F467073

General Info

Members Datasets Scaffolds Average Seq Length
591 281 1182 215

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0140527|Ga0495603_0140527_150_902
Length 250
Sequence VQWTVAAGSRQIEDRAQRELARGVVSETTINSRKLMRTLSLADAVALIPDGASLMIGGFMAVGTPESVVDELVRQGKRDLTVIANDTAMPGVGIGKLVRARLVKKAIVSHIGTNPETQAQMIGGEMEVDLVPQGTLVERIRAGGFGLGGILTATGVGTVVEEGKQKVTVAGKDYLVEPALRADFALVHAFMADYLGNLAYALTGRNFNPVIAMAADTVIVTVDNIVPVGLISPDHVVTPAPLVDYLIAQS

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
169 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
180 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
188 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
189 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
190 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
191 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
225 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
226 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
227 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
231 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
232 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
248 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
249 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 4.23
Rhizosphere 95.26
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0140527 3300046455 Bacteria 1405
2 Ga0065715_10013140 3300005293 Bacteria 2245
3 Ga0065715_10134779 3300005293 Bacteria 1943
4 Ga0070676_10000101 3300005328 Bacteria 30545
5 Ga0070676_10069411 3300005328 Bacteria 2112
6 Ga0070676_10262405 3300005328 Bacteria 1157
7 Ga0070690_100008126 3300005330 Bacteria 6029
8 Ga0070690_100300570 3300005330 Bacteria 1151
9 Ga0070670_100044711 3300005331 Bacteria 3807
10 Ga0070670_100198719 3300005331 Bacteria 1742
11 Ga0070670_100247343 3300005331 Bacteria 1553
12 Ga0070670_100256607 3300005331 Bacteria 1523
13 Ga0070670_100354683 3300005331 Bacteria 1289
14 Ga0070670_100722074 3300005331 Bacteria 897
15 Ga0070677_10023693 3300005333 Bacteria 2275
16 Ga0070677_10169596 3300005333 Bacteria 1030
17 Ga0070677_10224284 3300005333 Bacteria 920
18 Ga0068869_100004676 3300005334 Bacteria 8544
19 Ga0068869_100296818 3300005334 Bacteria 1304
20 Ga0070666_10006335 3300005335 Bacteria 7280
21 Ga0070666_10103994 3300005335 Bacteria 1960
22 Ga0070666_10354842 3300005335 Bacteria 1050
23 Ga0070682_100071815 3300005337 Bacteria 2216
24 Ga0068868_100194263 3300005338 Bacteria 1689
25 Ga0068868_100337060 3300005338 Bacteria 1289
26 Ga0070660_100322818 3300005339 Bacteria 1268
27 Ga0070661_100020975 3300005344 Bacteria 4664
28 Ga0070661_100085741 3300005344 Bacteria 2328
29 Ga0070661_100285316 3300005344 Bacteria 1282
30 Ga0070668_100003342 3300005347 Bacteria 11827
31 Ga0070668_100056117 3300005347 Bacteria 3041
32 Ga0070668_100117206 3300005347 Bacteria 2124
33 Ga0070668_100759510 3300005347 Bacteria 859
34 Ga0070669_100000736 3300005353 Bacteria 23856
35 Ga0070669_100031072 3300005353 Bacteria 3856
36 Ga0070669_100210501 3300005353 Bacteria 1534
37 Ga0070669_100857577 3300005353 Bacteria 774
38 Ga0070675_100046723 3300005354 Bacteria 3546
39 Ga0070675_100125332 3300005354 Bacteria 2184
40 Ga0070675_100599912 3300005354 Bacteria 998
41 Ga0070671_100008194 3300005355 Bacteria 8362
42 Ga0070671_100010572 3300005355 Bacteria 7411
43 Ga0070671_100031962 3300005355 Bacteria 4351
44 Ga0070671_100110104 3300005355 Bacteria 2313
45 Ga0070671_100127658 3300005355 Bacteria 2141
46 Ga0070674_100001055 3300005356 Bacteria 14403
47 Ga0070674_100057821 3300005356 Bacteria 2693
48 Ga0070673_100059057 3300005364 Bacteria 3035
49 Ga0070659_100002514 3300005366 Bacteria 13020
50 Ga0070667_100000911 3300005367 Bacteria 27330
51 Ga0070709_10008851 3300005434 Bacteria 5541
52 Ga0070713_100054486 3300005436 Bacteria 3318
53 Ga0070713_100663126 3300005436 Unclassified 994
54 Ga0070711_100853846 3300005439 Bacteria 775
55 Ga0070700_100717075 3300005441 Bacteria 797
56 Ga0070663_100009320 3300005455 Bacteria 6076
57 Ga0070678_100023877 3300005456 Bacteria 4084
58 Ga0070678_100050825 3300005456 Bacteria 3001
59 Ga0070678_100064684 3300005456 Bacteria 2712
60 Ga0070678_100124271 3300005456 Bacteria 2040
61 Ga0070678_101041507 3300005456 Bacteria 754
62 Ga0070662_100000248 3300005457 Bacteria 31890
63 Ga0070662_100009651 3300005457 Bacteria 6313
64 Ga0070662_100032471 3300005457 Bacteria 3669
65 Ga0070662_100186094 3300005457 Bacteria 1640
66 Ga0070662_100279826 3300005457 Bacteria 1350
67 Ga0070681_10008343 3300005458 Bacteria 10148
68 Ga0068867_100002478 3300005459 Bacteria 12972
69 Ga0068867_100006095 3300005459 Bacteria 8537
70 Ga0068867_100018802 3300005459 Bacteria 4915
71 Ga0068867_100161639 3300005459 Bacteria 1766
72 Ga0070685_10681668 3300005466 Bacteria 748
73 Ga0070679_100486878 3300005530 Bacteria 1178
74 Ga0068853_100130371 3300005539 Bacteria 2250
75 Ga0068853_100142181 3300005539 Bacteria 2155
76 Ga0068853_100504936 3300005539 Bacteria 1142
77 Ga0070672_100000298 3300005543 Bacteria 28086
78 Ga0070672_100006518 3300005543 Bacteria 7847
79 Ga0070672_100205852 3300005543 Bacteria 1647
80 Ga0070672_100240126 3300005543 Bacteria 1524
81 Ga0070672_100253803 3300005543 Bacteria 1482
82 Ga0070686_100068904 3300005544 Bacteria 2309
83 Ga0070686_100671238 3300005544 Bacteria 824
84 Ga0070696_100780467 3300005546 Bacteria 785
85 Ga0070693_100187682 3300005547 Bacteria 1335
86 Ga0070693_100629414 3300005547 Bacteria 778
87 Ga0068855_100001259 3300005563 Bacteria 31467
88 Ga0068855_100027568 3300005563 Bacteria 6794
89 Ga0068855_100098280 3300005563 Bacteria 3372
90 Ga0068855_100284887 3300005563 Bacteria 1833
91 Ga0070664_100008908 3300005564 Bacteria 8133
92 Ga0070664_100168234 3300005564 Bacteria 1943
93 Ga0070664_100314562 3300005564 Bacteria 1417
94 Ga0068854_100036313 3300005578 Bacteria 3454
95 Ga0068854_100192026 3300005578 Bacteria 1601
96 Ga0068854_100544948 3300005578 Bacteria 983
97 Ga0068856_100000181 3300005614 Bacteria 65631
98 Ga0068856_100004921 3300005614 Bacteria 13221
99 Ga0068852_100003271 3300005616 Bacteria 11311
100 Ga0068852_100152745 3300005616 Bacteria 2149
101 Ga0068852_100812551 3300005616 Bacteria 949
102 Ga0068859_100264425 3300005617 Bacteria 1812
103 Ga0068859_100878201 3300005617 Bacteria 982
104 Ga0068864_100041050 3300005618 Bacteria 3958
105 Ga0068864_100045250 3300005618 Bacteria 3775
106 Ga0068864_100525156 3300005618 Bacteria 1142
107 Ga0068866_10002517 3300005718 Bacteria 7548
108 Ga0068866_10218516 3300005718 Bacteria 1148
109 Ga0068861_100003452 3300005719 Bacteria 10493
110 Ga0068861_100281770 3300005719 Bacteria 1432
111 Ga0068851_10018572 3300005834 Bacteria 3350
112 Ga0068851_10082638 3300005834 Bacteria 1680
113 Ga0068870_10208625 3300005840 Bacteria 1189
114 Ga0068863_100000830 3300005841 Bacteria 31001
115 Ga0068863_100022362 3300005841 Bacteria 6038
116 Ga0068863_100226153 3300005841 Bacteria 1804
117 Ga0068863_100256032 3300005841 Bacteria 1692
118 Ga0068863_100724234 3300005841 Bacteria 990
119 Ga0068863_100872110 3300005841 Bacteria 900
120 Ga0068858_100001155 3300005842 Bacteria 27330
121 Ga0068858_100086524 3300005842 Bacteria 2915
122 Ga0068858_100302774 3300005842 Bacteria 1525
123 Ga0068860_100000796 3300005843 Bacteria 35406
124 Ga0068860_100189421 3300005843 Bacteria 1990
125 Ga0068862_100037681 3300005844 Bacteria 4099
126 Ga0081455_10061678 3300005937 Bacteria 3154
127 Ga0081455_10468054 3300005937 Bacteria 856
128 Ga0081540_1036258 3300005983 Bacteria 2632
129 Ga0070717_10482741 3300006028 Bacteria 1119
130 Ga0070712_100076186 3300006175 Bacteria 2415
131 Ga0070712_100333352 3300006175 Bacteria 1237
132 Ga0097621_100178113 3300006237 Bacteria 1836
133 Ga0097621_100263886 3300006237 Bacteria 1511
134 Ga0097621_100525600 3300006237 Bacteria 1074
135 Ga0068871_100014907 3300006358 Bacteria 5809
136 Ga0068871_100158590 3300006358 Bacteria 1934
137 Ga0075428_100006609 3300006844 Bacteria 12899
138 Ga0075428_100082937 3300006844 Bacteria 3498
139 Ga0075431_100006106 3300006847 Bacteria 11947
140 Ga0075431_100108401 3300006847 Bacteria 2866
141 Ga0075434_100289431 3300006871 Bacteria 1658
142 Ga0075429_100012805 3300006880 Bacteria 7276
143 Ga0068865_100001586 3300006881 Bacteria 13298
144 Ga0068865_100007519 3300006881 Bacteria 6703
145 Ga0068865_100126883 3300006881 Bacteria 1906
146 Ga0068865_100244733 3300006881 Bacteria 1413
147 Ga0068865_100423017 3300006881 Bacteria 1096
148 Ga0068865_100579843 3300006881 Bacteria 945
149 Ga0075436_100315165 3300006914 Bacteria 1123
150 Ga0097620_100264407 3300006931 Bacteria 1812
151 Ga0097620_100878241 3300006931 Bacteria 982
152 Ga0111539_10549676 3300009094 Bacteria 1345
153 Ga0111539_10676348 3300009094 Bacteria 1202
154 Ga0114129_10000005 3300009147 Bacteria 159906
155 Ga0114129_10016886 3300009147 Bacteria 10393
156 Ga0114129_10474476 3300009147 Bacteria 1638
157 Ga0105243_10014891 3300009148 Bacteria 5887
158 Ga0105241_10120373 3300009174 Bacteria 2113
159 Ga0105242_10018254 3300009176 Bacteria 5482
160 Ga0105242_10024340 3300009176 Bacteria 4781
161 Ga0105242_10573080 3300009176 Bacteria 1086
162 Ga0105248_10007457 3300009177 Bacteria 12001
163 Ga0105248_10035717 3300009177 Bacteria 5559
164 Ga0105248_10040894 3300009177 Bacteria 5197
165 Ga0105248_10093743 3300009177 Bacteria 3382
166 Ga0105248_10501479 3300009177 Bacteria 1368
167 Ga0105248_10775716 3300009177 Bacteria 1082
168 Ga0105238_10156942 3300009551 Bacteria 2251
169 Ga0105249_10031876 3300009553 Bacteria 4769
170 Ga0105249_10232531 3300009553 Bacteria 1818
171 Ga0105239_10211046 3300010375 Bacteria 2176
172 Ga0105246_10464190 3300011119 Bacteria 1067
173 Ga0105246_10466640 3300011119 Bacteria 1065
174 Ga0157371_10000221 3300013102 Bacteria 83267
175 Ga0157370_10048936 3300013104 Bacteria 4048
176 Ga0157370_10155262 3300013104 Bacteria 2129
177 Ga0157370_10244033 3300013104 Bacteria 1662
178 Ga0157369_10021715 3300013105 Bacteria 7179
179 Ga0157369_10169159 3300013105 Bacteria 2304
180 Ga0157369_10567331 3300013105 Bacteria 1172
181 Ga0157374_10145614 3300013296 Bacteria 2301
182 Ga0157374_10290105 3300013296 Bacteria 1617
183 Ga0163162_10004930 3300013306 Bacteria 12865
184 Ga0163162_10016912 3300013306 Bacteria 7132
185 Ga0163162_10102989 3300013306 Bacteria 2948
186 Ga0163162_10112431 3300013306 Bacteria 2822
187 Ga0163162_10198646 3300013306 Bacteria 2134
188 Ga0163162_10386687 3300013306 Bacteria 1532
189 Ga0157372_10000546 3300013307 Bacteria 41467
190 Ga0157372_10045693 3300013307 Bacteria 4859
191 Ga0157375_10001027 3300013308 Bacteria 24079
192 Ga0157375_10009764 3300013308 Bacteria 8435
193 Ga0157375_10014497 3300013308 Bacteria 7033
194 Ga0157375_10037005 3300013308 Bacteria 4672
195 Ga0157375_10119027 3300013308 Bacteria 2748
196 Ga0157375_10275507 3300013308 Bacteria 1845
197 Ga0163163_10237752 3300014325 Bacteria 1871
198 Ga0163163_10675326 3300014325 Bacteria 1096
199 Ga0157380_10000360 3300014326 Bacteria 27339
200 Ga0157380_10393696 3300014326 Bacteria 1312
201 Ga0157377_10192749 3300014745 Bacteria 1289
202 Ga0157379_10020533 3300014968 Bacteria 5842
203 Ga0157379_10160371 3300014968 Bacteria 2030
204 Ga0157379_10347311 3300014968 Bacteria 1358
205 Ga0157379_10375481 3300014968 Bacteria 1304
206 Ga0157376_10382129 3300014969 Bacteria 1357
207 Ga0157376_10522774 3300014969 Bacteria 1170
208 Ga0157376_10579637 3300014969 Bacteria 1114
209 Ga0163161_10001228 3300017792 Bacteria 19212
210 Ga0163161_10107246 3300017792 Bacteria 2085
211 Ga0163161_10173461 3300017792 Bacteria 1650
212 Ga0163161_10193158 3300017792 Bacteria 1566
213 Ga0163161_10373089 3300017792 Bacteria 1139
214 Ga0209050_1004532 3300025298 Bacteria 9342
215 Ga0207697_10005006 3300025315 Bacteria 6233
216 Ga0207697_10006847 3300025315 Bacteria 5119
217 Ga0207656_10013551 3300025321 Bacteria 3120
218 Ga0207682_10004587 3300025893 Bacteria 5755
219 Ga0207682_10011771 3300025893 Bacteria 3417
220 Ga0207682_10245730 3300025893 Bacteria 832
221 Ga0207642_10013803 3300025899 Bacteria 2960
222 Ga0207688_10075148 3300025901 Bacteria 1923
223 Ga0207680_10041824 3300025903 Bacteria 2677
224 Ga0207680_10053775 3300025903 Bacteria 2419
225 Ga0207647_10072400 3300025904 Bacteria 2078
226 Ga0207645_10004531 3300025907 Bacteria 10263
227 Ga0207645_10025878 3300025907 Bacteria 3795
228 Ga0207705_10129201 3300025909 Bacteria 1879
229 Ga0207705_10399820 3300025909 Bacteria 1062
230 Ga0207654_10017416 3300025911 Bacteria 3755
231 Ga0207654_10135919 3300025911 Bacteria 1562
232 Ga0207707_10077924 3300025912 Bacteria 2893
233 Ga0207707_10140700 3300025912 Bacteria 2110
234 Ga0207693_10010583 3300025915 Bacteria 7485
235 Ga0207693_10122785 3300025915 Bacteria 2040
236 Ga0207663_10067944 3300025916 Bacteria 2287
237 Ga0207660_10069384 3300025917 Bacteria 2559
238 Ga0207662_10009408 3300025918 Bacteria 5376
239 Ga0207657_10000596 3300025919 Bacteria 38318
240 Ga0207657_10099266 3300025919 Bacteria 2418
241 Ga0207649_10003941 3300025920 Bacteria 8098
242 Ga0207649_10115964 3300025920 Bacteria 1797
243 Ga0207649_10235457 3300025920 Bacteria 1312
244 Ga0207649_10552266 3300025920 Bacteria 881
245 Ga0207652_10243405 3300025921 Bacteria 1622
246 Ga0207681_10000592 3300025923 Bacteria 24653
247 Ga0207681_10013076 3300025923 Bacteria 5132
248 Ga0207681_10065318 3300025923 Bacteria 2515
249 Ga0207650_10010191 3300025925 Bacteria 6441
250 Ga0207650_10084049 3300025925 Bacteria 2419
251 Ga0207650_10087822 3300025925 Bacteria 2370
252 Ga0207650_10212746 3300025925 Bacteria 1553
253 Ga0207650_10256500 3300025925 Bacteria 1417
254 Ga0207650_10662078 3300025925 Bacteria 881
255 Ga0207650_10698994 3300025925 Bacteria 856
256 Ga0207659_10006611 3300025926 Bacteria 7119
257 Ga0207659_10021777 3300025926 Bacteria 4261
258 Ga0207659_10022473 3300025926 Bacteria 4200
259 Ga0207659_10195610 3300025926 Bacteria 1611
260 Ga0207659_10492924 3300025926 Bacteria 1036
261 Ga0207700_10083392 3300025928 Bacteria 2502
262 Ga0207700_10370345 3300025928 Bacteria 1251
263 Ga0207644_10005044 3300025931 Bacteria 8616
264 Ga0207644_10014930 3300025931 Bacteria 5207
265 Ga0207644_10046510 3300025931 Bacteria 3092
266 Ga0207644_10070496 3300025931 Bacteria 2555
267 Ga0207690_10000419 3300025932 Bacteria 27647
268 Ga0207690_10143180 3300025932 Bacteria 1764
269 Ga0207690_10644519 3300025932 Bacteria 868
270 Ga0207706_10000074 3300025933 Bacteria 103144
271 Ga0207706_10002518 3300025933 Bacteria 17874
272 Ga0207706_10019690 3300025933 Bacteria 6071
273 Ga0207706_10227285 3300025933 Bacteria 1633
274 Ga0207686_10020451 3300025934 Bacteria 3782
275 Ga0207686_10035011 3300025934 Bacteria 3010
276 Ga0207686_10214443 3300025934 Bacteria 1386
277 Ga0207686_10228944 3300025934 Bacteria 1346
278 Ga0207709_10003323 3300025935 Bacteria 9633
279 Ga0207669_10000756 3300025937 Bacteria 13966
280 Ga0207669_10107277 3300025937 Bacteria 1862
281 Ga0207669_10109329 3300025937 Bacteria 1848
282 Ga0207669_10177038 3300025937 Bacteria 1525
283 Ga0207704_10000750 3300025938 Bacteria 14293
284 Ga0207704_10048038 3300025938 Bacteria 2556
285 Ga0207704_10083377 3300025938 Bacteria 2074
286 Ga0207704_10134599 3300025938 Bacteria 1718
287 Ga0207704_10390468 3300025938 Bacteria 1095
288 Ga0207691_10001866 3300025940 Bacteria 20593
289 Ga0207691_10014808 3300025940 Bacteria 7431
290 Ga0207691_10103201 3300025940 Bacteria 2543
291 Ga0207691_10178725 3300025940 Bacteria 1855
292 Ga0207711_10011986 3300025941 Bacteria 7205
293 Ga0207711_10014428 3300025941 Bacteria 6563
294 Ga0207711_10031161 3300025941 Bacteria 4500
295 Ga0207711_10041445 3300025941 Bacteria 3921
296 Ga0207711_10222835 3300025941 Bacteria 1725
297 Ga0207689_10006195 3300025942 Bacteria 10596
298 Ga0207661_10118582 3300025944 Bacteria 2250
299 Ga0207679_10007022 3300025945 Bacteria 7136
300 Ga0207679_10126902 3300025945 Bacteria 2040
301 Ga0207679_10183171 3300025945 Bacteria 1734
302 Ga0207679_10240019 3300025945 Bacteria 1535
303 Ga0207667_10030975 3300025949 Bacteria 5780
304 Ga0207667_10307522 3300025949 Bacteria 1619
305 Ga0207667_10899361 3300025949 Bacteria 877
306 Ga0207651_10084601 3300025960 Bacteria 2298
307 Ga0207651_10399649 3300025960 Bacteria 1169
308 Ga0207712_10012206 3300025961 Bacteria 5488
309 Ga0207668_10014767 3300025972 Bacteria 4840
310 Ga0207668_10033851 3300025972 Bacteria 3388
311 Ga0207640_10089134 3300025981 Bacteria 2131
312 Ga0207640_10402079 3300025981 Bacteria 1116
313 Ga0207640_10631853 3300025981 Bacteria 910
314 Ga0207640_10939463 3300025981 Bacteria 757
315 Ga0207658_10000510 3300025986 Bacteria 35545
316 Ga0207658_10067112 3300025986 Bacteria 2701
317 Ga0207658_10086504 3300025986 Bacteria 2418
318 Ga0207658_10255718 3300025986 Bacteria 1490
319 Ga0207658_10376149 3300025986 Bacteria 1243
320 Ga0207677_10445572 3300026023 Bacteria 1108
321 Ga0207677_11011019 3300026023 Bacteria 754
322 Ga0207703_10001422 3300026035 Bacteria 21834
323 Ga0207703_10293490 3300026035 Bacteria 1480
324 Ga0207639_10032306 3300026041 Bacteria 3852
325 Ga0207639_10283807 3300026041 Bacteria 1457
326 Ga0207639_10540742 3300026041 Bacteria 1069
327 Ga0207639_10553527 3300026041 Bacteria 1056
328 Ga0207678_10007835 3300026067 Bacteria 9427
329 Ga0207708_10484405 3300026075 Bacteria 1035
330 Ga0207702_10001390 3300026078 Bacteria 24132
331 Ga0207702_10153702 3300026078 Bacteria 2095
332 Ga0207641_10001218 3300026088 Bacteria 25753
333 Ga0207641_10056997 3300026088 Bacteria 3322
334 Ga0207641_10162067 3300026088 Bacteria 2034
335 Ga0207641_10210230 3300026088 Bacteria 1799
336 Ga0207648_10001492 3300026089 Bacteria 25769
337 Ga0207648_10012368 3300026089 Bacteria 7990
338 Ga0207648_10018499 3300026089 Bacteria 6306
339 Ga0207648_10104243 3300026089 Bacteria 2487
340 Ga0207676_10036241 3300026095 Bacteria 3751
341 Ga0207676_10040883 3300026095 Bacteria 3556
342 Ga0207676_10151988 3300026095 Bacteria 1995
343 Ga0207676_10418284 3300026095 Bacteria 1256
344 Ga0207675_100001773 3300026118 Bacteria 21566
345 Ga0207675_100275507 3300026118 Bacteria 1634
346 Ga0207683_10005185 3300026121 Bacteria 11189
347 Ga0207683_10085823 3300026121 Bacteria 2798
348 Ga0207683_10150989 3300026121 Bacteria 2096
349 Ga0207683_10227010 3300026121 Bacteria 1702
350 Ga0207683_11180612 3300026121 Bacteria 709
351 Ga0207698_10012687 3300026142 Bacteria 5526
352 Ga0207698_10060728 3300026142 Bacteria 2941
353 Ga0207698_10196320 3300026142 Bacteria 1803
354 Ga0207698_10406415 3300026142 Bacteria 1303
355 Ga0207428_10613387 3300027907 Bacteria 783
356 Ga0268265_10005696 3300028380 Bacteria 8507
357 Ga0268264_10028083 3300028381 Bacteria 4602
358 Ga0268264_10192730 3300028381 Bacteria 1859
359 Ga0268264_10988880 3300028381 Bacteria 847
360 Ga0307416_100220057 3300032002 Bacteria 1820
361 Ga0307414_10585342 3300032004 Bacteria 999
362 Ga0307415_100133291 3300032126 Bacteria 1885
363 Ga0373926_0034130 3300035083 Bacteria 1800
364 Ga0373926_0181272 3300035083 Bacteria 808
365 Ga0373945_0177915 3300035116 Bacteria 874
366 Ga0373943_0026826 3300035170 Bacteria 2702
367 Ga0373924_0020099 3300035410 Bacteria 2592
368 Ga0373931_0069174 3300035691 Bacteria 1923
369 Ga0373935_0112178 3300035692 Bacteria 1811
370 Ga0373933_0161205 3300035724 Bacteria 1424
371 Ga0373947_0088546 3300035725 Bacteria 1927
372 Ga0373925_0026288 3300037068 Bacteria 4259
373 Ga0373925_0336654 3300037068 Bacteria 1223
374 Ga0395899_0003912 3300037312 Bacteria 11741
375 Ga0395899_0011242 3300037312 Bacteria 6857
376 Ga0395900_0001162 3300037418 Bacteria 32955
377 Ga0395900_0020459 3300037418 Bacteria 6755
378 Ga0395898_0003358 3300037466 Bacteria 17956
379 Ga0395905_0004279 3300037471 Bacteria 14891
380 Ga0395905_0238031 3300037471 Bacteria 1701
381 Ga0395901_0011447 3300038443 Bacteria 8989
382 Ga0395901_0175269 3300038443 Bacteria 2249
383 Ga0439449_0027200 3300042007 Bacteria 2134
384 Ga0451577_0000058 3300042876 Bacteria 272673
385 Ga0453684_0000279 3300044712 Bacteria 220016
386 Ga0466971_0093729 3300044719 Bacteria 1376
387 Ga0466957_0035583 3300044842 Bacteria 2988
388 Ga0451576_0001134 3300045051 Bacteria 48176
389 Ga0466967_0005963 3300045976 Bacteria 8551
390 Ga0495617_000030 3300046452 Bacteria 152392
391 Ga0495627_000228 3300046453 Bacteria 59535
392 Ga0495627_022678 3300046453 Bacteria 2063
393 Ga0495629_0011521 3300046459 Bacteria 6423
394 Ga0495653_0007080 3300046463 Bacteria 9199
395 Ga0495580_0156956 3300046472 Bacteria 1575
396 Ga0495582_0113473 3300046473 Bacteria 1523
397 Ga0495605_0000046 3300046474 Bacteria 175985
398 Ga0495605_0012885 3300046474 Bacteria 4627
399 Ga0495605_0017171 3300046474 Bacteria 3903
400 Ga0495605_0035670 3300046474 Bacteria 2512
401 Ga0495584_0001630 3300046491 Bacteria 13194
402 Ga0495584_0064863 3300046491 Bacteria 1836
403 Ga0495584_0172202 3300046491 Bacteria 1100
404 Ga0495585_0000410 3300046492 Bacteria 41579
405 Ga0495585_0003320 3300046492 Bacteria 10923
406 Ga0495594_0033471 3300046499 Bacteria 2794
407 Ga0495594_0289775 3300046499 Bacteria 933
408 Ga0495596_0000846 3300046500 Bacteria 18508
409 Ga0495596_0005147 3300046500 Bacteria 6226
410 Ga0495596_0005570 3300046500 Bacteria 5916
411 Ga0495596_0019781 3300046500 Bacteria 2762
412 Ga0495607_0001168 3300046501 Bacteria 23749
413 Ga0495607_0052992 3300046501 Bacteria 2347
414 Ga0495583_0000142 3300046506 Bacteria 121513
415 Ga0495583_0007855 3300046506 Bacteria 6626
416 Ga0495583_0012652 3300046506 Bacteria 4756
417 Ga0495583_0023203 3300046506 Bacteria 3144
418 Ga0495583_0143298 3300046506 Bacteria 994
419 Ga0495606_0089051 3300046507 Bacteria 1902
420 Ga0495616_0034366 3300046513 Bacteria 2633
421 Ga0495616_0041717 3300046513 Bacteria 2339
422 Ga0495616_0064515 3300046513 Bacteria 1787
423 Ga0495630_0014901 3300046517 Bacteria 5670
424 Ga0495631_0006519 3300046518 Bacteria 6021
425 Ga0495631_0009677 3300046518 Bacteria 4806
426 Ga0495631_0014950 3300046518 Bacteria 3732
427 Ga0495631_0203581 3300046518 Bacteria 846
428 Ga0495632_0003811 3300046519 Bacteria 10511
429 Ga0495632_0049842 3300046519 Bacteria 2068
430 Ga0495643_0018799 3300046522 Bacteria 4004
431 Ga0495644_0002504 3300046523 Bacteria 7326
432 Ga0495644_0017039 3300046523 Bacteria 2780
433 Ga0495644_0029568 3300046523 Bacteria 2070
434 Ga0495648_0000815 3300046524 Bacteria 32978
435 Ga0495666_0003566 3300046526 Bacteria 7869
436 Ga0495666_0156403 3300046526 Bacteria 1058
437 Ga0495642_0000013 3300046528 Bacteria 123896
438 Ga0495642_0017369 3300046528 Bacteria 2811
439 Ga0495642_0040232 3300046528 Bacteria 1898
440 Ga0495642_0093510 3300046528 Bacteria 1274
441 Ga0495654_0004974 3300046530 Bacteria 7808
442 Ga0495665_0007660 3300046531 Bacteria 5843
443 Ga0495586_0089053 3300046535 Bacteria 1703
444 Ga0495586_0385626 3300046535 Unclassified 806
445 Ga0495587_0018542 3300046536 Bacteria 4316
446 Ga0495609_0000948 3300046538 Bacteria 20986
447 Ga0495609_0005910 3300046538 Bacteria 6324
448 Ga0495609_0021179 3300046538 Bacteria 2999
449 Ga0495609_0102637 3300046538 Bacteria 1238
450 Ga0495621_0033547 3300046539 Bacteria 1770
451 Ga0495621_0101783 3300046539 Bacteria 1094
452 Ga0495597_0006125 3300046542 Bacteria 6258
453 Ga0495597_0020490 3300046542 Bacteria 3079
454 Ga0495645_0571727 3300046543 Bacteria 698
455 Ga0495622_0094057 3300046557 Bacteria 1376
456 Ga0495633_0037882 3300046558 Bacteria 2305
457 Ga0495633_0045305 3300046558 Bacteria 2083
458 Ga0495656_0150497 3300046615 Bacteria 1123
459 Ga0495656_0166527 3300046615 Bacteria 1075
460 Ga0495668_0000373 3300046616 Bacteria 59298
461 Ga0495668_0046915 3300046616 Bacteria 2399
462 Ga0495668_0134968 3300046616 Bacteria 1350
463 Ga0495668_0162213 3300046616 Bacteria 1224
464 Ga0495611_0011487 3300046648 Bacteria 3755
465 Ga0495611_0049033 3300046648 Bacteria 1899
466 Ga0495625_0006300 3300046660 Bacteria 10610
467 Ga0495661_0009522 3300046665 Bacteria 6665
468 Ga0495661_0013871 3300046665 Bacteria 5406
469 Ga0495661_0024686 3300046665 Bacteria 3891
470 Ga0495661_0056187 3300046665 Bacteria 2356
471 Ga0495661_0065767 3300046665 Bacteria 2135
472 Ga0495661_0272031 3300046665 Bacteria 857
473 Ga0495588_0002056 3300046674 Bacteria 8606
474 Ga0495623_0060908 3300046679 Bacteria 2367
475 Ga0495658_0247497 3300046683 Bacteria 1120
476 Ga0495669_0001491 3300046684 Bacteria 9648
477 Ga0495669_0006852 3300046684 Bacteria 4768
478 Ga0495669_0048252 3300046684 Bacteria 1904
479 Ga0495613_0109696 3300046689 Bacteria 1990
480 Ga0495613_0307319 3300046689 Bacteria 1096
481 Ga0495624_0001290 3300046690 Bacteria 19765
482 Ga0495670_0012853 3300046691 Bacteria 4116
483 Ga0495670_0029128 3300046691 Bacteria 2739
484 Ga0495671_0000989 3300046692 Bacteria 19828
485 Ga0495589_0018014 3300046794 Bacteria 3624
486 Ga0495589_0027534 3300046794 Bacteria 2873
487 Ga0495600_0149738 3300046809 Bacteria 1511
488 Ga0495660_0047873 3300046810 Bacteria 2339
489 Ga0495581_0208481 3300047315 Bacteria 1143
490 Ga0495604_0060867 3300047317 Bacteria 2889
491 Ga0495604_0232047 3300047317 Bacteria 1265
492 Ga0495672_0042963 3300047320 Bacteria 2721
493 Ga0495672_0112700 3300047320 Bacteria 1457
494 Ga0495676_0009654 3300047321 Bacteria 8779
495 Ga0495676_0015149 3300047321 Bacteria 6880
496 Ga0495676_0041025 3300047321 Bacteria 3814
497 Ga0495676_0492953 3300047321 Bacteria 805
498 Ga0495680_0036776 3300047322 Bacteria 3927
499 Ga0495675_0141733 3300047444 Bacteria 1489
500 Ga0495677_0002312 3300047445 Bacteria 7514
501 Ga0495677_0005272 3300047445 Bacteria 4910
502 Ga0495679_026066 3300047446 Bacteria 1946
503 Ga0495685_076668 3300047447 Bacteria 1116
504 Ga0495673_0007840 3300047469 Bacteria 6071
505 Ga0495681_0009180 3300047470 Bacteria 6115
506 Ga0495681_0012177 3300047470 Bacteria 5069
507 Ga0495593_0006234 3300047673 Bacteria 7004
508 Ga0495602_0012852 3300048088 Bacteria 8583
509 Ga0495614_0103330 3300048089 Bacteria 1247
510 Ga0495615_0003349 3300048090 Bacteria 2675
511 Ga0495626_0001381 3300048091 Bacteria 19521
512 Ga0495626_0002812 3300048091 Bacteria 11650
513 Ga0495626_0006393 3300048091 Bacteria 6707
514 Ga0495626_0009558 3300048091 Bacteria 5237
515 Ga0495626_0027417 3300048091 Bacteria 2770
516 Ga0495626_0028758 3300048091 Bacteria 2691
517 Ga0495626_0040255 3300048091 Bacteria 2208
518 Ga0496101_0606039 3300048904 Bacteria 866
519 Ga0496102_0000231 3300048905 Bacteria 73157
520 Ga0496102_0000943 3300048905 Bacteria 27451
521 Ga0496102_0001702 3300048905 Bacteria 19248
522 Ga0496102_0301316 3300048905 Bacteria 1511
523 Ga0496103_0049971 3300048906 Bacteria 2586
524 Ga0496103_0051518 3300048906 Bacteria 2548
525 Ga0496103_0103977 3300048906 Bacteria 1799
526 Ga0496104_0000005 3300048907 Bacteria 620360
527 Ga0496104_0047410 3300048907 Bacteria 4050
528 Ga0496105_0000106 3300048908 Bacteria 56944
529 Ga0496105_0141427 3300048908 Bacteria 1981
530 Ga0496105_0611819 3300048908 Bacteria 844
531 Ga0496106_0001506 3300048909 Bacteria 17507
532 Ga0496107_0012164 3300048910 Bacteria 6002
533 Ga0496107_0142314 3300048910 Bacteria 1773
534 Ga0496108_0263696 3300048911 Bacteria 1499
535 Ga0496108_0452342 3300048911 Bacteria 1122
536 Ga0496109_0084620 3300048912 Bacteria 2926
537 Ga0496109_0104821 3300048912 Bacteria 2626
538 Ga0496110_0159180 3300048913 Bacteria 2046
539 Ga0496110_0630742 3300048913 Bacteria 971
540 Ga0496112_0038804 3300048915 Bacteria 4652
541 Ga0496113_0303283 3300048916 Bacteria 1279
542 Ga0496114_0012861 3300048917 Bacteria 6703
543 Ga0496121_0230157 3300048924 Bacteria 1299
544 Ga0496124_0002249 3300048927 Bacteria 25656
545 Ga0495678_007207 3300049459 Bacteria 5795
546 Ga0495682_0014012 3300049460 Bacteria 3044
547 Ga0495682_0051125 3300049460 Bacteria 1504
548 Ga0501033_0105330 3300049570 Bacteria 2056
549 Ga0501034_0002589 3300049571 Bacteria 21507
550 Ga0501036_0214161 3300049572 Bacteria 1618
551 Ga0501037_0218628 3300049573 Bacteria 1341
552 Ga0501038_0196655 3300049574 Bacteria 1620
553 Ga0501038_0483855 3300049574 Bacteria 948
554 Ga0501039_0052036 3300049575 Bacteria 3169
555 Ga0501039_0076109 3300049575 Bacteria 2609
556 Ga0501040_0044724 3300049576 Bacteria 3019
557 Ga0501041_0150614 3300049577 Bacteria 1452
558 Ga0501043_0177384 3300049579 Bacteria 1661
559 Ga0501046_0061483 3300049580 Bacteria 2936
560 Ga0501046_0148497 3300049580 Bacteria 1769
561 Ga0501048_0088350 3300049582 Bacteria 2186
562 Ga0501068_0096756 3300049584 Bacteria 1826
563 Ga0501071_0019978 3300049587 Bacteria 4653
564 Ga0501071_0121639 3300049587 Bacteria 1935
565 Ga0501072_0043830 3300049588 Bacteria 3517
566 Ga0501074_0424267 3300049590 Bacteria 943
567 Ga0501075_0010572 3300049591 Bacteria 6489
568 Ga0501075_0256244 3300049591 Bacteria 1333
569 Ga0501076_0012122 3300049592 Bacteria 6444
570 Ga0501076_0560963 3300049592 Bacteria 942
571 Ga0501077_0222286 3300049593 Bacteria 1200
572 Ga0501079_0040966 3300049741 Bacteria 3574
573 Ga0501079_0228273 3300049741 Bacteria 1454
574 Ga0501081_0026219 3300049743 Bacteria 3928
575 Ga0501081_0039813 3300049743 Bacteria 3217
576 Ga0501083_0142869 3300049744 Bacteria 1567
577 Ga0501035_0321483 3300049822 Bacteria 1300
578 Ga0501045_0061879 3300049824 Bacteria 2746
579 nmdc:mga05p37_16495_c1 3300050507 Bacteria 8897
580 nmdc:mga05p37_534646_c1 3300050507 Bacteria 1338
581 nmdc:mga05p37_75835_c1 3300050507 Bacteria 4140
582 nmdc:mga09592_11152_c1 3300050508 Bacteria 7313
583 nmdc:mga06r32_176363_c1 3300050510 Bacteria 2122
584 nmdc:mga06r32_458597_c1 3300050510 Bacteria 1254
585 nmdc:mga06r32_771_c1 3300050510 Bacteria 28266
586 nmdc:mga0n895_233101_c1 3300050512 Bacteria 1868
587 Ga0495612_0018286 3300053078 Bacteria 2808
588 Ga0495619_0111174 3300053085 Bacteria 1872
589 Ga0501084_0110106 3300054114 Bacteria 2314
590 Ga0501082_0063082 3300060353 Bacteria 3191
591 Ga0530510_0007515 3300061734 Bacteria 7590
592 Ga0495603_0140527
593 Ga0065715_10013140
594 Ga0065715_10134779
595 Ga0070676_10000101
596 Ga0070676_10069411
597 Ga0070676_10262405
598 Ga0070690_100008126
599 Ga0070690_100300570
600 Ga0070670_100044711
601 Ga0070670_100198719
602 Ga0070670_100247343
603 Ga0070670_100256607
604 Ga0070670_100354683
605 Ga0070670_100722074
606 Ga0070677_10023693
607 Ga0070677_10169596
608 Ga0070677_10224284
609 Ga0068869_100004676
610 Ga0068869_100296818
611 Ga0070666_10006335
612 Ga0070666_10103994
613 Ga0070666_10354842
614 Ga0070682_100071815
615 Ga0068868_100194263
616 Ga0068868_100337060
617 Ga0070660_100322818
618 Ga0070661_100020975
619 Ga0070661_100085741
620 Ga0070661_100285316
621 Ga0070668_100003342
622 Ga0070668_100056117
623 Ga0070668_100117206
624 Ga0070668_100759510
625 Ga0070669_100000736
626 Ga0070669_100031072
627 Ga0070669_100210501
628 Ga0070669_100857577
629 Ga0070675_100046723
630 Ga0070675_100125332
631 Ga0070675_100599912
632 Ga0070671_100008194
633 Ga0070671_100010572
634 Ga0070671_100031962
635 Ga0070671_100110104
636 Ga0070671_100127658
637 Ga0070674_100001055
638 Ga0070674_100057821
639 Ga0070673_100059057
640 Ga0070659_100002514
641 Ga0070667_100000911
642 Ga0070709_10008851
643 Ga0070713_100054486
644 Ga0070713_100663126
645 Ga0070711_100853846
646 Ga0070700_100717075
647 Ga0070663_100009320
648 Ga0070678_100023877
649 Ga0070678_100050825
650 Ga0070678_100064684
651 Ga0070678_100124271
652 Ga0070678_101041507
653 Ga0070662_100000248
654 Ga0070662_100009651
655 Ga0070662_100032471
656 Ga0070662_100186094
657 Ga0070662_100279826
658 Ga0070681_10008343
659 Ga0068867_100002478
660 Ga0068867_100006095
661 Ga0068867_100018802
662 Ga0068867_100161639
663 Ga0070685_10681668
664 Ga0070679_100486878
665 Ga0068853_100130371
666 Ga0068853_100142181
667 Ga0068853_100504936
668 Ga0070672_100000298
669 Ga0070672_100006518
670 Ga0070672_100205852
671 Ga0070672_100240126
672 Ga0070672_100253803
673 Ga0070686_100068904
674 Ga0070686_100671238
675 Ga0070696_100780467
676 Ga0070693_100187682
677 Ga0070693_100629414
678 Ga0068855_100001259
679 Ga0068855_100027568
680 Ga0068855_100098280
681 Ga0068855_100284887
682 Ga0070664_100008908
683 Ga0070664_100168234
684 Ga0070664_100314562
685 Ga0068854_100036313
686 Ga0068854_100192026
687 Ga0068854_100544948
688 Ga0068856_100000181
689 Ga0068856_100004921
690 Ga0068852_100003271
691 Ga0068852_100152745
692 Ga0068852_100812551
693 Ga0068859_100264425
694 Ga0068859_100878201
695 Ga0068864_100041050
696 Ga0068864_100045250
697 Ga0068864_100525156
698 Ga0068866_10002517
699 Ga0068866_10218516
700 Ga0068861_100003452
701 Ga0068861_100281770
702 Ga0068851_10018572
703 Ga0068851_10082638
704 Ga0068870_10208625
705 Ga0068863_100000830
706 Ga0068863_100022362
707 Ga0068863_100226153
708 Ga0068863_100256032
709 Ga0068863_100724234
710 Ga0068863_100872110
711 Ga0068858_100001155
712 Ga0068858_100086524
713 Ga0068858_100302774
714 Ga0068860_100000796
715 Ga0068860_100189421
716 Ga0068862_100037681
717 Ga0081455_10061678
718 Ga0081455_10468054
719 Ga0081540_1036258
720 Ga0070717_10482741
721 Ga0070712_100076186
722 Ga0070712_100333352
723 Ga0097621_100178113
724 Ga0097621_100263886
725 Ga0097621_100525600
726 Ga0068871_100014907
727 Ga0068871_100158590
728 Ga0075428_100006609
729 Ga0075428_100082937
730 Ga0075431_100006106
731 Ga0075431_100108401
732 Ga0075434_100289431
733 Ga0075429_100012805
734 Ga0068865_100001586
735 Ga0068865_100007519
736 Ga0068865_100126883
737 Ga0068865_100244733
738 Ga0068865_100423017
739 Ga0068865_100579843
740 Ga0075436_100315165
741 Ga0097620_100264407
742 Ga0097620_100878241
743 Ga0111539_10549676
744 Ga0111539_10676348
745 Ga0114129_10000005
746 Ga0114129_10016886
747 Ga0114129_10474476
748 Ga0105243_10014891
749 Ga0105241_10120373
750 Ga0105242_10018254
751 Ga0105242_10024340
752 Ga0105242_10573080
753 Ga0105248_10007457
754 Ga0105248_10035717
755 Ga0105248_10040894
756 Ga0105248_10093743
757 Ga0105248_10501479
758 Ga0105248_10775716
759 Ga0105238_10156942
760 Ga0105249_10031876
761 Ga0105249_10232531
762 Ga0105239_10211046
763 Ga0105246_10464190
764 Ga0105246_10466640
765 Ga0157371_10000221
766 Ga0157370_10048936
767 Ga0157370_10155262
768 Ga0157370_10244033
769 Ga0157369_10021715
770 Ga0157369_10169159
771 Ga0157369_10567331
772 Ga0157374_10145614
773 Ga0157374_10290105
774 Ga0163162_10004930
775 Ga0163162_10016912
776 Ga0163162_10102989
777 Ga0163162_10112431
778 Ga0163162_10198646
779 Ga0163162_10386687
780 Ga0157372_10000546
781 Ga0157372_10045693
782 Ga0157375_10001027
783 Ga0157375_10009764
784 Ga0157375_10014497
785 Ga0157375_10037005
786 Ga0157375_10119027
787 Ga0157375_10275507
788 Ga0163163_10237752
789 Ga0163163_10675326
790 Ga0157380_10000360
791 Ga0157380_10393696
792 Ga0157377_10192749
793 Ga0157379_10020533
794 Ga0157379_10160371
795 Ga0157379_10347311
796 Ga0157379_10375481
797 Ga0157376_10382129
798 Ga0157376_10522774
799 Ga0157376_10579637
800 Ga0163161_10001228
801 Ga0163161_10107246
802 Ga0163161_10173461
803 Ga0163161_10193158
804 Ga0163161_10373089
805 Ga0209050_1004532
806 Ga0207697_10005006
807 Ga0207697_10006847
808 Ga0207656_10013551
809 Ga0207682_10004587
810 Ga0207682_10011771
811 Ga0207682_10245730
812 Ga0207642_10013803
813 Ga0207688_10075148
814 Ga0207680_10041824
815 Ga0207680_10053775
816 Ga0207647_10072400
817 Ga0207645_10004531
818 Ga0207645_10025878
819 Ga0207705_10129201
820 Ga0207705_10399820
821 Ga0207654_10017416
822 Ga0207654_10135919
823 Ga0207707_10077924
824 Ga0207707_10140700
825 Ga0207693_10010583
826 Ga0207693_10122785
827 Ga0207663_10067944
828 Ga0207660_10069384
829 Ga0207662_10009408
830 Ga0207657_10000596
831 Ga0207657_10099266
832 Ga0207649_10003941
833 Ga0207649_10115964
834 Ga0207649_10235457
835 Ga0207649_10552266
836 Ga0207652_10243405
837 Ga0207681_10000592
838 Ga0207681_10013076
839 Ga0207681_10065318
840 Ga0207650_10010191
841 Ga0207650_10084049
842 Ga0207650_10087822
843 Ga0207650_10212746
844 Ga0207650_10256500
845 Ga0207650_10662078
846 Ga0207650_10698994
847 Ga0207659_10006611
848 Ga0207659_10021777
849 Ga0207659_10022473
850 Ga0207659_10195610
851 Ga0207659_10492924
852 Ga0207700_10083392
853 Ga0207700_10370345
854 Ga0207644_10005044
855 Ga0207644_10014930
856 Ga0207644_10046510
857 Ga0207644_10070496
858 Ga0207690_10000419
859 Ga0207690_10143180
860 Ga0207690_10644519
861 Ga0207706_10000074
862 Ga0207706_10002518
863 Ga0207706_10019690
864 Ga0207706_10227285
865 Ga0207686_10020451
866 Ga0207686_10035011
867 Ga0207686_10214443
868 Ga0207686_10228944
869 Ga0207709_10003323
870 Ga0207669_10000756
871 Ga0207669_10107277
872 Ga0207669_10109329
873 Ga0207669_10177038
874 Ga0207704_10000750
875 Ga0207704_10048038
876 Ga0207704_10083377
877 Ga0207704_10134599
878 Ga0207704_10390468
879 Ga0207691_10001866
880 Ga0207691_10014808
881 Ga0207691_10103201
882 Ga0207691_10178725
883 Ga0207711_10011986
884 Ga0207711_10014428
885 Ga0207711_10031161
886 Ga0207711_10041445
887 Ga0207711_10222835
888 Ga0207689_10006195
889 Ga0207661_10118582
890 Ga0207679_10007022
891 Ga0207679_10126902
892 Ga0207679_10183171
893 Ga0207679_10240019
894 Ga0207667_10030975
895 Ga0207667_10307522
896 Ga0207667_10899361
897 Ga0207651_10084601
898 Ga0207651_10399649
899 Ga0207712_10012206
900 Ga0207668_10014767
901 Ga0207668_10033851
902 Ga0207640_10089134
903 Ga0207640_10402079
904 Ga0207640_10631853
905 Ga0207640_10939463
906 Ga0207658_10000510
907 Ga0207658_10067112
908 Ga0207658_10086504
909 Ga0207658_10255718
910 Ga0207658_10376149
911 Ga0207677_10445572
912 Ga0207677_11011019
913 Ga0207703_10001422
914 Ga0207703_10293490
915 Ga0207639_10032306
916 Ga0207639_10283807
917 Ga0207639_10540742
918 Ga0207639_10553527
919 Ga0207678_10007835
920 Ga0207708_10484405
921 Ga0207702_10001390
922 Ga0207702_10153702
923 Ga0207641_10001218
924 Ga0207641_10056997
925 Ga0207641_10162067
926 Ga0207641_10210230
927 Ga0207648_10001492
928 Ga0207648_10012368
929 Ga0207648_10018499
930 Ga0207648_10104243
931 Ga0207676_10036241
932 Ga0207676_10040883
933 Ga0207676_10151988
934 Ga0207676_10418284
935 Ga0207675_100001773
936 Ga0207675_100275507
937 Ga0207683_10005185
938 Ga0207683_10085823
939 Ga0207683_10150989
940 Ga0207683_10227010
941 Ga0207683_11180612
942 Ga0207698_10012687
943 Ga0207698_10060728
944 Ga0207698_10196320
945 Ga0207698_10406415
946 Ga0207428_10613387
947 Ga0268265_10005696
948 Ga0268264_10028083
949 Ga0268264_10192730
950 Ga0268264_10988880
951 Ga0307416_100220057
952 Ga0307414_10585342
953 Ga0307415_100133291
954 Ga0373926_0034130
955 Ga0373926_0181272
956 Ga0373945_0177915
957 Ga0373943_0026826
958 Ga0373924_0020099
959 Ga0373931_0069174
960 Ga0373935_0112178
961 Ga0373933_0161205
962 Ga0373947_0088546
963 Ga0373925_0026288
964 Ga0373925_0336654
965 Ga0395899_0003912
966 Ga0395899_0011242
967 Ga0395900_0001162
968 Ga0395900_0020459
969 Ga0395898_0003358
970 Ga0395905_0004279
971 Ga0395905_0238031
972 Ga0395901_0011447
973 Ga0395901_0175269
974 Ga0439449_0027200
975 Ga0451577_0000058
976 Ga0453684_0000279
977 Ga0466971_0093729
978 Ga0466957_0035583
979 Ga0451576_0001134
980 Ga0466967_0005963
981 Ga0495617_000030
982 Ga0495627_000228
983 Ga0495627_022678
984 Ga0495629_0011521
985 Ga0495653_0007080
986 Ga0495580_0156956
987 Ga0495582_0113473
988 Ga0495605_0000046
989 Ga0495605_0012885
990 Ga0495605_0017171
991 Ga0495605_0035670
992 Ga0495584_0001630
993 Ga0495584_0064863
994 Ga0495584_0172202
995 Ga0495585_0000410
996 Ga0495585_0003320
997 Ga0495594_0033471
998 Ga0495594_0289775
999 Ga0495596_0000846
1000 Ga0495596_0005147
1001 Ga0495596_0005570
1002 Ga0495596_0019781
1003 Ga0495607_0001168
1004 Ga0495607_0052992
1005 Ga0495583_0000142
1006 Ga0495583_0007855
1007 Ga0495583_0012652
1008 Ga0495583_0023203
1009 Ga0495583_0143298
1010 Ga0495606_0089051
1011 Ga0495616_0034366
1012 Ga0495616_0041717
1013 Ga0495616_0064515
1014 Ga0495630_0014901
1015 Ga0495631_0006519
1016 Ga0495631_0009677
1017 Ga0495631_0014950
1018 Ga0495631_0203581
1019 Ga0495632_0003811
1020 Ga0495632_0049842
1021 Ga0495643_0018799
1022 Ga0495644_0002504
1023 Ga0495644_0017039
1024 Ga0495644_0029568
1025 Ga0495648_0000815
1026 Ga0495666_0003566
1027 Ga0495666_0156403
1028 Ga0495642_0000013
1029 Ga0495642_0017369
1030 Ga0495642_0040232
1031 Ga0495642_0093510
1032 Ga0495654_0004974
1033 Ga0495665_0007660
1034 Ga0495586_0089053
1035 Ga0495586_0385626
1036 Ga0495587_0018542
1037 Ga0495609_0000948
1038 Ga0495609_0005910
1039 Ga0495609_0021179
1040 Ga0495609_0102637
1041 Ga0495621_0033547
1042 Ga0495621_0101783
1043 Ga0495597_0006125
1044 Ga0495597_0020490
1045 Ga0495645_0571727
1046 Ga0495622_0094057
1047 Ga0495633_0037882
1048 Ga0495633_0045305
1049 Ga0495656_0150497
1050 Ga0495656_0166527
1051 Ga0495668_0000373
1052 Ga0495668_0046915
1053 Ga0495668_0134968
1054 Ga0495668_0162213
1055 Ga0495611_0011487
1056 Ga0495611_0049033
1057 Ga0495625_0006300
1058 Ga0495661_0009522
1059 Ga0495661_0013871
1060 Ga0495661_0024686
1061 Ga0495661_0056187
1062 Ga0495661_0065767
1063 Ga0495661_0272031
1064 Ga0495588_0002056
1065 Ga0495623_0060908
1066 Ga0495658_0247497
1067 Ga0495669_0001491
1068 Ga0495669_0006852
1069 Ga0495669_0048252
1070 Ga0495613_0109696
1071 Ga0495613_0307319
1072 Ga0495624_0001290
1073 Ga0495670_0012853
1074 Ga0495670_0029128
1075 Ga0495671_0000989
1076 Ga0495589_0018014
1077 Ga0495589_0027534
1078 Ga0495600_0149738
1079 Ga0495660_0047873
1080 Ga0495581_0208481
1081 Ga0495604_0060867
1082 Ga0495604_0232047
1083 Ga0495672_0042963
1084 Ga0495672_0112700
1085 Ga0495676_0009654
1086 Ga0495676_0015149
1087 Ga0495676_0041025
1088 Ga0495676_0492953
1089 Ga0495680_0036776
1090 Ga0495675_0141733
1091 Ga0495677_0002312
1092 Ga0495677_0005272
1093 Ga0495679_026066
1094 Ga0495685_076668
1095 Ga0495673_0007840
1096 Ga0495681_0009180
1097 Ga0495681_0012177
1098 Ga0495593_0006234
1099 Ga0495602_0012852
1100 Ga0495614_0103330
1101 Ga0495615_0003349
1102 Ga0495626_0001381
1103 Ga0495626_0002812
1104 Ga0495626_0006393
1105 Ga0495626_0009558
1106 Ga0495626_0027417
1107 Ga0495626_0028758
1108 Ga0495626_0040255
1109 Ga0496101_0606039
1110 Ga0496102_0000231
1111 Ga0496102_0000943
1112 Ga0496102_0001702
1113 Ga0496102_0301316
1114 Ga0496103_0049971
1115 Ga0496103_0051518
1116 Ga0496103_0103977
1117 Ga0496104_0000005
1118 Ga0496104_0047410
1119 Ga0496105_0000106
1120 Ga0496105_0141427
1121 Ga0496105_0611819
1122 Ga0496106_0001506
1123 Ga0496107_0012164
1124 Ga0496107_0142314
1125 Ga0496108_0263696
1126 Ga0496108_0452342
1127 Ga0496109_0084620
1128 Ga0496109_0104821
1129 Ga0496110_0159180
1130 Ga0496110_0630742
1131 Ga0496112_0038804
1132 Ga0496113_0303283
1133 Ga0496114_0012861
1134 Ga0496121_0230157
1135 Ga0496124_0002249
1136 Ga0495678_007207
1137 Ga0495682_0014012
1138 Ga0495682_0051125
1139 Ga0501033_0105330
1140 Ga0501034_0002589
1141 Ga0501036_0214161
1142 Ga0501037_0218628
1143 Ga0501038_0196655
1144 Ga0501038_0483855
1145 Ga0501039_0052036
1146 Ga0501039_0076109
1147 Ga0501040_0044724
1148 Ga0501041_0150614
1149 Ga0501043_0177384
1150 Ga0501046_0061483
1151 Ga0501046_0148497
1152 Ga0501048_0088350
1153 Ga0501068_0096756
1154 Ga0501071_0019978
1155 Ga0501071_0121639
1156 Ga0501072_0043830
1157 Ga0501074_0424267
1158 Ga0501075_0010572
1159 Ga0501075_0256244
1160 Ga0501076_0012122
1161 Ga0501076_0560963
1162 Ga0501077_0222286
1163 Ga0501079_0040966
1164 Ga0501079_0228273
1165 Ga0501081_0026219
1166 Ga0501081_0039813
1167 Ga0501083_0142869
1168 Ga0501035_0321483
1169 Ga0501045_0061879
1170 nmdc:mga05p37_16495_c1
1171 nmdc:mga05p37_534646_c1
1172 nmdc:mga05p37_75835_c1
1173 nmdc:mga09592_11152_c1
1174 nmdc:mga06r32_176363_c1
1175 nmdc:mga06r32_458597_c1
1176 nmdc:mga06r32_771_c1
1177 nmdc:mga0n895_233101_c1
1178 Ga0495612_0018286
1179 Ga0495619_0111174
1180 Ga0501084_0110106
1181 Ga0501082_0063082
1182 Ga0530510_0007515

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

38

249

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k6m-assembly2.cif.gz_D dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. 0.9192 3 199
1ooz-assembly1.cif.gz_B deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart 0.9164 3 199
3dlx-assembly2.cif.gz_C crystal structure of human 3-oxoacid coa transferase 1 0.9164 6 199
5dbn-assembly2.cif.gz_E crystal structure of atoda complex 0.9157 4 200
1ooz-assembly1.cif.gz_A deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart 0.9154 3 199
ID Description Score Start End Superfamily
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.907 3 199 3.40.1080.10
af_A4I5L9_2_259_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8998 4 201 3.40.1080.10
af_Q4E2P8_5_264_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8894 3 200 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8838 4 207 3.40.1080.10
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8307 3 199 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A559GBE8-F1-model_v4 CoA transferase subunit A 0.9539 1 154 GO:0008410
AF-A0A0F2S9H6-F1-model_v4 Branched-chain amino acid dehydrogenase 0.9487 1 154 GO:0008410
AF-Q7P939-F1-model_v4 Putative succinyl-CoA:3-ketoacid-coenzyme A transferase 0.9435 18 152 GO:0008410
AF-A0A7Z9KKT0-F1-model_v4 CoA transferase subunit A 0.9394 1 125 GO:0008410
AF-A0A5A7MRX1-F1-model_v4 merged 0.9387 5 152

Map