 3300037312 | Bacteria | 1570 |
| 460 | Ga0395900_0000359 | 3300037418 | Bacteria | 66277 |
| 461 | Ga0395900_0004142 | 3300037418 | Bacteria | 15438 |
| 462 | Ga0395900_0043298 | 3300037418 | Bacteria | 4640 |
| 463 | Ga0395900_0046606 | 3300037418 | Bacteria | 4465 |
| 464 | Ga0395900_0089840 | 3300037418 | Bacteria | 3157 |
| 465 | Ga0395900_0104796 | 3300037418 | Bacteria | 2905 |
| 466 | Ga0395900_0126384 | 3300037418 | Bacteria | 2622 |
| 467 | Ga0395900_0127400 | 3300037418 | Bacteria | 2610 |
| 468 | Ga0395900_0231942 | 3300037418 | Bacteria | 1856 |
| 469 | Ga0395900_0488640 | 3300037418 | Bacteria | 1183 |
| 470 | Ga0395900_0543429 | 3300037418 | Bacteria | 1107 |
| 471 | Ga0395900_0616719 | 3300037418 | Bacteria | 1024 |
| 472 | Ga0395898_0010002 | 3300037466 | Bacteria | 9930 |
| 473 | Ga0395898_0135792 | 3300037466 | Bacteria | 2355 |
| 474 | Ga0395898_0158717 | 3300037466 | Bacteria | 2163 |
| 475 | Ga0395898_0319701 | 3300037466 | Bacteria | 1481 |
| 476 | Ga0395898_0365682 | 3300037466 | Bacteria | 1375 |
| 477 | Ga0395898_1016515 | 3300037466 | Bacteria | 764 |
| 478 | Ga0395905_0000946 | 3300037471 | Bacteria | 37278 |
| 479 | Ga0395905_0002968 | 3300037471 | Bacteria | 18443 |
| 480 | Ga0395905_0009091 | 3300037471 | Bacteria | 9741 |
| 481 | Ga0395905_0010496 | 3300037471 | Bacteria | 9008 |
| 482 | Ga0395905_0044358 | 3300037471 | Bacteria | 4173 |
| 483 | Ga0395905_0046644 | 3300037471 | Bacteria | 4063 |
| 484 | Ga0395905_0064484 | 3300037471 | Bacteria | 3428 |
| 485 | Ga0395905_0071803 | 3300037471 | Bacteria | 3245 |
| 486 | Ga0395905_0122316 | 3300037471 | Bacteria | 2447 |
| 487 | Ga0395905_0125456 | 3300037471 | Bacteria | 2414 |
| 488 | Ga0395905_0142992 | 3300037471 | Bacteria | 2250 |
| 489 | Ga0395905_0203853 | 3300037471 | Bacteria | 1854 |
| 490 | Ga0395905_0292748 | 3300037471 | Bacteria | 1515 |
| 491 | Ga0395905_0351975 | 3300037471 | Bacteria | 1365 |
| 492 | Ga0395905_0394374 | 3300037471 | Unclassified | 1279 |
| 493 | Ga0395905_0470426 | 3300037471 | Bacteria | 1156 |
| 494 | Ga0395905_0513028 | 3300037471 | Bacteria | 1099 |
| 495 | Ga0395905_0656709 | 3300037471 | Bacteria | 951 |
| 496 | Ga0395905_0709055 | 3300037471 | Bacteria | 908 |
| 497 | Ga0395905_0929650 | 3300037471 | Bacteria | 773 |
| 498 | Ga0395901_0000897 | 3300038443 | Bacteria | 32720 |
| 499 | Ga0395901_0021404 | 3300038443 | Bacteria | 6625 |
| 500 | Ga0395901_0045698 | 3300038443 | Bacteria | 4546 |
| 501 | Ga0395901_0108982 | 3300038443 | Bacteria | 2907 |
| 502 | Ga0395901_0176279 | 3300038443 | Bacteria | 2242 |
| 503 | Ga0395901_0363682 | 3300038443 | Bacteria | 1491 |
| 504 | Ga0439433_0109678 | 3300041999 | Bacteria | 690 |
| 505 | Ga0439445_0015299 | 3300042004 | Bacteria | 1877 |
| 506 | Ga0439432_031221 | 3300042006 | Bacteria | 1724 |
| 507 | Ga0439449_0043738 | 3300042007 | Bacteria | 1662 |
| 508 | Ga0439458_0017996 | 3300042157 | Bacteria | 1616 |
| 509 | Ga0466966_0000059 | 3300044684 | Bacteria | 80975 |
| 510 | Ga0466961_0128828 | 3300044693 | Bacteria | 1586 |
| 511 | Ga0466961_0337016 | 3300044693 | Bacteria | 919 |
| 512 | Ga0466963_0022845 | 3300044694 | Bacteria | 3965 |
| 513 | Ga0466963_0032583 | 3300044694 | Bacteria | 3376 |
| 514 | Ga0466964_0039545 | 3300044706 | Bacteria | 1901 |
| 515 | Ga0466970_0168005 | 3300044765 | Bacteria | 1215 |
| 516 | Ga0466959_0662865 | 3300045049 | Bacteria | 700 |
| 517 | Ga0466958_0342071 | 3300045836 | Bacteria | 962 |
| 518 | Ga0466958_0371273 | 3300045836 | Bacteria | 922 |
| 519 | Ga0466967_0015403 | 3300045976 | Bacteria | 5991 |
| 520 | Ga0466967_0061806 | 3300045976 | Bacteria | 3324 |
| 521 | Ga0466967_0066838 | 3300045976 | Bacteria | 3204 |
| 522 | Ga0466967_0069417 | 3300045976 | Bacteria | 3149 |
| 523 | Ga0466967_0071591 | 3300045976 | Bacteria | 3105 |
| 524 | Ga0466967_0118690 | 3300045976 | Bacteria | 2440 |
| 525 | Ga0466967_0153381 | 3300045976 | Bacteria | 2155 |
| 526 | Ga0466967_0174524 | 3300045976 | Bacteria | 2024 |
| 527 | Ga0466967_0250014 | 3300045976 | Bacteria | 1693 |
| 528 | Ga0466967_0324667 | 3300045976 | Bacteria | 1485 |
| 529 | Ga0466967_0794828 | 3300045976 | Bacteria | 939 |
| 530 | Ga0466967_1321520 | 3300045976 | Bacteria | 718 |
| 531 | Ga0495582_0127107 | 3300046473 | Bacteria | 1439 |
| 532 | Ga0495620_0083492 | 3300046515 | Bacteria | 1289 |
| 533 | Ga0495663_0025509 | 3300046525 | Bacteria | 1724 |
| 534 | Ga0495642_0034021 | 3300046528 | Bacteria | 2051 |
| 535 | Ga0495598_0000477 | 3300046537 | Bacteria | 7347 |
| 536 | Ga0495633_0203131 | 3300046558 | Bacteria | 909 |
| 537 | Ga0495656_0212138 | 3300046615 | Bacteria | 965 |
| 538 | Ga0495668_0038047 | 3300046616 | Bacteria | 2690 |
| 539 | Ga0495659_0185205 | 3300046664 | Bacteria | 849 |
| 540 | Ga0495669_0000249 | 3300046684 | Bacteria | 31437 |
| 541 | Ga0495669_0001045 | 3300046684 | Bacteria | 11523 |
| 542 | Ga0495669_0007911 | 3300046684 | Bacteria | 4464 |
| 543 | Ga0495669_0054776 | 3300046684 | Bacteria | 1796 |
| 544 | Ga0495669_0154681 | 3300046684 | Bacteria | 1087 |
| 545 | Ga0495669_0177269 | 3300046684 | Bacteria | 1015 |
| 546 | Ga0495670_0002609 | 3300046691 | Bacteria | 8900 |
| 547 | Ga0495602_0085923 | 3300048088 | Bacteria | 2627 |
| 548 | Ga0496101_0166436 | 3300048904 | Bacteria | 1693 |
| 549 | Ga0496102_0032003 | 3300048905 | Bacteria | 4723 |
| 550 | Ga0496102_0115104 | 3300048905 | Bacteria | 2509 |
| 551 | Ga0496102_0240646 | 3300048905 | Bacteria | 1706 |
| 552 | Ga0496103_0097744 | 3300048906 | Bacteria | 1856 |
| 553 | Ga0496104_0270368 | 3300048907 | Bacteria | 1612 |
| 554 | Ga0496106_0246613 | 3300048909 | Bacteria | 1427 |
| 555 | Ga0496106_0253236 | 3300048909 | Bacteria | 1408 |
| 556 | Ga0496107_0016436 | 3300048910 | Bacteria | 5197 |
| 557 | Ga0496107_0111752 | 3300048910 | Bacteria | 2008 |
| 558 | Ga0496108_0000498 | 3300048911 | Bacteria | 31214 |
| 559 | Ga0496108_0018570 | 3300048911 | Bacteria | 5695 |
| 560 | Ga0496109_0012910 | 3300048912 | Bacteria | 7222 |
| 561 | Ga0496110_0000806 | 3300048913 | Bacteria | 21970 |
| 562 | Ga0496110_0123075 | 3300048913 | Bacteria | 2339 |
| 563 | Ga0496110_0223234 | 3300048913 | Bacteria | 1713 |
| 564 | Ga0496111_0003369 | 3300048914 | Bacteria | 9880 |
| 565 | Ga0496111_0161866 | 3300048914 | Bacteria | 1662 |
| 566 | Ga0496111_0631757 | 3300048914 | Bacteria | 782 |
| 567 | Ga0496111_0648273 | 3300048914 | Bacteria | 770 |
| 568 | Ga0496112_0018938 | 3300048915 | Bacteria | 6487 |
| 569 | Ga0496112_0365822 | 3300048915 | Bacteria | 1384 |
| 570 | Ga0496112_0392815 | 3300048915 | Bacteria | 1327 |
| 571 | Ga0496113_0004483 | 3300048916 | Bacteria | 8593 |
| 572 | Ga0496113_0197128 | 3300048916 | Bacteria | 1600 |
| 573 | Ga0496113_0322089 | 3300048916 | Bacteria | 1239 |
| 574 | Ga0496114_0118518 | 3300048917 | Bacteria | 2274 |
| 575 | Ga0496114_0646602 | 3300048917 | Bacteria | 930 |
| 576 | Ga0496115_0021804 | 3300048918 | Bacteria | 4952 |
| 577 | Ga0501067_0054019 | 3300049583 | Bacteria | 2226 |
| 578 | Ga0501223_052616 | 3300049663 | Bacteria | 791 |
| 579 | Ga0501249_033123 | 3300049679 | Bacteria | 1157 |
| 580 | Ga0501257_023306 | 3300049686 | Bacteria | 1468 |
| 581 | Ga0501221_035086 | 3300049704 | Bacteria | 1068 |
| 582 | Ga0501225_0042962 | 3300049705 | Bacteria | 1249 |
| 583 | Ga0501268_000371 | 3300049765 | Bacteria | 4738 |
| 584 | Ga0501268_036816 | 3300049765 | Bacteria | 907 |
| 585 | Ga0501283_013110 | 3300049779 | Bacteria | 1253 |
| 586 | nmdc:mga0n895_458030_c1 | 3300050512 | Bacteria | 1287 |
| 587 | nmdc:mga0rr50_116467_c1 | 3300050513 | Bacteria | 2121 |
| 588 | nmdc:mga0a205_11551_c1 | 3300050515 | Bacteria | 8136 |
| 589 | Ga0495612_0121835 | 3300053078 | Bacteria | 1122 |
| 590 | Ga0466962_0171742 | 3300061719 | Bacteria | 1056 |
| 591 | Ga0466962_0199004 | 3300061719 | Bacteria | 979 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041999 | Ga0439433_0109678 | Ga0439433_0109678_34_561 | 175 |
| 2 | 3300046664 | Ga0495659_0185205 | Ga0495659_0185205_263_808 | 181 |
| 3 | 3300061719 | Ga0466962_0171742 | Ga0466962_0171742_501_1046 | 181 |
| 4 | 3300046473 | Ga0495582_0127107 | Ga0495582_0127107_23_598 | 191 |
| 5 | 3300037418 | Ga0395900_0126384 | Ga0395900_0126384_452_1069 | 193 |
| 6 | 3300038443 | Ga0395901_0176279 | Ga0395901_0176279_709_1326 | 193 |
| 7 | 3300046515 | Ga0495620_0083492 | Ga0495620_0083492_371_967 | 198 |
| 8 | 3300001979 | JGI24740J21852_10030783 | JGI24740J21852_100307832 | 205 |
| 9 | 3300001979 | JGI24740J21852_10037395 | JGI24740J21852_100373952 | 205 |
| 10 | 3300001989 | JGI24739J22299_10049822 | JGI24739J22299_100498222 | 205 |
| 11 | 3300002077 | JGI24744J21845_10000623 | JGI24744J21845_100006236 | 205 |
| 12 | 3300003203 | JGI25406J46586_10047432 | JGI25406J46586_100474322 | 205 |
| 13 | 3300005290 | Ga0065712_10107291 | Ga0065712_101072911 | 205 |
| 14 | 3300005327 | Ga0070658_10001359 | Ga0070658_1000135919 | 205 |
| 15 | 3300005327 | Ga0070658_10011801 | Ga0070658_1001180111 | 205 |
| 16 | 3300005327 | Ga0070658_10035301 | Ga0070658_100353016 | 205 |
| 17 | 3300005327 | Ga0070658_10133812 | Ga0070658_101338122 | 205 |
| 18 | 3300005327 | Ga0070658_10219490 | Ga0070658_102194902 | 205 |
| 19 | 3300005327 | Ga0070658_10586394 | Ga0070658_105863942 | 205 |
| 20 | 3300005328 | Ga0070676_10083076 | Ga0070676_100830762 | 205 |
| 21 | 3300005329 | Ga0070683_100029406 | Ga0070683_1000294064 | 205 |
| 22 | 3300005330 | Ga0070690_100006574 | Ga0070690_1000065744 | 205 |
| 23 | 3300005330 | Ga0070690_100244072 | Ga0070690_1002440722 | 205 |
| 24 | 3300005331 | Ga0070670_100001791 | Ga0070670_10000179111 | 205 |
| 25 | 3300005331 | Ga0070670_100092640 | Ga0070670_1000926403 | 205 |
| 26 | 3300005333 | Ga0070677_10058376 | Ga0070677_100583762 | 205 |
| 27 | 3300005334 | Ga0068869_100041710 | Ga0068869_1000417106 | 205 |
| 28 | 3300005334 | Ga0068869_100119827 | Ga0068869_1001198272 | 205 |
| 29 | 3300005335 | Ga0070666_10001341 | Ga0070666_1000134114 | 205 |
| 30 | 3300005335 | Ga0070666_10007313 | Ga0070666_100073132 | 205 |
| 31 | 3300005335 | Ga0070666_10058269 | Ga0070666_100582692 | 205 |
| 32 | 3300005335 | Ga0070666_10279869 | Ga0070666_102798692 | 205 |
| 33 | 3300005335 | Ga0070666_10292425 | Ga0070666_102924252 | 205 |
| 34 | 3300005336 | Ga0070680_100043881 | Ga0070680_1000438815 | 205 |
| 35 | 3300005336 | Ga0070680_100121337 | Ga0070680_1001213372 | 205 |
| 36 | 3300005337 | Ga0070682_100101917 | Ga0070682_1001019172 | 205 |
| 37 | 3300005338 | Ga0068868_100000579 | Ga0068868_1000005795 | 205 |
| 38 | 3300005338 | Ga0068868_100255635 | Ga0068868_1002556352 | 205 |
| 39 | 3300005338 | Ga0068868_100320535 | Ga0068868_1003205352 | 205 |
| 40 | 3300005338 | Ga0068868_100814294 | Ga0068868_1008142941 | 205 |
| 41 | 3300005339 | Ga0070660_100028807 | Ga0070660_1000288072 | 205 |
| 42 | 3300005339 | Ga0070660_100034505 | Ga0070660_1000345056 | 205 |
| 43 | 3300005339 | Ga0070660_100047884 | Ga0070660_1000478843 | 205 |
| 44 | 3300005339 | Ga0070660_100077102 | Ga0070660_1000771022 | 205 |
| 45 | 3300005339 | Ga0070660_100094735 | Ga0070660_1000947353 | 205 |
| 46 | 3300005339 | Ga0070660_100124472 | Ga0070660_1001244723 | 205 |
| 47 | 3300005340 | Ga0070689_100085464 | Ga0070689_1000854642 | 205 |
| 48 | 3300005344 | Ga0070661_100002170 | Ga0070661_10000217016 | 205 |
| 49 | 3300005344 | Ga0070661_100046713 | Ga0070661_1000467132 | 205 |
| 50 | 3300005344 | Ga0070661_100120580 | Ga0070661_1001205802 | 205 |
| 51 | 3300005344 | Ga0070661_100147671 | Ga0070661_1001476712 | 205 |
| 52 | 3300005344 | Ga0070661_100319443 | Ga0070661_1003194432 | 205 |
| 53 | 3300005344 | Ga0070661_100381395 | Ga0070661_1003813952 | 205 |
| 54 | 3300005344 | Ga0070661_100619919 | Ga0070661_1006199192 | 205 |
| 55 | 3300005344 | Ga0070661_100674095 | Ga0070661_1006740952 | 205 |
| 56 | 3300005345 | Ga0070692_10010852 | Ga0070692_100108525 | 205 |
| 57 | 3300005347 | Ga0070668_100378192 | Ga0070668_1003781922 | 205 |
| 58 | 3300005353 | Ga0070669_100034164 | Ga0070669_1000341642 | 205 |
| 59 | 3300005353 | Ga0070669_100102101 | Ga0070669_1001021013 | 205 |
| 60 | 3300005353 | Ga0070669_100144484 | Ga0070669_1001444841 | 205 |
| 61 | 3300005354 | Ga0070675_100011209 | Ga0070675_10001120910 | 205 |
| 62 | 3300005354 | Ga0070675_100011801 | Ga0070675_10001180111 | 205 |
| 63 | 3300005354 | Ga0070675_100089381 | Ga0070675_1000893813 | 205 |
| 64 | 3300005354 | Ga0070675_100288631 | Ga0070675_1002886312 | 205 |
| 65 | 3300005355 | Ga0070671_100000987 | Ga0070671_10000098722 | 205 |
| 66 | 3300005355 | Ga0070671_100009923 | Ga0070671_1000099236 | 205 |
| 67 | 3300005355 | Ga0070671_100014278 | Ga0070671_1000142788 | 205 |
| 68 | 3300005355 | Ga0070671_100055553 | Ga0070671_1000555536 | 205 |
| 69 | 3300005355 | Ga0070671_100066553 | Ga0070671_1000665532 | 205 |
| 70 | 3300005356 | Ga0070674_100005831 | Ga0070674_10000583111 | 205 |
| 71 | 3300005356 | Ga0070674_100047256 | Ga0070674_1000472562 | 205 |
| 72 | 3300005356 | Ga0070674_100054790 | Ga0070674_1000547904 | 205 |
| 73 | 3300005356 | Ga0070674_100121824 | Ga0070674_1001218242 | 205 |
| 74 | 3300005356 | Ga0070674_100736168 | Ga0070674_1007361681 | 205 |
| 75 | 3300005364 | Ga0070673_100023161 | Ga0070673_1000231614 | 205 |
| 76 | 3300005364 | Ga0070673_100089514 | Ga0070673_1000895142 | 205 |
| 77 | 3300005364 | Ga0070673_100300719 | Ga0070673_1003007192 | 205 |
| 78 | 3300005364 | Ga0070673_100428911 | Ga0070673_1004289112 | 205 |
| 79 | 3300005364 | Ga0070673_100476825 | Ga0070673_1004768251 | 205 |
| 80 | 3300005364 | Ga0070673_100525821 | Ga0070673_1005258212 | 205 |
| 81 | 3300005364 | Ga0070673_101096028 | Ga0070673_1010960281 | 205 |
| 82 | 3300005366 | Ga0070659_100003994 | Ga0070659_10000399411 | 205 |
| 83 | 3300005366 | Ga0070659_100007475 | Ga0070659_1000074756 | 205 |
| 84 | 3300005366 | Ga0070659_100011740 | Ga0070659_1000117405 | 205 |
| 85 | 3300005366 | Ga0070659_100110851 | Ga0070659_1001108512 | 205 |
| 86 | 3300005366 | Ga0070659_100160043 | Ga0070659_1001600432 | 205 |
| 87 | 3300005366 | Ga0070659_100227514 | Ga0070659_1002275142 | 205 |
| 88 | 3300005366 | Ga0070659_100401450 | Ga0070659_1004014502 | 205 |
| 89 | 3300005366 | Ga0070659_100414569 | Ga0070659_1004145692 | 205 |
| 90 | 3300005367 | Ga0070667_100000512 | Ga0070667_10000051215 | 205 |
| 91 | 3300005367 | Ga0070667_100019694 | Ga0070667_1000196946 | 205 |
| 92 | 3300005367 | Ga0070667_100026508 | Ga0070667_1000265082 | 205 |
| 93 | 3300005367 | Ga0070667_100047027 | Ga0070667_1000470272 | 205 |
| 94 | 3300005367 | Ga0070667_100146063 | Ga0070667_1001460632 | 205 |
| 95 | 3300005367 | Ga0070667_100149555 | Ga0070667_1001495552 | 205 |
| 96 | 3300005367 | Ga0070667_100364356 | Ga0070667_1003643562 | 205 |
| 97 | 3300005435 | Ga0070714_100017393 | Ga0070714_1000173934 | 205 |
| 98 | 3300005435 | Ga0070714_100069392 | Ga0070714_1000693925 | 205 |
| 99 | 3300005436 | Ga0070713_100186577 | Ga0070713_1001865772 | 205 |
| 100 | 3300005455 | Ga0070663_100004988 | Ga0070663_10000498811 | 205 |
| 101 | 3300005455 | Ga0070663_100086691 | Ga0070663_1000866912 | 205 |
| 102 | 3300005455 | Ga0070663_100178975 | Ga0070663_1001789752 | 205 |
| 103 | 3300005455 | Ga0070663_100229210 | Ga0070663_1002292102 | 205 |
| 104 | 3300005455 | Ga0070663_100638161 | Ga0070663_1006381611 | 205 |
| 105 | 3300005456 | Ga0070678_100021616 | Ga0070678_1000216162 | 205 |
| 106 | 3300005456 | Ga0070678_100076038 | Ga0070678_1000760382 | 205 |
| 107 | 3300005456 | Ga0070678_100155206 | Ga0070678_1001552062 | 205 |
| 108 | 3300005457 | Ga0070662_100034078 | Ga0070662_1000340783 | 205 |
| 109 | 3300005457 | Ga0070662_100056350 | Ga0070662_1000563503 | 205 |
| 110 | 3300005457 | Ga0070662_100071034 | Ga0070662_1000710342 | 205 |
| 111 | 3300005457 | Ga0070662_100094798 | Ga0070662_1000947982 | 205 |
| 112 | 3300005457 | Ga0070662_100228214 | Ga0070662_1002282142 | 205 |
| 113 | 3300005457 | Ga0070662_100317061 | Ga0070662_1003170612 | 205 |
| 114 | 3300005458 | Ga0070681_10070301 | Ga0070681_100703012 | 205 |
| 115 | 3300005458 | Ga0070681_10126037 | Ga0070681_101260373 | 205 |
| 116 | 3300005458 | Ga0070681_10368110 | Ga0070681_103681102 | 205 |
| 117 | 3300005459 | Ga0068867_100039243 | Ga0068867_1000392435 | 205 |
| 118 | 3300005459 | Ga0068867_100079413 | Ga0068867_1000794132 | 205 |
| 119 | 3300005459 | Ga0068867_100721249 | Ga0068867_1007212491 | 205 |
| 120 | 3300005530 | Ga0070679_100077233 | Ga0070679_1000772333 | 205 |
| 121 | 3300005530 | Ga0070679_100112719 | Ga0070679_1001127192 | 205 |
| 122 | 3300005530 | Ga0070679_100541676 | Ga0070679_1005416761 | 205 |
| 123 | 3300005530 | Ga0070679_100824951 | Ga0070679_1008249512 | 205 |
| 124 | 3300005539 | Ga0068853_100017118 | Ga0068853_1000171187 | 205 |
| 125 | 3300005539 | Ga0068853_100065515 | Ga0068853_1000655153 | 205 |
| 126 | 3300005539 | Ga0068853_100224456 | Ga0068853_1002244562 | 205 |
| 127 | 3300005539 | Ga0068853_100363764 | Ga0068853_1003637642 | 205 |
| 128 | 3300005539 | Ga0068853_100802408 | Ga0068853_1008024082 | 205 |
| 129 | 3300005543 | Ga0070672_100010538 | Ga0070672_1000105385 | 205 |
| 130 | 3300005543 | Ga0070672_100011841 | Ga0070672_1000118416 | 205 |
| 131 | 3300005543 | Ga0070672_100073288 | Ga0070672_1000732881 | 205 |
| 132 | 3300005543 | Ga0070672_100162199 | Ga0070672_1001621992 | 205 |
| 133 | 3300005547 | Ga0070693_100037272 | Ga0070693_1000372724 | 205 |
| 134 | 3300005548 | Ga0070665_100012566 | Ga0070665_1000125667 | 205 |
| 135 | 3300005548 | Ga0070665_100055960 | Ga0070665_1000559603 | 205 |
| 136 | 3300005548 | Ga0070665_100113092 | Ga0070665_1001130922 | 205 |
| 137 | 3300005548 | Ga0070665_100281383 | Ga0070665_1002813832 | 205 |
| 138 | 3300005548 | Ga0070665_100901726 | Ga0070665_1009017262 | 205 |
| 139 | 3300005563 | Ga0068855_100021387 | Ga0068855_1000213876 | 205 |
| 140 | 3300005563 | Ga0068855_100654929 | Ga0068855_1006549292 | 205 |
| 141 | 3300005564 | Ga0070664_100002681 | Ga0070664_10000268110 | 205 |
| 142 | 3300005564 | Ga0070664_100008006 | Ga0070664_1000080069 | 205 |
| 143 | 3300005564 | Ga0070664_100009014 | Ga0070664_1000090144 | 205 |
| 144 | 3300005564 | Ga0070664_100028888 | Ga0070664_1000288887 | 205 |
| 145 | 3300005564 | Ga0070664_100264631 | Ga0070664_1002646312 | 205 |
| 146 | 3300005564 | Ga0070664_100344210 | Ga0070664_1003442102 | 205 |
| 147 | 3300005564 | Ga0070664_100531328 | Ga0070664_1005313282 | 205 |
| 148 | 3300005577 | Ga0068857_100212059 | Ga0068857_1002120592 | 205 |
| 149 | 3300005577 | Ga0068857_100275304 | Ga0068857_1002753042 | 205 |
| 150 | 3300005577 | Ga0068857_100298793 | Ga0068857_1002987932 | 205 |
| 151 | 3300005578 | Ga0068854_100060204 | Ga0068854_1000602043 | 205 |
| 152 | 3300005578 | Ga0068854_100081363 | Ga0068854_1000813634 | 205 |
| 153 | 3300005614 | Ga0068856_100064237 | Ga0068856_1000642372 | 205 |
| 154 | 3300005614 | Ga0068856_100114959 | Ga0068856_1001149592 | 205 |
| 155 | 3300005614 | Ga0068856_100606574 | Ga0068856_1006065742 | 205 |
| 156 | 3300005614 | Ga0068856_100785655 | Ga0068856_1007856552 | 205 |
| 157 | 3300005616 | Ga0068852_100017235 | Ga0068852_1000172357 | 205 |
| 158 | 3300005616 | Ga0068852_100035280 | Ga0068852_1000352803 | 205 |
| 159 | 3300005616 | Ga0068852_100057228 | Ga0068852_1000572286 | 205 |
| 160 | 3300005616 | Ga0068852_100108013 | Ga0068852_1001080133 | 205 |
| 161 | 3300005616 | Ga0068852_100133613 | Ga0068852_1001336133 | 205 |
| 162 | 3300005616 | Ga0068852_100564067 | Ga0068852_1005640672 | 205 |
| 163 | 3300005617 | Ga0068859_100019836 | Ga0068859_1000198368 | 205 |
| 164 | 3300005617 | Ga0068859_100038438 | Ga0068859_1000384386 | 205 |
| 165 | 3300005617 | Ga0068859_100125473 | Ga0068859_1001254732 | 205 |
| 166 | 3300005617 | Ga0068859_101079533 | Ga0068859_1010795332 | 205 |
| 167 | 3300005618 | Ga0068864_100081724 | Ga0068864_1000817244 | 205 |
| 168 | 3300005718 | Ga0068866_10007967 | Ga0068866_100079672 | 205 |
| 169 | 3300005718 | Ga0068866_10012838 | Ga0068866_100128384 | 205 |
| 170 | 3300005834 | Ga0068851_10000795 | Ga0068851_1000079512 | 205 |
| 171 | 3300005834 | Ga0068851_10068072 | Ga0068851_100680722 | 205 |
| 172 | 3300005840 | Ga0068870_10083508 | Ga0068870_100835082 | 205 |
| 173 | 3300005841 | Ga0068863_100047687 | Ga0068863_1000476872 | 205 |
| 174 | 3300005841 | Ga0068863_100062024 | Ga0068863_1000620245 | 205 |
| 175 | 3300005841 | Ga0068863_100063432 | Ga0068863_1000634322 | 205 |
| 176 | 3300005841 | Ga0068863_100070449 | Ga0068863_1000704492 | 205 |
| 177 | 3300005842 | Ga0068858_100000855 | Ga0068858_1000008558 | 205 |
| 178 | 3300005842 | Ga0068858_100046354 | Ga0068858_1000463542 | 205 |
| 179 | 3300005842 | Ga0068858_100058218 | Ga0068858_1000582184 | 205 |
| 180 | 3300005842 | Ga0068858_100156188 | Ga0068858_1001561882 | 205 |
| 181 | 3300005842 | Ga0068858_100338981 | Ga0068858_1003389812 | 205 |
| 182 | 3300005843 | Ga0068860_100133013 | Ga0068860_1001330132 | 205 |
| 183 | 3300005843 | Ga0068860_100294085 | Ga0068860_1002940852 | 205 |
| 184 | 3300005844 | Ga0068862_100576318 | Ga0068862_1005763181 | 205 |
| 185 | 3300005844 | Ga0068862_101310948 | Ga0068862_1013109482 | 205 |
| 186 | 3300005985 | Ga0081539_10010258 | Ga0081539_100102586 | 205 |
| 187 | 3300006051 | Ga0075364_10290261 | Ga0075364_102902612 | 205 |
| 188 | 3300006173 | Ga0070716_100031705 | Ga0070716_1000317052 | 205 |
| 189 | 3300006175 | Ga0070712_100146222 | Ga0070712_1001462222 | 205 |
| 190 | 3300006237 | Ga0097621_100478316 | Ga0097621_1004783161 | 205 |
| 191 | 3300006358 | Ga0068871_100293400 | Ga0068871_1002934002 | 205 |
| 192 | 3300006852 | Ga0075433_10002953 | Ga0075433_1000295310 | 205 |
| 193 | 3300006881 | Ga0068865_100146761 | Ga0068865_1001467612 | 205 |
| 194 | 3300006931 | Ga0097620_100019837 | Ga0097620_1000198378 | 205 |
| 195 | 3300006931 | Ga0097620_100038439 | Ga0097620_1000384396 | 205 |
| 196 | 3300006931 | Ga0097620_100125476 | Ga0097620_1001254762 | 205 |
| 197 | 3300006931 | Ga0097620_101079604 | Ga0097620_1010796042 | 205 |
| 198 | 3300007076 | Ga0075435_100186166 | Ga0075435_1001861662 | 205 |
| 199 | 3300009098 | Ga0105245_10080047 | Ga0105245_100800472 | 205 |
| 200 | 3300009098 | Ga0105245_10116186 | Ga0105245_101161864 | 205 |
| 201 | 3300009098 | Ga0105245_10273180 | Ga0105245_102731802 | 205 |
| 202 | 3300009148 | Ga0105243_10105116 | Ga0105243_101051162 | 205 |
| 203 | 3300009174 | Ga0105241_10055738 | Ga0105241_100557385 | 205 |
| 204 | 3300009174 | Ga0105241_10092158 | Ga0105241_100921582 | 205 |
| 205 | 3300009176 | Ga0105242_10056605 | Ga0105242_100566053 | 205 |
| 206 | 3300009176 | Ga0105242_10521544 | Ga0105242_105215442 | 205 |
| 207 | 3300009177 | Ga0105248_10001030 | Ga0105248_1000103030 | 205 |
| 208 | 3300009177 | Ga0105248_10006248 | Ga0105248_1000624814 | 205 |
| 209 | 3300009177 | Ga0105248_10030185 | Ga0105248_100301856 | 205 |
| 210 | 3300009177 | Ga0105248_10111708 | Ga0105248_101117082 | 205 |
| 211 | 3300009177 | Ga0105248_10178177 | Ga0105248_101781772 | 205 |
| 212 | 3300009545 | Ga0105237_10029775 | Ga0105237_100297755 | 205 |
| 213 | 3300009545 | Ga0105237_10302677 | Ga0105237_103026772 | 205 |
| 214 | 3300009551 | Ga0105238_10013165 | Ga0105238_100131655 | 205 |
| 215 | 3300009551 | Ga0105238_10172508 | Ga0105238_101725082 | 205 |
| 216 | 3300009551 | Ga0105238_10438681 | Ga0105238_104386812 | 205 |
| 217 | 3300009553 | Ga0105249_10241890 | Ga0105249_102418902 | 205 |
| 218 | 3300010375 | Ga0105239_10258983 | Ga0105239_102589832 | 205 |
| 219 | 3300011119 | Ga0105246_10051840 | Ga0105246_100518402 | 205 |
| 220 | 3300011119 | Ga0105246_10935520 | Ga0105246_109355201 | 205 |
| 221 | 3300013100 | Ga0157373_10020929 | Ga0157373_100209295 | 205 |
| 222 | 3300013100 | Ga0157373_10024749 | Ga0157373_100247493 | 205 |
| 223 | 3300013100 | Ga0157373_10200876 | Ga0157373_102008762 | 205 |
| 224 | 3300013100 | Ga0157373_10285966 | Ga0157373_102859662 | 205 |
| 225 | 3300013102 | Ga0157371_10100090 | Ga0157371_101000902 | 205 |
| 226 | 3300013102 | Ga0157371_10123037 | Ga0157371_101230372 | 205 |
| 227 | 3300013104 | Ga0157370_10213768 | Ga0157370_102137682 | 205 |
| 228 | 3300013104 | Ga0157370_10237342 | Ga0157370_102373422 | 205 |
| 229 | 3300013105 | Ga0157369_10002175 | Ga0157369_100021756 | 205 |
| 230 | 3300013105 | Ga0157369_10002814 | Ga0157369_100028149 | 205 |
| 231 | 3300013105 | Ga0157369_10128744 | Ga0157369_101287444 | 205 |
| 232 | 3300013105 | Ga0157369_10933751 | Ga0157369_109337512 | 205 |
| 233 | 3300013296 | Ga0157374_10044797 | Ga0157374_100447975 | 205 |
| 234 | 3300013296 | Ga0157374_10368316 | Ga0157374_103683162 | 205 |
| 235 | 3300013296 | Ga0157374_10759774 | Ga0157374_107597742 | 205 |
| 236 | 3300013297 | Ga0157378_10007917 | Ga0157378_100079178 | 205 |
| 237 | 3300013297 | Ga0157378_10852806 | Ga0157378_108528062 | 205 |
| 238 | 3300013306 | Ga0163162_10026291 | Ga0163162_100262915 | 205 |
| 239 | 3300013307 | Ga0157372_10499115 | Ga0157372_104991152 | 205 |
| 240 | 3300013307 | Ga0157372_11000107 | Ga0157372_110001072 | 205 |
| 241 | 3300013308 | Ga0157375_10006437 | Ga0157375_100064373 | 205 |
| 242 | 3300013308 | Ga0157375_10025418 | Ga0157375_100254187 | 205 |
| 243 | 3300013308 | Ga0157375_10294825 | Ga0157375_102948252 | 205 |
| 244 | 3300013308 | Ga0157375_10476264 | Ga0157375_104762642 | 205 |
| 245 | 3300014325 | Ga0163163_10623592 | Ga0163163_106235922 | 205 |
| 246 | 3300014497 | Ga0182008_10019125 | Ga0182008_100191252 | 205 |
| 247 | 3300014745 | Ga0157377_10117034 | Ga0157377_101170342 | 205 |
| 248 | 3300014968 | Ga0157379_10004998 | Ga0157379_100049986 | 205 |
| 249 | 3300014968 | Ga0157379_10097627 | Ga0157379_100976274 | 205 |
| 250 | 3300025315 | Ga0207697_10010718 | Ga0207697_100107182 | 205 |
| 251 | 3300025315 | Ga0207697_10024570 | Ga0207697_100245702 | 205 |
| 252 | 3300025899 | Ga0207642_10009906 | Ga0207642_100099063 | 205 |
| 253 | 3300025899 | Ga0207642_10119734 | Ga0207642_101197342 | 205 |
| 254 | 3300025901 | Ga0207688_10011227 | Ga0207688_100112277 | 205 |
| 255 | 3300025901 | Ga0207688_10301164 | Ga0207688_103011642 | 205 |
| 256 | 3300025901 | Ga0207688_10442566 | Ga0207688_104425661 | 205 |
| 257 | 3300025903 | Ga0207680_10000274 | Ga0207680_1000027411 | 205 |
| 258 | 3300025903 | Ga0207680_10009481 | Ga0207680_100094813 | 205 |
| 259 | 3300025903 | Ga0207680_10043671 | Ga0207680_100436712 | 205 |
| 260 | 3300025903 | Ga0207680_10198298 | Ga0207680_101982982 | 205 |
| 261 | 3300025903 | Ga0207680_10290508 | Ga0207680_102905082 | 205 |
| 262 | 3300025904 | Ga0207647_10000786 | Ga0207647_1000078625 | 205 |
| 263 | 3300025904 | Ga0207647_10038047 | Ga0207647_100380475 | 205 |
| 264 | 3300025906 | Ga0207699_10188303 | Ga0207699_101883032 | 205 |
| 265 | 3300025907 | Ga0207645_10031446 | Ga0207645_100314462 | 205 |
| 266 | 3300025907 | Ga0207645_10060266 | Ga0207645_100602662 | 205 |
| 267 | 3300025907 | Ga0207645_10358826 | Ga0207645_103588262 | 205 |
| 268 | 3300025908 | Ga0207643_10097532 | Ga0207643_100975322 | 205 |
| 269 | 3300025909 | Ga0207705_10003585 | Ga0207705_1000358512 | 205 |
| 270 | 3300025909 | Ga0207705_10004261 | Ga0207705_100042613 | 205 |
| 271 | 3300025909 | Ga0207705_10009376 | Ga0207705_100093762 | 205 |
| 272 | 3300025909 | Ga0207705_10042224 | Ga0207705_100422242 | 205 |
| 273 | 3300025909 | Ga0207705_10050546 | Ga0207705_100505464 | 205 |
| 274 | 3300025909 | Ga0207705_10126458 | Ga0207705_101264581 | 205 |
| 275 | 3300025909 | Ga0207705_10399716 | Ga0207705_103997161 | 205 |
| 276 | 3300025911 | Ga0207654_10425804 | Ga0207654_104258042 | 205 |
| 277 | 3300025912 | Ga0207707_10079318 | Ga0207707_100793183 | 205 |
| 278 | 3300025912 | Ga0207707_10590811 | Ga0207707_105908112 | 205 |
| 279 | 3300025915 | Ga0207693_10057403 | Ga0207693_100574033 | 205 |
| 280 | 3300025917 | Ga0207660_10088028 | Ga0207660_100880282 | 205 |
| 281 | 3300025917 | Ga0207660_10900112 | Ga0207660_109001121 | 205 |
| 282 | 3300025919 | Ga0207657_10001891 | Ga0207657_100018916 | 205 |
| 283 | 3300025919 | Ga0207657_10013795 | Ga0207657_100137955 | 205 |
| 284 | 3300025919 | Ga0207657_10018695 | Ga0207657_100186954 | 205 |
| 285 | 3300025919 | Ga0207657_10025902 | Ga0207657_100259024 | 205 |
| 286 | 3300025919 | Ga0207657_10026016 | Ga0207657_100260168 | 205 |
| 287 | 3300025919 | Ga0207657_10046642 | Ga0207657_100466425 | 205 |
| 288 | 3300025919 | Ga0207657_10068185 | Ga0207657_100681852 | 205 |
| 289 | 3300025919 | Ga0207657_10072787 | Ga0207657_100727873 | 205 |
| 290 | 3300025919 | Ga0207657_10337020 | Ga0207657_103370202 | 205 |
| 291 | 3300025919 | Ga0207657_10683104 | Ga0207657_106831041 | 205 |
| 292 | 3300025920 | Ga0207649_10069044 | Ga0207649_100690442 | 205 |
| 293 | 3300025920 | Ga0207649_10105005 | Ga0207649_101050053 | 205 |
| 294 | 3300025920 | Ga0207649_10372175 | Ga0207649_103721751 | 205 |
| 295 | 3300025920 | Ga0207649_10398879 | Ga0207649_103988792 | 205 |
| 296 | 3300025921 | Ga0207652_10282547 | Ga0207652_102825472 | 205 |
| 297 | 3300025921 | Ga0207652_10564626 | Ga0207652_105646262 | 205 |
| 298 | 3300025923 | Ga0207681_10059443 | Ga0207681_100594432 | 205 |
| 299 | 3300025923 | Ga0207681_10130694 | Ga0207681_101306943 | 205 |
| 300 | 3300025923 | Ga0207681_10430157 | Ga0207681_104301572 | 205 |
| 301 | 3300025923 | Ga0207681_10808122 | Ga0207681_108081221 | 205 |
| 302 | 3300025924 | Ga0207694_10016883 | Ga0207694_100168836 | 205 |
| 303 | 3300025924 | Ga0207694_10139202 | Ga0207694_101392022 | 205 |
| 304 | 3300025925 | Ga0207650_10018978 | Ga0207650_100189782 | 205 |
| 305 | 3300025925 | Ga0207650_10085819 | Ga0207650_100858193 | 205 |
| 306 | 3300025926 | Ga0207659_10001607 | Ga0207659_100016072 | 205 |
| 307 | 3300025926 | Ga0207659_10041904 | Ga0207659_100419042 | 205 |
| 308 | 3300025926 | Ga0207659_10132682 | Ga0207659_101326822 | 205 |
| 309 | 3300025926 | Ga0207659_10204997 | Ga0207659_102049972 | 205 |
| 310 | 3300025927 | Ga0207687_10158712 | Ga0207687_101587122 | 205 |
| 311 | 3300025927 | Ga0207687_10219999 | Ga0207687_102199992 | 205 |
| 312 | 3300025928 | Ga0207700_10081616 | Ga0207700_100816163 | 205 |
| 313 | 3300025929 | Ga0207664_10043416 | Ga0207664_100434165 | 205 |
| 314 | 3300025929 | Ga0207664_10222508 | Ga0207664_102225083 | 205 |
| 315 | 3300025931 | Ga0207644_10003573 | Ga0207644_100035738 | 205 |
| 316 | 3300025931 | Ga0207644_10024586 | Ga0207644_100245865 | 205 |
| 317 | 3300025931 | Ga0207644_10355422 | Ga0207644_103554222 | 205 |
| 318 | 3300025932 | Ga0207690_10022209 | Ga0207690_100222096 | 205 |
| 319 | 3300025932 | Ga0207690_10046385 | Ga0207690_100463852 | 205 |
| 320 | 3300025932 | Ga0207690_10142801 | Ga0207690_101428011 | 205 |
| 321 | 3300025932 | Ga0207690_10155479 | Ga0207690_101554792 | 205 |
| 322 | 3300025932 | Ga0207690_10163202 | Ga0207690_101632022 | 205 |
| 323 | 3300025932 | Ga0207690_10340272 | Ga0207690_103402722 | 205 |
| 324 | 3300025933 | Ga0207706_10016452 | Ga0207706_100164526 | 205 |
| 325 | 3300025933 | Ga0207706_10026447 | Ga0207706_100264473 | 205 |
| 326 | 3300025933 | Ga0207706_10073430 | Ga0207706_100734302 | 205 |
| 327 | 3300025933 | Ga0207706_10111576 | Ga0207706_101115764 | 205 |
| 328 | 3300025933 | Ga0207706_10137967 | Ga0207706_101379672 | 205 |
| 329 | 3300025933 | Ga0207706_10251882 | Ga0207706_102518822 | 205 |
| 330 | 3300025933 | Ga0207706_10284200 | Ga0207706_102842002 | 205 |
| 331 | 3300025934 | Ga0207686_10013065 | Ga0207686_100130652 | 205 |
| 332 | 3300025934 | Ga0207686_10401824 | Ga0207686_104018242 | 205 |
| 333 | 3300025935 | Ga0207709_10066644 | Ga0207709_100666442 | 205 |
| 334 | 3300025935 | Ga0207709_10682132 | Ga0207709_106821322 | 205 |
| 335 | 3300025937 | Ga0207669_10023063 | Ga0207669_100230632 | 205 |
| 336 | 3300025937 | Ga0207669_10036842 | Ga0207669_100368422 | 205 |
| 337 | 3300025937 | Ga0207669_10046827 | Ga0207669_100468273 | 205 |
| 338 | 3300025937 | Ga0207669_10110975 | Ga0207669_101109752 | 205 |
| 339 | 3300025938 | Ga0207704_10061904 | Ga0207704_100619042 | 205 |
| 340 | 3300025938 | Ga0207704_10073728 | Ga0207704_100737282 | 205 |
| 341 | 3300025938 | Ga0207704_10456101 | Ga0207704_104561012 | 205 |
| 342 | 3300025939 | Ga0207665_10094980 | Ga0207665_100949802 | 205 |
| 343 | 3300025940 | Ga0207691_10040872 | Ga0207691_100408724 | 205 |
| 344 | 3300025940 | Ga0207691_10050673 | Ga0207691_100506732 | 205 |
| 345 | 3300025940 | Ga0207691_10053759 | Ga0207691_100537594 | 205 |
| 346 | 3300025940 | Ga0207691_10359326 | Ga0207691_103593262 | 205 |
| 347 | 3300025940 | Ga0207691_10583716 | Ga0207691_105837161 | 205 |
| 348 | 3300025941 | Ga0207711_10000107 | Ga0207711_1000010714 | 205 |
| 349 | 3300025941 | Ga0207711_10008860 | Ga0207711_1000886013 | 205 |
| 350 | 3300025941 | Ga0207711_10033544 | Ga0207711_100335446 | 205 |
| 351 | 3300025941 | Ga0207711_10047052 | Ga0207711_100470527 | 205 |
| 352 | 3300025941 | Ga0207711_10104473 | Ga0207711_101044732 | 205 |
| 353 | 3300025942 | Ga0207689_10021312 | Ga0207689_100213128 | 205 |
| 354 | 3300025942 | Ga0207689_10021341 | Ga0207689_100213415 | 205 |
| 355 | 3300025944 | Ga0207661_10292078 | Ga0207661_102920782 | 205 |
| 356 | 3300025945 | Ga0207679_10015436 | Ga0207679_100154366 | 205 |
| 357 | 3300025945 | Ga0207679_10106745 | Ga0207679_101067453 | 205 |
| 358 | 3300025945 | Ga0207679_10111817 | Ga0207679_101118172 | 205 |
| 359 | 3300025945 | Ga0207679_10134976 | Ga0207679_101349762 | 205 |
| 360 | 3300025945 | Ga0207679_10403247 | Ga0207679_104032471 | 205 |
| 361 | 3300025945 | Ga0207679_10571285 | Ga0207679_105712852 | 205 |
| 362 | 3300025945 | Ga0207679_10896260 | Ga0207679_108962602 | 205 |
| 363 | 3300025949 | Ga0207667_10029298 | Ga0207667_100292986 | 205 |
| 364 | 3300025949 | Ga0207667_10071745 | Ga0207667_100717454 | 205 |
| 365 | 3300025949 | Ga0207667_10729694 | Ga0207667_107296942 | 205 |
| 366 | 3300025960 | Ga0207651_10004804 | Ga0207651_100048048 | 205 |
| 367 | 3300025960 | Ga0207651_10024248 | Ga0207651_100242487 | 205 |
| 368 | 3300025960 | Ga0207651_10029994 | Ga0207651_100299946 | 205 |
| 369 | 3300025960 | Ga0207651_10171229 | Ga0207651_101712292 | 205 |
| 370 | 3300025960 | Ga0207651_10176426 | Ga0207651_101764262 | 205 |
| 371 | 3300025960 | Ga0207651_10207185 | Ga0207651_102071852 | 205 |
| 372 | 3300025972 | Ga0207668_10399764 | Ga0207668_103997642 | 205 |
| 373 | 3300025981 | Ga0207640_10144986 | Ga0207640_101449862 | 205 |
| 374 | 3300025981 | Ga0207640_10220151 | Ga0207640_102201511 | 205 |
| 375 | 3300025981 | Ga0207640_10543593 | Ga0207640_105435932 | 205 |
| 376 | 3300025981 | Ga0207640_10871249 | Ga0207640_108712492 | 205 |
| 377 | 3300025986 | Ga0207658_10001125 | Ga0207658_100011255 | 205 |
| 378 | 3300025986 | Ga0207658_10001869 | Ga0207658_1000186916 | 205 |
| 379 | 3300025986 | Ga0207658_10026353 | Ga0207658_100263536 | 205 |
| 380 | 3300025986 | Ga0207658_10038298 | Ga0207658_100382982 | 205 |
| 381 | 3300025986 | Ga0207658_10093905 | Ga0207658_100939053 | 205 |
| 382 | 3300025986 | Ga0207658_10518670 | Ga0207658_105186702 | 205 |
| 383 | 3300025986 | Ga0207658_10692748 | Ga0207658_106927482 | 205 |
| 384 | 3300026023 | Ga0207677_10002860 | Ga0207677_1000286010 | 205 |
| 385 | 3300026023 | Ga0207677_10083870 | Ga0207677_100838702 | 205 |
| 386 | 3300026023 | Ga0207677_10116784 | Ga0207677_101167842 | 205 |
| 387 | 3300026023 | Ga0207677_10530586 | Ga0207677_105305862 | 205 |
| 388 | 3300026023 | Ga0207677_10656019 | Ga0207677_106560192 | 205 |
| 389 | 3300026035 | Ga0207703_10001207 | Ga0207703_100012076 | 205 |
| 390 | 3300026035 | Ga0207703_10005640 | Ga0207703_100056408 | 205 |
| 391 | 3300026041 | Ga0207639_10025482 | Ga0207639_100254822 | 205 |
| 392 | 3300026041 | Ga0207639_10050345 | Ga0207639_100503452 | 205 |
| 393 | 3300026041 | Ga0207639_10065445 | Ga0207639_100654452 | 205 |
| 394 | 3300026067 | Ga0207678_10000736 | Ga0207678_1000073617 | 205 |
| 395 | 3300026067 | Ga0207678_10016088 | Ga0207678_100160886 | 205 |
| 396 | 3300026067 | Ga0207678_10036653 | Ga0207678_100366535 | 205 |
| 397 | 3300026067 | Ga0207678_10042307 | Ga0207678_100423077 | 205 |
| 398 | 3300026067 | Ga0207678_10043642 | Ga0207678_100436422 | 205 |
| 399 | 3300026067 | Ga0207678_10056879 | Ga0207678_100568794 | 205 |
| 400 | 3300026067 | Ga0207678_10212402 | Ga0207678_102124022 | 205 |
| 401 | 3300026078 | Ga0207702_10126457 | Ga0207702_101264572 | 205 |
| 402 | 3300026078 | Ga0207702_10519032 | Ga0207702_105190322 | 205 |
| 403 | 3300026078 | Ga0207702_11083857 | Ga0207702_110838571 | 205 |
| 404 | 3300026088 | Ga0207641_10031630 | Ga0207641_100316302 | 205 |
| 405 | 3300026088 | Ga0207641_10034319 | Ga0207641_100343192 | 205 |
| 406 | 3300026088 | Ga0207641_10244443 | Ga0207641_102444432 | 205 |
| 407 | 3300026088 | Ga0207641_10283640 | Ga0207641_102836402 | 205 |
| 408 | 3300026089 | Ga0207648_10008511 | Ga0207648_100085115 | 205 |
| 409 | 3300026089 | Ga0207648_10061172 | Ga0207648_100611722 | 205 |
| 410 | 3300026089 | Ga0207648_10596361 | Ga0207648_105963612 | 205 |
| 411 | 3300026095 | Ga0207676_10023980 | Ga0207676_100239802 | 205 |
| 412 | 3300026095 | Ga0207676_10065074 | Ga0207676_100650743 | 205 |
| 413 | 3300026095 | Ga0207676_10477093 | Ga0207676_104770932 | 205 |
| 414 | 3300026116 | Ga0207674_10000583 | Ga0207674_100005833 | 205 |
| 415 | 3300026116 | Ga0207674_10039372 | Ga0207674_100393725 | 205 |
| 416 | 3300026116 | Ga0207674_10065319 | Ga0207674_100653193 | 205 |
| 417 | 3300026116 | Ga0207674_10216030 | Ga0207674_102160302 | 205 |
| 418 | 3300026118 | Ga0207675_100100832 | Ga0207675_1001008322 | 205 |
| 419 | 3300026121 | Ga0207683_10017280 | Ga0207683_100172806 | 205 |
| 420 | 3300026121 | Ga0207683_10087425 | Ga0207683_100874252 | 205 |
| 421 | 3300026121 | Ga0207683_10110127 | Ga0207683_101101273 | 205 |
| 422 | 3300026142 | Ga0207698_10037814 | Ga0207698_100378145 | 205 |
| 423 | 3300026142 | Ga0207698_10042377 | Ga0207698_100423773 | 205 |
| 424 | 3300026142 | Ga0207698_10110137 | Ga0207698_101101372 | 205 |
| 425 | 3300028379 | Ga0268266_10085752 | Ga0268266_100857522 | 205 |
| 426 | 3300028379 | Ga0268266_10114263 | Ga0268266_101142632 | 205 |
| 427 | 3300028379 | Ga0268266_10153667 | Ga0268266_101536673 | 205 |
| 428 | 3300028379 | Ga0268266_10521968 | Ga0268266_105219682 | 205 |
| 429 | 3300028380 | Ga0268265_10018027 | Ga0268265_100180277 | 205 |
| 430 | 3300028381 | Ga0268264_10135838 | Ga0268264_101358382 | 205 |
| 431 | 3300031548 | Ga0307408_100035753 | Ga0307408_1000357533 | 205 |
| 432 | 3300031548 | Ga0307408_100052533 | Ga0307408_1000525334 | 205 |
| 433 | 3300031548 | Ga0307408_100550798 | Ga0307408_1005507982 | 205 |
| 434 | 3300031731 | Ga0307405_10168794 | Ga0307405_101687942 | 205 |
| 435 | 3300031852 | Ga0307410_10004840 | Ga0307410_100048407 | 205 |
| 436 | 3300031852 | Ga0307410_10011482 | Ga0307410_100114825 | 205 |
| 437 | 3300031901 | Ga0307406_10018687 | Ga0307406_100186872 | 205 |
| 438 | 3300031903 | Ga0307407_10010399 | Ga0307407_100103994 | 205 |
| 439 | 3300031911 | Ga0307412_10170072 | Ga0307412_101700722 | 205 |
| 440 | 3300031995 | Ga0307409_100072213 | Ga0307409_1000722133 | 205 |
| 441 | 3300031995 | Ga0307409_100272655 | Ga0307409_1002726552 | 205 |
| 442 | 3300032002 | Ga0307416_100139496 | Ga0307416_1001394962 | 205 |
| 443 | 3300032004 | Ga0307414_10024096 | Ga0307414_100240962 | 205 |
| 444 | 3300032004 | Ga0307414_10034829 | Ga0307414_100348294 | 205 |
| 445 | 3300032005 | Ga0307411_10017265 | Ga0307411_100172653 | 205 |
| 446 | 3300032005 | Ga0307411_10087640 | Ga0307411_100876403 | 205 |
| 447 | 3300032126 | Ga0307415_100008636 | Ga0307415_1000086366 | 205 |
| 448 | 3300032126 | Ga0307415_100099351 | Ga0307415_1000993512 | 205 |
| 449 | 3300032126 | Ga0307415_100312367 | Ga0307415_1003123672 | 205 |
| 450 | 3300035086 | Ga0373934_0136267 | Ga0373934_0136267_191_808 | 205 |
| 451 | 3300035088 | Ga0373940_0066734 | Ga0373940_0066734_286_903 | 205 |
| 452 | 3300035111 | Ga0373923_0045261 | Ga0373923_0045261_1186_1803 | 205 |
| 453 | 3300035118 | Ga0373954_0009159 | Ga0373954_0009159_348_965 | 205 |
| 454 | 3300035119 | Ga0373956_0080332 | Ga0373956_0080332_503_1120 | 205 |
| 455 | 3300035120 | Ga0373957_0020711 | Ga0373957_0020711_1636_2253 | 205 |
| 456 | 3300035170 | Ga0373943_0328259 | Ga0373943_0328259_222_839 | 205 |
| 457 | 3300035172 | Ga0373955_0096913 | Ga0373955_0096913_220_837 | 205 |
| 458 | 3300035692 | Ga0373935_0003260 | Ga0373935_0003260_1388_2005 | 205 |
| 459 | 3300036401 | Ga0373937_0038960 | Ga0373937_0038960_895_1512 | 205 |
| 460 | 3300037312 | Ga0395899_0000132 | Ga0395899_0000132_112665_113285 | 205 |
| 461 | 3300037312 | Ga0395899_0011033 | Ga0395899_0011033_5711_6328 | 205 |
| 462 | 3300037312 | Ga0395899_0120538 | Ga0395899_0120538_891_1508 | 205 |
| 463 | 3300037312 | Ga0395899_0121878 | Ga0395899_0121878_830_1447 | 205 |
| 464 | 3300037312 | Ga0395899_0155360 | Ga0395899_0155360_813_1430 | 205 |
| 465 | 3300037312 | Ga0395899_0158467 | Ga0395899_0158467_797_1414 | 205 |
| 466 | 3300037312 | Ga0395899_0163697 | Ga0395899_0163697_24_641 | 205 |
| 467 | 3300037418 | Ga0395900_0000359 | Ga0395900_0000359_41407_42027 | 205 |
| 468 | 3300037418 | Ga0395900_0004142 | Ga0395900_0004142_4800_5417 | 205 |
| 469 | 3300037418 | Ga0395900_0043298 | Ga0395900_0043298_1082_1699 | 205 |
| 470 | 3300037418 | Ga0395900_0046606 | Ga0395900_0046606_873_1490 | 205 |
| 471 | 3300037418 | Ga0395900_0089840 | Ga0395900_0089840_374_991 | 205 |
| 472 | 3300037418 | Ga0395900_0104796 | Ga0395900_0104796_1497_2114 | 205 |
| 473 | 3300037418 | Ga0395900_0127400 | Ga0395900_0127400_1397_2014 | 205 |
| 474 | 3300037418 | Ga0395900_0231942 | Ga0395900_0231942_1052_1669 | 205 |
| 475 | 3300037418 | Ga0395900_0488640 | Ga0395900_0488640_217_834 | 205 |
| 476 | 3300037418 | Ga0395900_0543429 | Ga0395900_0543429_35_652 | 205 |
| 477 | 3300037418 | Ga0395900_0616719 | Ga0395900_0616719_130_747 | 205 |
| 478 | 3300037466 | Ga0395898_0010002 | Ga0395898_0010002_2288_2908 | 205 |
| 479 | 3300037466 | Ga0395898_0135792 | Ga0395898_0135792_1581_2198 | 205 |
| 480 | 3300037466 | Ga0395898_0158717 | Ga0395898_0158717_1115_1732 | 205 |
| 481 | 3300037466 | Ga0395898_0319701 | Ga0395898_0319701_519_1136 | 205 |
| 482 | 3300037466 | Ga0395898_0365682 | Ga0395898_0365682_736_1353 | 205 |
| 483 | 3300037466 | Ga0395898_1016515 | Ga0395898_1016515_101_718 | 205 |
| 484 | 3300037471 | Ga0395905_0000946 | Ga0395905_0000946_20487_21104 | 205 |
| 485 | 3300037471 | Ga0395905_0002968 | Ga0395905_0002968_5746_6363 | 205 |
| 486 | 3300037471 | Ga0395905_0009091 | Ga0395905_0009091_6515_7132 | 205 |
| 487 | 3300037471 | Ga0395905_0010496 | Ga0395905_0010496_6724_7341 | 205 |
| 488 | 3300037471 | Ga0395905_0044358 | Ga0395905_0044358_2501_3118 | 205 |
| 489 | 3300037471 | Ga0395905_0046644 | Ga0395905_0046644_2681_3298 | 205 |
| 490 | 3300037471 | Ga0395905_0064484 | Ga0395905_0064484_301_918 | 205 |
| 491 | 3300037471 | Ga0395905_0071803 | Ga0395905_0071803_2232_2849 | 205 |
| 492 | 3300037471 | Ga0395905_0122316 | Ga0395905_0122316_641_1258 | 205 |
| 493 | 3300037471 | Ga0395905_0125456 | Ga0395905_0125456_1173_1790 | 205 |
| 494 | 3300037471 | Ga0395905_0142992 | Ga0395905_0142992_1096_1728 | 205 |
| 495 | 3300037471 | Ga0395905_0203853 | Ga0395905_0203853_1118_1738 | 205 |
| 496 | 3300037471 | Ga0395905_0292748 | Ga0395905_0292748_403_1020 | 205 |
| 497 | 3300037471 | Ga0395905_0351975 | Ga0395905_0351975_721_1338 | 205 |
| 498 | 3300037471 | Ga0395905_0394374 | Ga0395905_0394374_637_1254 | 205 |
| 499 | 3300037471 | Ga0395905_0470426 | Ga0395905_0470426_293_910 | 205 |
| 500 | 3300037471 | Ga0395905_0513028 | Ga0395905_0513028_62_679 | 205 |
| 501 | 3300037471 | Ga0395905_0656709 | Ga0395905_0656709_127_744 | 205 |
| 502 | 3300037471 | Ga0395905_0709055 | Ga0395905_0709055_256_873 | 205 |
| 503 | 3300037471 | Ga0395905_0929650 | Ga0395905_0929650_138_755 | 205 |
| 504 | 3300038443 | Ga0395901_0000897 | Ga0395901_0000897_31474_32094 | 205 |
| 505 | 3300038443 | Ga0395901_0021404 | Ga0395901_0021404_3653_4270 | 205 |
| 506 | 3300038443 | Ga0395901_0045698 | Ga0395901_0045698_2411_3028 | 205 |
| 507 | 3300038443 | Ga0395901_0108982 | Ga0395901_0108982_2090_2707 | 205 |
| 508 | 3300038443 | Ga0395901_0363682 | Ga0395901_0363682_667_1284 | 205 |
| 509 | 3300042004 | Ga0439445_0015299 | Ga0439445_0015299_45_662 | 205 |
| 510 | 3300042006 | Ga0439432_031221 | Ga0439432_031221_871_1488 | 205 |
| 511 | 3300042007 | Ga0439449_0043738 | Ga0439449_0043738_950_1567 | 205 |
| 512 | 3300042157 | Ga0439458_0017996 | Ga0439458_0017996_517_1134 | 205 |
| 513 | 3300044684 | Ga0466966_0000059 | Ga0466966_0000059_65152_65769 | 205 |
| 514 | 3300044693 | Ga0466961_0128828 | Ga0466961_0128828_654_1289 | 205 |
| 515 | 3300044693 | Ga0466961_0337016 | Ga0466961_0337016_278_895 | 205 |
| 516 | 3300044694 | Ga0466963_0022845 | Ga0466963_0022845_1679_2296 | 205 |
| 517 | 3300044694 | Ga0466963_0032583 | Ga0466963_0032583_857_1474 | 205 |
| 518 | 3300044706 | Ga0466964_0039545 | Ga0466964_0039545_528_1145 | 205 |
| 519 | 3300044765 | Ga0466970_0168005 | Ga0466970_0168005_236_853 | 205 |
| 520 | 3300045049 | Ga0466959_0662865 | Ga0466959_0662865_48_665 | 205 |
| 521 | 3300045836 | Ga0466958_0342071 | Ga0466958_0342071_182_799 | 205 |
| 522 | 3300045836 | Ga0466958_0371273 | Ga0466958_0371273_131_748 | 205 |
| 523 | 3300045976 | Ga0466967_0015403 | Ga0466967_0015403_5032_5649 | 205 |
| 524 | 3300045976 | Ga0466967_0061806 | Ga0466967_0061806_1176_1793 | 205 |
| 525 | 3300045976 | Ga0466967_0066838 | Ga0466967_0066838_702_1319 | 205 |
| 526 | 3300045976 | Ga0466967_0069417 | Ga0466967_0069417_1299_1916 | 205 |
| 527 | 3300045976 | Ga0466967_0071591 | Ga0466967_0071591_2424_3041 | 205 |
| 528 | 3300045976 | Ga0466967_0118690 | Ga0466967_0118690_1026_1643 | 205 |
| 529 | 3300045976 | Ga0466967_0153381 | Ga0466967_0153381_830_1447 | 205 |
| 530 | 3300045976 | Ga0466967_0174524 | Ga0466967_0174524_221_838 | 205 |
| 531 | 3300045976 | Ga0466967_0250014 | Ga0466967_0250014_230_847 | 205 |
| 532 | 3300045976 | Ga0466967_0324667 | Ga0466967_0324667_822_1439 | 205 |
| 533 | 3300045976 | Ga0466967_0794828 | Ga0466967_0794828_279_896 | 205 |
| 534 | 3300045976 | Ga0466967_1321520 | Ga0466967_1321520_35_652 | 205 |
| 535 | 3300046525 | Ga0495663_0025509 | Ga0495663_0025509_927_1544 | 205 |
| 536 | 3300046528 | Ga0495642_0034021 | Ga0495642_0034021_1086_1703 | 205 |
| 537 | 3300046537 | Ga0495598_0000477 | Ga0495598_0000477_2532_3149 | 205 |
| 538 | 3300046558 | Ga0495633_0203131 | Ga0495633_0203131_156_773 | 205 |
| 539 | 3300046615 | Ga0495656_0212138 | Ga0495656_0212138_72_689 | 205 |
| 540 | 3300046616 | Ga0495668_0038047 | Ga0495668_0038047_1390_2007 | 205 |
| 541 | 3300046684 | Ga0495669_0000249 | Ga0495669_0000249_5011_5628 | 205 |
| 542 | 3300046684 | Ga0495669_0001045 | Ga0495669_0001045_8996_9613 | 205 |
| 543 | 3300046684 | Ga0495669_0007911 | Ga0495669_0007911_1877_2494 | 205 |
| 544 | 3300046684 | Ga0495669_0054776 | Ga0495669_0054776_709_1326 | 205 |
| 545 | 3300046684 | Ga0495669_0154681 | Ga0495669_0154681_426_1043 | 205 |
| 546 | 3300046684 | Ga0495669_0177269 | Ga0495669_0177269_208_825 | 205 |
| 547 | 3300046691 | Ga0495670_0002609 | Ga0495670_0002609_3518_4135 | 205 |
| 548 | 3300048088 | Ga0495602_0085923 | Ga0495602_0085923_964_1581 | 205 |
| 549 | 3300048904 | Ga0496101_0166436 | Ga0496101_0166436_130_747 | 205 |
| 550 | 3300048905 | Ga0496102_0032003 | Ga0496102_0032003_2420_3037 | 205 |
| 551 | 3300048905 | Ga0496102_0115104 | Ga0496102_0115104_116_733 | 205 |
| 552 | 3300048905 | Ga0496102_0240646 | Ga0496102_0240646_174_791 | 205 |
| 553 | 3300048906 | Ga0496103_0097744 | Ga0496103_0097744_142_759 | 205 |
| 554 | 3300048907 | Ga0496104_0270368 | Ga0496104_0270368_263_880 | 205 |
| 555 | 3300048909 | Ga0496106_0246613 | Ga0496106_0246613_272_889 | 205 |
| 556 | 3300048909 | Ga0496106_0253236 | Ga0496106_0253236_108_725 | 205 |
| 557 | 3300048910 | Ga0496107_0016436 | Ga0496107_0016436_4136_4753 | 205 |
| 558 | 3300048910 | Ga0496107_0111752 | Ga0496107_0111752_887_1504 | 205 |
| 559 | 3300048911 | Ga0496108_0000498 | Ga0496108_0000498_29924_30541 | 205 |
| 560 | 3300048911 | Ga0496108_0018570 | Ga0496108_0018570_4936_5553 | 205 |
| 561 | 3300048912 | Ga0496109_0012910 | Ga0496109_0012910_1039_1656 | 205 |
| 562 | 3300048913 | Ga0496110_0000806 | Ga0496110_0000806_13067_13684 | 205 |
| 563 | 3300048913 | Ga0496110_0123075 | Ga0496110_0123075_1159_1776 | 205 |
| 564 | 3300048913 | Ga0496110_0223234 | Ga0496110_0223234_825_1442 | 205 |
| 565 | 3300048914 | Ga0496111_0003369 | Ga0496111_0003369_950_1567 | 205 |
| 566 | 3300048914 | Ga0496111_0161866 | Ga0496111_0161866_650_1267 | 205 |
| 567 | 3300048914 | Ga0496111_0631757 | Ga0496111_0631757_91_708 | 205 |
| 568 | 3300048914 | Ga0496111_0648273 | Ga0496111_0648273_22_639 | 205 |
| 569 | 3300048915 | Ga0496112_0018938 | Ga0496112_0018938_5496_6113 | 205 |
| 570 | 3300048915 | Ga0496112_0365822 | Ga0496112_0365822_429_1046 | 205 |
| 571 | 3300048915 | Ga0496112_0392815 | Ga0496112_0392815_158_775 | 205 |
| 572 | 3300048916 | Ga0496113_0004483 | Ga0496113_0004483_2456_3073 | 205 |
| 573 | 3300048916 | Ga0496113_0197128 | Ga0496113_0197128_541_1158 | 205 |
| 574 | 3300048916 | Ga0496113_0322089 | Ga0496113_0322089_563_1180 | 205 |
| 575 | 3300048917 | Ga0496114_0118518 | Ga0496114_0118518_643_1260 | 205 |
| 576 | 3300048917 | Ga0496114_0646602 | Ga0496114_0646602_179_796 | 205 |
| 577 | 3300048918 | Ga0496115_0021804 | Ga0496115_0021804_96_713 | 205 |
| 578 | 3300049583 | Ga0501067_0054019 | Ga0501067_0054019_1355_1972 | 205 |
| 579 | 3300049663 | Ga0501223_052616 | Ga0501223_052616_93_710 | 205 |
| 580 | 3300049679 | Ga0501249_033123 | Ga0501249_033123_327_944 | 205 |
| 581 | 3300049686 | Ga0501257_023306 | Ga0501257_023306_420_1037 | 205 |
| 582 | 3300049704 | Ga0501221_035086 | Ga0501221_035086_363_980 | 205 |
| 583 | 3300049705 | Ga0501225_0042962 | Ga0501225_0042962_493_1110 | 205 |
| 584 | 3300049765 | Ga0501268_000371 | Ga0501268_000371_3367_3984 | 205 |
| 585 | 3300049765 | Ga0501268_036816 | Ga0501268_036816_212_829 | 205 |
| 586 | 3300049779 | Ga0501283_013110 | Ga0501283_013110_427_1044 | 205 |
| 587 | 3300050512 | nmdc:mga0n895_458030_c1 | nmdc:mga0n895_458030_c1_601_1218 | 205 |
| 588 | 3300050513 | nmdc:mga0rr50_116467_c1 | nmdc:mga0rr50_116467_c1_353_970 | 205 |
| 589 | 3300050515 | nmdc:mga0a205_11551_c1 | nmdc:mga0a205_11551_c1_5137_5754 | 205 |
| 590 | 3300053078 | Ga0495612_0121835 | Ga0495612_0121835_108_725 | 205 |
| 591 | 3300061719 | Ga0466962_0199004 | Ga0466962_0199004_316_933 | 205 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2h56-assembly2.cif.gz_B | crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution | 0.902 | 11 | 204 |
| 2yg9-assembly2.cif.gz_B | structure of an unusual 3-methyladenine dna glycosylase ii (alka) from deinococcus radiodurans | 0.8819 | 10 | 203 |
| 2h56-assembly2.cif.gz_B | crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution | 0.853 | 11 | 204 |
| 2h56-assembly3.cif.gz_C | crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution | 0.844 | 11 | 204 |
| 4ejz-assembly2.cif.gz_B | structure of mbogg1 in complex with low affinity dna ligand | 0.8416 | 10 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B4FZ58_120_231_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9193 | 40 | 144 | 1.10.340.30 |
| af_A0A1D8PI96_136_252_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.914 | 41 | 143 | 1.10.340.30 |
| 4ejzB02 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9107 | 41 | 148 | 1.10.340.30 |
| af_P22134_82_201_1.10.340.30 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.8954 | 41 | 143 | 1.10.340.30 |
| 2h56B02 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.8903 | 37 | 143 | 1.10.340.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A516IQP4-F1-model_v4 | DNA-3-methyladenine glycosylase II (EC 3.2.2.21) | 0.983 | 1 | 201 |
GO:0005737
GO:0006285 GO:0006307 GO:0008725 GO:0032131 GO:0032993 GO:0043916 |
| AF-A0A1Y6E944-F1-model_v4 | DNA-3-methyladenine glycosylase II (EC 3.2.2.21) | 0.9773 | 6 | 201 |
GO:0005737
GO:0006285 GO:0006307 GO:0008725 GO:0032131 GO:0032993 GO:0043916 |
| AF-A0A2G2D6Z0-F1-model_v4 | deleted | 0.9733 | 1 | 205 |
|
| AF-A0A1B6Z8M6-F1-model_v4 | DNA-3-methyladenine glycosylase II (EC 3.2.2.21) | 0.9724 | 1 | 205 |
GO:0005737
GO:0006285 GO:0006307 GO:0008725 GO:0032131 GO:0032993 GO:0043916 |
| AF-A0A5C6TT44-F1-model_v4 | DNA-3-methyladenine glycosylase II (EC 3.2.2.21) | 0.9719 | 1 | 205 |
GO:0005737
GO:0006285 GO:0006307 GO:0008725 GO:0032131 GO:0032993 GO:0043916 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar