F467140

General Info

Members Datasets Scaffolds Average Seq Length
592 330 582 131

Family's Representative Sequence

Representative Sequence 3300025932|Ga0207690_10699367|Ga0207690_106993672
Length 153
Sequence MTSMSNAAWPCWPLTIGIKLTEPTTGGMLLLGERDIVMSRQQVRKLTQQIKFTLVDQTKMITAASELSRNTVVYGGGGEMRWEILQQGIKTGLRLWFEDKGPGIPDVALALTDGWTSGSGMGVGLSGSKRLVNEFEIRTVVGEGTCVIVTRWK

Samples

Sample ID Description Type Environment
1 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
2 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
3 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
4 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
5 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
6 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
7 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
8 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
9 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
108 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
117 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
118 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
177 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
178 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
182 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
183 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
184 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
185 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
187 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
188 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
189 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
190 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
191 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
192 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
222 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
225 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
226 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
230 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
231 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
232 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
249 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
250 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
262 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
276 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
277 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
278 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
279 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
318 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
319 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
320 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
321 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
322 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
323 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
324 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
325 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
326 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
327 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
328 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
329 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
330 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.8
Metatranscriptomes 0.51
Isolates 1.69

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 14.53
Nodule 0
Rhizoplane 3.55
Rhizosphere 70.95
Stem 0
Stem Tuber 0
Unclassified 10.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000033 3300002773 Bacteria 95187
2 JGI25150J39212_1000151 3300002774 Bacteria 39298
3 JGI25151J46595_10000142 3300003187 Bacteria 95187
4 JGI25151J46595_10002153 3300003187 Bacteria 12230
5 JGI25153J46596_10000107 3300003215 Bacteria 95187
6 Ga0055539_1000524 3300003752 Bacteria 11718
7 Ga0055533_1000033 3300003756 Bacteria 265716
8 Ga0055525_1000084 3300003759 Bacteria 155319
9 Ga0055525_1001150 3300003759 Bacteria 6259
10 Ga0055526_1001795 3300003771 Bacteria 14858
11 Ga0055537_1000201 3300003773 Bacteria 44718
12 Ga0055537_1007383 3300003773 Bacteria 2655
13 Ga0055524_1000013 3300003775 Bacteria 259850
14 Ga0055524_1001046 3300003775 Bacteria 17071
15 Ga0055524_1035556 3300003775 Bacteria 1356
16 Ga0055536_1039856 3300003781 Bacteria 1124
17 Ga0055534_1000075 3300003784 Bacteria 77072
18 Ga0055534_1003936 3300003784 Bacteria 4478
19 Ga0055528_1000271 3300003790 Bacteria 43963
20 Ga0055528_1002305 3300003790 Bacteria 10341
21 Ga0055530_10000771 3300003791 Bacteria 26703
22 Ga0055530_10000810 3300003791 Bacteria 25993
23 Ga0055530_10003077 3300003791 Bacteria 9917
24 Ga0055530_10121864 3300003791 Bacteria 505
25 Ga0055540_1024256 3300003792 Bacteria 1508
26 Ga0055540_1024829 3300003792 Bacteria 1480
27 Ga0055531_10009298 3300003794 Bacteria 5042
28 Ga0055531_10041919 3300003794 Bacteria 1317
29 Ga0055531_10049685 3300003794 Bacteria 1118
30 Ga0065165_1087303 3300005262 Bacteria 800
31 Ga0065712_10366399 3300005290 Bacteria 768
32 Ga0065715_10143022 3300005293 Bacteria 1826
33 Ga0065707_10105030 3300005295 Bacteria 2666
34 Ga0070658_10107275 3300005327 Bacteria 2311
35 Ga0070658_10195570 3300005327 Bacteria 1705
36 Ga0070676_10010887 3300005328 Bacteria 4939
37 Ga0070676_10035979 3300005328 Bacteria 2850
38 Ga0070683_100079138 3300005329 Bacteria 3076
39 Ga0070690_100698536 3300005330 Bacteria 779
40 Ga0070670_100008583 3300005331 Bacteria 8716
41 Ga0070670_100053650 3300005331 Bacteria 3461
42 Ga0070670_100089561 3300005331 Bacteria 2645
43 Ga0070670_100266907 3300005331 Bacteria 1493
44 Ga0070677_10000532 3300005333 Bacteria 13026
45 Ga0070677_10001160 3300005333 Bacteria 8472
46 Ga0070677_10152565 3300005333 Bacteria 1076
47 Ga0070677_10357643 3300005333 Unclassified 758
48 Ga0068869_101439813 3300005334 Bacteria 611
49 Ga0070680_100058141 3300005336 Bacteria 3162
50 Ga0068868_100201879 3300005338 Bacteria 1658
51 Ga0068868_100391055 3300005338 Bacteria 1198
52 Ga0068868_100946615 3300005338 Bacteria 785
53 Ga0070689_100738574 3300005340 Bacteria 862
54 Ga0070661_100172890 3300005344 Bacteria 1641
55 Ga0070668_101241076 3300005347 Bacteria 676
56 Ga0070669_100192754 3300005353 Bacteria 1599
57 Ga0070675_100001226 3300005354 Bacteria 18654
58 Ga0070675_100031610 3300005354 Bacteria 4281
59 Ga0070675_100066881 3300005354 Bacteria 2973
60 Ga0070675_100247771 3300005354 Bacteria 1558
61 Ga0070671_100002269 3300005355 Bacteria 14840
62 Ga0070671_100127606 3300005355 Bacteria 2142
63 Ga0070671_100158279 3300005355 Bacteria 1914
64 Ga0070671_100203465 3300005355 Bacteria 1679
65 Ga0070674_100055454 3300005356 Bacteria 2745
66 Ga0070674_100134245 3300005356 Bacteria 1849
67 Ga0070674_100429736 3300005356 Bacteria 1085
68 Ga0070673_100162273 3300005364 Bacteria 1901
69 Ga0070673_100239877 3300005364 Bacteria 1576
70 Ga0070673_100264984 3300005364 Bacteria 1502
71 Ga0070673_102025097 3300005364 Bacteria 547
72 Ga0070659_100889075 3300005366 Bacteria 778
73 Ga0070667_100084105 3300005367 Bacteria 2727
74 Ga0070667_100372616 3300005367 Bacteria 1296
75 Ga0070694_100045455 3300005444 Bacteria 2943
76 Ga0070678_100008183 3300005456 Bacteria 6251
77 Ga0070678_100043701 3300005456 Bacteria 3194
78 Ga0070678_100134298 3300005456 Bacteria 1971
79 Ga0070678_100187252 3300005456 Bacteria 1699
80 Ga0070678_101038855 3300005456 Bacteria 754
81 Ga0070662_100008313 3300005457 Bacteria 6763
82 Ga0068867_100003616 3300005459 Bacteria 10876
83 Ga0068867_100199954 3300005459 Bacteria 1599
84 Ga0068867_100345285 3300005459 Bacteria 1240
85 Ga0068867_100395171 3300005459 Bacteria 1165
86 Ga0068867_100510106 3300005459 Bacteria 1035
87 Ga0068867_100576886 3300005459 Bacteria 978
88 Ga0070679_100005760 3300005530 Bacteria 11491
89 Ga0070679_100355445 3300005530 Unclassified 1413
90 Ga0070684_100438173 3300005535 Bacteria 1207
91 Ga0068853_100280971 3300005539 Bacteria 1535
92 Ga0070672_100011710 3300005543 Bacteria 6126
93 Ga0070672_100050606 3300005543 Bacteria 3237
94 Ga0070672_100082872 3300005543 Bacteria 2573
95 Ga0070672_100225072 3300005543 Bacteria 1574
96 Ga0070672_101026913 3300005543 Bacteria 731
97 Ga0070695_100022455 3300005545 Bacteria 3870
98 Ga0070696_100010058 3300005546 Bacteria 6330
99 Ga0070665_100162380 3300005548 Bacteria 2236
100 Ga0070665_100207935 3300005548 Bacteria 1958
101 Ga0070665_100222965 3300005548 Bacteria 1886
102 Ga0070704_100217433 3300005549 Bacteria 1552
103 Ga0068855_100123731 3300005563 Bacteria 2959
104 Ga0068855_100123758 3300005563 Bacteria 2958
105 Ga0068855_101146781 3300005563 Bacteria 810
106 Ga0070664_100060524 3300005564 Bacteria 3225
107 Ga0068857_100695723 3300005577 Bacteria 966
108 Ga0068856_100561534 3300005614 Bacteria 1163
109 Ga0068856_102025414 3300005614 Bacteria 586
110 Ga0068852_100318908 3300005616 Bacteria 1509
111 Ga0068852_101236234 3300005616 Bacteria 768
112 Ga0068864_100008984 3300005618 Bacteria 8242
113 Ga0068866_10193245 3300005718 Bacteria 1211
114 Ga0068861_100270155 3300005719 Bacteria 1460
115 Ga0068861_100770564 3300005719 Bacteria 900
116 Ga0068851_10021181 3300005834 Bacteria 3156
117 Ga0068851_10256008 3300005834 Bacteria 994
118 Ga0068870_10170319 3300005840 Bacteria 1299
119 Ga0068870_10216397 3300005840 Bacteria 1170
120 Ga0068870_10325987 3300005840 Bacteria 977
121 Ga0068863_100834438 3300005841 Bacteria 920
122 Ga0075363_100318861 3300006048 Bacteria 904
123 Ga0075364_10086872 3300006051 Bacteria 2072
124 Ga0070715_10447997 3300006163 Bacteria 728
125 Ga0070712_100335500 3300006175 Bacteria 1233
126 Ga0075367_10220061 3300006178 Bacteria 1188
127 Ga0097621_100009546 3300006237 Bacteria 7048
128 Ga0097621_100304675 3300006237 Bacteria 1408
129 Ga0075370_10449697 3300006353 Bacteria 775
130 Ga0068871_100013746 3300006358 Bacteria 6018
131 Ga0075431_100648042 3300006847 Bacteria 1037
132 Ga0068865_100370346 3300006881 Bacteria 1166
133 Ga0105244_10019427 3300009036 Bacteria 3792
134 Ga0105240_10079655 3300009093 Bacteria 4030
135 Ga0105240_10114002 3300009093 Bacteria 3266
136 Ga0105245_10035169 3300009098 Bacteria 4446
137 Ga0105245_10244486 3300009098 Bacteria 1741
138 Ga0105245_10584753 3300009098 Bacteria 1141
139 Ga0105243_10179153 3300009148 Bacteria 1842
140 Ga0105242_10471059 3300009176 Bacteria 1188
141 Ga0105248_10485036 3300009177 Bacteria 1393
142 Ga0105248_11688165 3300009177 Unclassified 718
143 Ga0105237_11692355 3300009545 Bacteria 640
144 Ga0105238_10000084 3300009551 Bacteria 106982
145 Ga0105238_10410976 3300009551 Bacteria 1347
146 Ga0105238_10584158 3300009551 Bacteria 1124
147 Ga0105249_11870280 3300009553 Bacteria 673
148 Ga0105239_10531956 3300010375 Bacteria 1338
149 Ga0105239_11093337 3300010375 Bacteria 918
150 Ga0157373_10179905 3300013100 Bacteria 1489
151 Ga0157371_10000206 3300013102 Bacteria 86320
152 Ga0157371_10280702 3300013102 Bacteria 1203
153 Ga0157370_10008242 3300013104 Bacteria 11254
154 Ga0157370_10427707 3300013104 Bacteria 1218
155 Ga0157370_10431207 3300013104 Bacteria 1212
156 Ga0157369_10672406 3300013105 Bacteria 1067
157 Ga0157369_12087809 3300013105 Bacteria 575
158 Ga0157374_11180734 3300013296 Bacteria 786
159 Ga0157378_10721458 3300013297 Bacteria 1018
160 Ga0163162_10036589 3300013306 Bacteria 4894
161 Ga0163162_10789010 3300013306 Bacteria 1068
162 Ga0163162_10805219 3300013306 Bacteria 1057
163 Ga0157372_10208049 3300013307 Bacteria 2267
164 Ga0157372_10239292 3300013307 Bacteria 2106
165 Ga0157375_10018984 3300013308 Bacteria 6242
166 Ga0157375_10128613 3300013308 Bacteria 2651
167 Ga0163163_12768264 3300014325 Bacteria 547
168 Ga0157380_10142640 3300014326 Bacteria 2060
169 Ga0157380_11565932 3300014326 Bacteria 714
170 Ga0182008_10000362 3300014497 Bacteria 35395
171 Ga0182008_10094359 3300014497 Bacteria 1476
172 Ga0157379_10740318 3300014968 Bacteria 925
173 Ga0157376_10867821 3300014969 Bacteria 919
174 Ga0157376_11365261 3300014969 Bacteria 740
175 Ga0182006_1024490 3300015261 Bacteria 2488
176 Ga0182006_1042246 3300015261 Bacteria 1787
177 Ga0182007_10000061 3300015262 Bacteria 88102
178 Ga0182005_1000413 3300015265 Bacteria 23140
179 Ga0182005_1009891 3300015265 Bacteria 2757
180 Ga0163161_10000327 3300017792 Bacteria 40625
181 Ga0163161_10013856 3300017792 Bacteria 5616
182 Ga0163161_10262606 3300017792 Bacteria 1349
183 Ga0163161_10551661 3300017792 Bacteria 945
184 Ga0206352_11326968 3300020078 Bacteria 1113
185 Ga0224712_10139864 3300022467 Bacteria 1064
186 Ga0209674_100064 3300025226 Bacteria 265769
187 Ga0209563_100025 3300025230 Bacteria 596456
188 Ga0209563_100099 3300025230 Bacteria 153336
189 Ga0207427_102399 3300025231 Bacteria 5085
190 Ga0209677_100175 3300025253 Bacteria 55052
191 Ga0209677_101039 3300025253 Bacteria 13221
192 Ga0209759_1009118 3300025256 Bacteria 3031
193 Ga0209759_1038691 3300025256 Bacteria 845
194 Ga0209129_1000431 3300025258 Bacteria 31539
195 Ga0209565_1000050 3300025263 Bacteria 213856
196 Ga0209565_1000066 3300025263 Bacteria 173062
197 Ga0209673_1000199 3300025273 Bacteria 120904
198 Ga0209673_1061709 3300025273 Bacteria 933
199 Ga0209675_1000007 3300025291 Bacteria 683430
200 Ga0209675_1000437 3300025291 Bacteria 33080
201 Ga0209675_1068761 3300025291 Bacteria 680
202 Ga0209676_1000018 3300025292 Bacteria 631385
203 Ga0209676_1000075 3300025292 Bacteria 303609
204 Ga0209025_1001993 3300025294 Bacteria 23406
205 Ga0209564_1000061 3300025295 Bacteria 322795
206 Ga0209564_1001906 3300025295 Bacteria 18662
207 Ga0209758_1007663 3300025297 Bacteria 7272
208 Ga0209758_1033199 3300025297 Bacteria 2079
209 Ga0209050_1000424 3300025298 Bacteria 77803
210 Ga0209050_1000610 3300025298 Bacteria 56686
211 Ga0209050_1007404 3300025298 Bacteria 6165
212 Ga0209050_1051256 3300025298 Bacteria 1042
213 Ga0209256_1000061 3300025299 Bacteria 260890
214 Ga0209256_1002355 3300025299 Bacteria 15718
215 Ga0209256_1004229 3300025299 Bacteria 9203
216 Ga0209256_1008618 3300025299 Bacteria 4678
217 Ga0209256_1043595 3300025299 Bacteria 1125
218 Ga0209051_1000809 3300025303 Bacteria 32636
219 Ga0209051_1006037 3300025303 Bacteria 6915
220 Ga0209051_1043373 3300025303 Bacteria 1579
221 Ga0209257_1000035 3300025304 Bacteria 631463
222 Ga0209257_1003209 3300025304 Bacteria 14464
223 Ga0209257_1024310 3300025304 Bacteria 2101
224 Ga0207697_10170652 3300025315 Bacteria 951
225 Ga0207656_10295045 3300025321 Bacteria 802
226 Ga0207682_10000804 3300025893 Bacteria 14510
227 Ga0207682_10003073 3300025893 Bacteria 7322
228 Ga0207682_10123745 3300025893 Bacteria 1149
229 Ga0207682_10358892 3300025893 Bacteria 687
230 Ga0207682_10569760 3300025893 Bacteria 535
231 Ga0207642_10167184 3300025899 Bacteria 1186
232 Ga0207680_10046055 3300025903 Bacteria 2576
233 Ga0207685_10148203 3300025905 Bacteria 1059
234 Ga0207645_10050584 3300025907 Bacteria 2653
235 Ga0207645_10055582 3300025907 Bacteria 2527
236 Ga0207645_10079980 3300025907 Bacteria 2095
237 Ga0207645_10087025 3300025907 Bacteria 2007
238 Ga0207643_10054285 3300025908 Bacteria 2277
239 Ga0207643_10166455 3300025908 Bacteria 1328
240 Ga0207643_10354228 3300025908 Bacteria 922
241 Ga0207705_10076200 3300025909 Bacteria 2438
242 Ga0207705_10340361 3300025909 Bacteria 1155
243 Ga0207707_10337008 3300025912 Bacteria 1301
244 Ga0207695_10082179 3300025913 Bacteria 3258
245 Ga0207695_10204674 3300025913 Bacteria 1887
246 Ga0207693_10241086 3300025915 Bacteria 1419
247 Ga0207660_10028681 3300025917 Bacteria 3808
248 Ga0207649_10056951 3300025920 Bacteria 2442
249 Ga0207652_10011926 3300025921 Bacteria 7014
250 Ga0207652_11221874 3300025921 Unclassified 653
251 Ga0207681_10023843 3300025923 Bacteria 3919
252 Ga0207681_10301653 3300025923 Bacteria 1268
253 Ga0207681_10446966 3300025923 Bacteria 1051
254 Ga0207694_10004778 3300025924 Bacteria 10532
255 Ga0207694_10105564 3300025924 Bacteria 2236
256 Ga0207650_10000667 3300025925 Bacteria 26981
257 Ga0207650_10120337 3300025925 Bacteria 2043
258 Ga0207650_10401715 3300025925 Bacteria 1134
259 Ga0207650_10450859 3300025925 Bacteria 1071
260 Ga0207650_11248664 3300025925 Bacteria 632
261 Ga0207659_10002105 3300025926 Bacteria 11788
262 Ga0207659_10020753 3300025926 Bacteria 4349
263 Ga0207659_10080176 3300025926 Bacteria 2411
264 Ga0207659_10214112 3300025926 Bacteria 1546
265 Ga0207659_10776007 3300025926 Bacteria 823
266 Ga0207687_10073458 3300025927 Bacteria 2448
267 Ga0207687_10350261 3300025927 Bacteria 1203
268 Ga0207644_10009455 3300025931 Bacteria 6401
269 Ga0207644_10331746 3300025931 Bacteria 1232
270 Ga0207644_10498352 3300025931 Bacteria 1004
271 Ga0207644_10673350 3300025931 Bacteria 862
272 Ga0207644_10886171 3300025931 Bacteria 748
273 Ga0207690_10664094 3300025932 Bacteria 855
274 Ga0207690_10699367 3300025932 Bacteria 833
275 Ga0207706_10008467 3300025933 Bacteria 9487
276 Ga0207706_10848419 3300025933 Bacteria 774
277 Ga0207686_10333671 3300025934 Bacteria 1137
278 Ga0207686_10669563 3300025934 Bacteria 822
279 Ga0207670_10383055 3300025936 Bacteria 1121
280 Ga0207670_10662186 3300025936 Bacteria 862
281 Ga0207669_10001145 3300025937 Bacteria 11318
282 Ga0207669_10060730 3300025937 Bacteria 2319
283 Ga0207669_10137467 3300025937 Bacteria 1690
284 Ga0207669_10150745 3300025937 Bacteria 1628
285 Ga0207669_10438272 3300025937 Bacteria 1032
286 Ga0207704_10305653 3300025938 Bacteria 1220
287 Ga0207691_10007338 3300025940 Bacteria 10633
288 Ga0207691_10030858 3300025940 Bacteria 5006
289 Ga0207691_10068826 3300025940 Bacteria 3198
290 Ga0207691_10083474 3300025940 Bacteria 2868
291 Ga0207711_10840100 3300025941 Unclassified 855
292 Ga0207711_10955469 3300025941 Bacteria 796
293 Ga0207689_10581584 3300025942 Bacteria 941
294 Ga0207689_11089476 3300025942 Bacteria 673
295 Ga0207661_10157076 3300025944 Bacteria 1971
296 Ga0207661_10172749 3300025944 Bacteria 1882
297 Ga0207679_10009792 3300025945 Bacteria 6149
298 Ga0207667_10095030 3300025949 Bacteria 3077
299 Ga0207667_10338553 3300025949 Bacteria 1535
300 Ga0207651_10015951 3300025960 Bacteria 4384
301 Ga0207651_10260674 3300025960 Bacteria 1423
302 Ga0207668_10047610 3300025972 Bacteria 2937
303 Ga0207668_11062656 3300025972 Bacteria 725
304 Ga0207658_10116867 3300025986 Bacteria 2119
305 Ga0207658_10138061 3300025986 Bacteria 1969
306 Ga0207677_10131730 3300026023 Bacteria 1900
307 Ga0207639_10411781 3300026041 Bacteria 1220
308 Ga0207678_10084616 3300026067 Bacteria 2712
309 Ga0207678_10714213 3300026067 Bacteria 882
310 Ga0207702_10515970 3300026078 Bacteria 1166
311 Ga0207702_11459720 3300026078 Bacteria 678
312 Ga0207641_10202290 3300026088 Bacteria 1832
313 Ga0207641_10303541 3300026088 Bacteria 1509
314 Ga0207648_10008667 3300026089 Bacteria 9815
315 Ga0207648_10056617 3300026089 Bacteria 3421
316 Ga0207648_10318910 3300026089 Bacteria 1396
317 Ga0207648_10371640 3300026089 Bacteria 1291
318 Ga0207648_10918843 3300026089 Bacteria 818
319 Ga0207676_10193504 3300026095 Bacteria 1791
320 Ga0207675_100105217 3300026118 Bacteria 2660
321 Ga0207675_101797481 3300026118 Bacteria 632
322 Ga0207683_10002948 3300026121 Bacteria 14846
323 Ga0207683_10010175 3300026121 Bacteria 8021
324 Ga0207683_10261790 3300026121 Bacteria 1579
325 Ga0207683_10649439 3300026121 Bacteria 977
326 Ga0207698_10269460 3300026142 Bacteria 1569
327 Ga0268266_10319031 3300028379 Bacteria 1454
328 Ga0268266_10624627 3300028379 Bacteria 1036
329 Ga0265319_1015317 3300028563 Bacteria 2978
330 Ga0265334_10129071 3300028573 Bacteria 900
331 Ga0265318_10000771 3300028577 Bacteria 21283
332 Ga0307515_10088177 3300028794 Bacteria 3926
333 Ga0265338_10186467 3300028800 Bacteria 1576
334 Ga0265338_10405982 3300028800 Bacteria 970
335 Ga0265324_10090151 3300029957 Bacteria 1043
336 Ga0307511_10192251 3300030521 Bacteria 1076
337 Ga0316176_1077866 3300030732 Bacteria 2650
338 Ga0316183_1163337 3300030742 Bacteria 12825
339 Ga0265762_1017467 3300030760 Bacteria 1305
340 Ga0265330_10000896 3300031235 Bacteria 18445
341 Ga0265332_10049022 3300031238 Bacteria 1816
342 Ga0265332_10049480 3300031238 Bacteria 1807
343 Ga0265328_10006698 3300031239 Bacteria 4852
344 Ga0265320_10001966 3300031240 Bacteria 14521
345 Ga0265329_10006674 3300031242 Bacteria 4554
346 Ga0265339_10021208 3300031249 Bacteria 3785
347 Ga0265331_10000655 3300031250 Bacteria 29967
348 Ga0265316_10030113 3300031344 Bacteria 4454
349 Ga0307513_10246388 3300031456 Bacteria 1587
350 Ga0307408_100058064 3300031548 Bacteria 2812
351 Ga0265313_10030767 3300031595 Bacteria 2759
352 Ga0265314_10011405 3300031711 Bacteria 7341
353 Ga0265342_10000610 3300031712 Bacteria 37712
354 Ga0307405_10001995 3300031731 Bacteria 8832
355 Ga0307413_10201227 3300031824 Bacteria 1438
356 Ga0307413_10229690 3300031824 Bacteria 1362
357 Ga0307410_10001182 3300031852 Bacteria 11532
358 Ga0307410_10526776 3300031852 Bacteria 976
359 Ga0307406_10031956 3300031901 Bacteria 3209
360 Ga0307406_10149828 3300031901 Bacteria 1663
361 Ga0307407_10072632 3300031903 Bacteria 2053
362 Ga0307407_11199021 3300031903 Bacteria 593
363 Ga0307412_10001505 3300031911 Bacteria 12936
364 Ga0307412_10168641 3300031911 Bacteria 1635
365 Ga0307409_100219814 3300031995 Bacteria 1714
366 Ga0307409_100581240 3300031995 Bacteria 1104
367 Ga0307416_100172782 3300032002 Bacteria 2014
368 Ga0307416_101189009 3300032002 Bacteria 868
369 Ga0307416_101346757 3300032002 Bacteria 820
370 Ga0307414_10043527 3300032004 Bacteria 3059
371 Ga0307414_10051032 3300032004 Bacteria 2869
372 Ga0307414_10332536 3300032004 Bacteria 1297
373 Ga0307414_11021311 3300032004 Bacteria 762
374 Ga0307411_10000810 3300032005 Bacteria 11680
375 Ga0307411_10383475 3300032005 Bacteria 1157
376 Ga0307411_11301255 3300032005 Bacteria 662
377 Ga0307415_100337235 3300032126 Bacteria 1264
378 Ga0373955_0360139 3300035172 Bacteria 882
379 Ga0373931_0001775 3300035691 Bacteria 9370
380 Ga0373927_0102494 3300035695 Bacteria 1862
381 Ga0373927_0208775 3300035695 Bacteria 1283
382 Ga0373927_1118932 3300035695 Bacteria 519
383 Ga0373933_1082063 3300035724 Bacteria 528
384 Ga0373947_0197561 3300035725 Bacteria 1315
385 Ga0373947_0384291 3300035725 Bacteria 945
386 Ga0373937_0611785 3300036401 Bacteria 1034
387 Ga0373925_1557136 3300037068 Bacteria 540
388 Ga0395905_0010184 3300037471 Bacteria 9163
389 Ga0237816_00299 3300039145 Bacteria 4231
390 Ga0436361_0044045 3300039447 Bacteria 1915
391 Ga0436362_0770144 3300039453 Bacteria 749
392 Ga0451791_0025746 3300041451 Bacteria 597
393 Ga0451843_0659177 3300041509 Bacteria 806
394 Ga0451853_3784381 3300041512 Bacteria 901
395 Ga0439431_0004716 3300041997 Bacteria 2999
396 Ga0439432_002824 3300042006 Bacteria 6476
397 Ga0439432_022449 3300042006 Bacteria 2084
398 Ga0450898_007681 3300042134 Bacteria 1684
399 Ga0466963_0699745 3300044694 Unclassified 715
400 Ga0466967_0220668 3300045976 Bacteria 1801
401 Ga0466967_1928123 3300045976 Bacteria 587
402 Ga0495627_048333 3300046453 Bacteria 1287
403 Ga0495627_063540 3300046453 Bacteria 1088
404 Ga0495592_0408035 3300046454 Bacteria 859
405 Ga0495603_0243199 3300046455 Bacteria 1036
406 Ga0495591_063921 3300046458 Bacteria 971
407 Ga0495638_0001027 3300046460 Bacteria 27709
408 Ga0495638_0005621 3300046460 Bacteria 9252
409 Ga0495582_0236137 3300046473 Bacteria 1047
410 Ga0495639_0008923 3300046475 Bacteria 4297
411 Ga0495608_0210859 3300046511 Bacteria 1221
412 Ga0495610_0001846 3300046512 Bacteria 18362
413 Ga0495610_0053495 3300046512 Bacteria 1955
414 Ga0495618_0212915 3300046514 Bacteria 1221
415 Ga0495620_0192636 3300046515 Bacteria 786
416 Ga0495628_0364370 3300046516 Bacteria 1060
417 Ga0495630_0007539 3300046517 Bacteria 7777
418 Ga0495631_0000377 3300046518 Bacteria 30621
419 Ga0495632_0052539 3300046519 Bacteria 2003
420 Ga0495643_0000599 3300046522 Bacteria 43638
421 Ga0495648_0164760 3300046524 Bacteria 1142
422 Ga0495663_0002208 3300046525 Bacteria 5921
423 Ga0495609_0097071 3300046538 Bacteria 1278
424 Ga0495621_0002800 3300046539 Bacteria 4742
425 Ga0495633_0014072 3300046558 Bacteria 4195
426 Ga0495633_0173228 3300046558 Bacteria 994
427 Ga0495625_0079473 3300046660 Bacteria 2286
428 Ga0495625_0342037 3300046660 Bacteria 948
429 Ga0495625_0403392 3300046660 Bacteria 853
430 Ga0495669_0082723 3300046684 Bacteria 1475
431 Ga0495624_0011941 3300046690 Bacteria 5953
432 Ga0495600_0490669 3300046809 Bacteria 756
433 Ga0495581_0276198 3300047315 Bacteria 982
434 Ga0495674_0007171 3300047319 Bacteria 10659
435 Ga0495672_0000417 3300047320 Bacteria 51409
436 Ga0495672_0047338 3300047320 Bacteria 2558
437 Ga0495676_0128395 3300047321 Bacteria 1834
438 Ga0495675_0360533 3300047444 Bacteria 853
439 Ga0495681_0081520 3300047470 Bacteria 1443
440 Ga0495684_0010912 3300047471 Bacteria 7022
441 Ga0495686_0007669 3300047472 Bacteria 8054
442 Ga0495686_0014989 3300047472 Bacteria 5313
443 Ga0495686_0267100 3300047472 Bacteria 955
444 Ga0495614_0162884 3300048089 Bacteria 998
445 Ga0496100_0085837 3300048903 Bacteria 2137
446 Ga0496102_0016307 3300048905 Bacteria 6489
447 Ga0496104_0027645 3300048907 Bacteria 5251
448 Ga0496105_0018338 3300048908 Bacteria 5621
449 Ga0496105_0477379 3300048908 Bacteria 981
450 Ga0496106_0785539 3300048909 Bacteria 756
451 Ga0496107_0130550 3300048910 Bacteria 1855
452 Ga0496109_0021280 3300048912 Bacteria 5734
453 Ga0496109_0045374 3300048912 Bacteria 3988
454 Ga0496109_0455982 3300048912 Bacteria 1207
455 Ga0496110_0015011 3300048913 Bacteria 6442
456 Ga0496110_0694397 3300048913 Bacteria 919
457 Ga0496110_0767264 3300048913 Bacteria 868
458 Ga0496112_1381946 3300048915 Bacteria 619
459 Ga0496113_0040939 3300048916 Bacteria 3416
460 Ga0496113_0591554 3300048916 Bacteria 889
461 Ga0496114_0003114 3300048917 Bacteria 12721
462 Ga0496114_0018036 3300048917 Bacteria 5702
463 Ga0496114_0445622 3300048917 Bacteria 1147
464 Ga0496115_0144963 3300048918 Bacteria 1960
465 Ga0496116_0006114 3300048919 Bacteria 11011
466 Ga0496116_0014356 3300048919 Bacteria 6332
467 Ga0496116_0190214 3300048919 Bacteria 1087
468 Ga0496116_0240756 3300048919 Bacteria 909
469 Ga0496117_0002001 3300048920 Bacteria 26998
470 Ga0496117_0015149 3300048920 Bacteria 6596
471 Ga0496117_0491169 3300048920 Bacteria 597
472 Ga0496118_0000074 3300048921 Bacteria 196515
473 Ga0496118_0003117 3300048921 Bacteria 21240
474 Ga0496118_0010014 3300048921 Bacteria 9453
475 Ga0496118_0052668 3300048921 Bacteria 3101
476 Ga0496118_0087856 3300048921 Bacteria 2153
477 Ga0496118_0102015 3300048921 Bacteria 1935
478 Ga0496119_0000209 3300048922 Bacteria 83605
479 Ga0496119_0221140 3300048922 Bacteria 969
480 Ga0496120_0000271 3300048923 Bacteria 86589
481 Ga0496121_0041464 3300048924 Bacteria 4021
482 Ga0496121_0045581 3300048924 Bacteria 3765
483 Ga0496121_0087050 3300048924 Bacteria 2453
484 Ga0496121_0168428 3300048924 Bacteria 1594
485 Ga0496121_0183733 3300048924 Bacteria 1506
486 Ga0496122_0000806 3300048925 Bacteria 60153
487 Ga0496122_0003584 3300048925 Bacteria 20262
488 Ga0496122_0215029 3300048925 Bacteria 1109
489 Ga0496122_0235339 3300048925 Bacteria 1037
490 Ga0496122_0279074 3300048925 Bacteria 914
491 Ga0496122_0535104 3300048925 Bacteria 562
492 Ga0496122_0561581 3300048925 Bacteria 541
493 Ga0496123_0001338 3300048926 Bacteria 34837
494 Ga0496123_0062952 3300048926 Bacteria 2373
495 Ga0496123_0066919 3300048926 Bacteria 2272
496 Ga0496123_0128180 3300048926 Bacteria 1412
497 Ga0496123_0152807 3300048926 Bacteria 1242
498 Ga0496123_0369802 3300048926 Bacteria 661
499 Ga0496124_0000447 3300048927 Bacteria 72640
500 Ga0496124_0000584 3300048927 Bacteria 61524
501 Ga0496124_0003380 3300048927 Bacteria 19595
502 Ga0496124_0006152 3300048927 Bacteria 13166
503 Ga0496124_0007796 3300048927 Bacteria 11309
504 Ga0496124_0022871 3300048927 Bacteria 5722
505 Ga0496124_0176699 3300048927 Bacteria 1647
506 Ga0496124_0188890 3300048927 Bacteria 1578
507 Ga0496125_0000144 3300048928 Bacteria 156270
508 Ga0496125_0000249 3300048928 Bacteria 110627
509 Ga0496125_0001175 3300048928 Bacteria 39654
510 Ga0496125_0014229 3300048928 Bacteria 7757
511 Ga0496125_0084422 3300048928 Bacteria 2411
512 Ga0496125_0123116 3300048928 Bacteria 1844
513 Ga0496125_0291232 3300048928 Bacteria 1005
514 Ga0496126_0000795 3300048929 Bacteria 56626
515 Ga0496126_0432824 3300048929 Bacteria 1062
516 Ga0501032_0012290 3300049569 Bacteria 6125
517 Ga0501032_0157428 3300049569 Bacteria 1492
518 Ga0501032_0193594 3300049569 Bacteria 1328
519 Ga0501033_0014081 3300049570 Bacteria 6081
520 Ga0501033_0180902 3300049570 Bacteria 1511
521 Ga0501034_0141473 3300049571 Bacteria 2385
522 Ga0501036_0005157 3300049572 Bacteria 10561
523 Ga0501036_1066489 3300049572 Bacteria 660
524 Ga0501037_0004374 3300049573 Bacteria 10257
525 Ga0501037_0227791 3300049573 Bacteria 1309
526 Ga0501038_0003804 3300049574 Bacteria 14045
527 Ga0501038_0334226 3300049574 Bacteria 1183
528 Ga0501039_0010961 3300049575 Bacteria 6909
529 Ga0501040_0034073 3300049576 Bacteria 3450
530 Ga0501041_0412813 3300049577 Bacteria 856
531 Ga0501043_0000112 3300049579 Bacteria 76249
532 Ga0501043_0027147 3300049579 Bacteria 4494
533 Ga0501043_0106119 3300049579 Bacteria 2206
534 Ga0501046_0000146 3300049580 Bacteria 74204
535 Ga0501046_0310480 3300049580 Bacteria 1150
536 Ga0501047_0000192 3300049581 Bacteria 74300
537 Ga0501047_0027750 3300049581 Bacteria 5454
538 Ga0501047_0080878 3300049581 Bacteria 3123
539 Ga0501047_0415312 3300049581 Bacteria 1177
540 Ga0501048_0000874 3300049582 Bacteria 22228
541 Ga0501048_0057688 3300049582 Bacteria 2753
542 Ga0501068_0106082 3300049584 Bacteria 1744
543 Ga0501070_0008181 3300049586 Bacteria 8844
544 Ga0501070_0010434 3300049586 Bacteria 7853
545 Ga0501070_0152842 3300049586 Bacteria 1904
546 Ga0501072_0188346 3300049588 Bacteria 1646
547 Ga0501072_0357775 3300049588 Bacteria 1159
548 Ga0501206_021359 3300049653 Bacteria 924
549 Ga0501079_0418176 3300049741 Bacteria 1052
550 Ga0501080_0549332 3300049742 Bacteria 1029
551 Ga0501081_0449409 3300049743 Bacteria 957
552 Ga0501083_0172188 3300049744 Bacteria 1415
553 Ga0501035_0003656 3300049822 Bacteria 14665
554 Ga0501035_0007745 3300049822 Bacteria 10033
555 Ga0501035_0457163 3300049822 Bacteria 1055
556 Ga0501044_0007912 3300049823 Bacteria 11689
557 Ga0501044_0033554 3300049823 Bacteria 5393
558 Ga0501044_0045370 3300049823 Bacteria 4553
559 Ga0501044_0541438 3300049823 Bacteria 1062
560 Ga0501045_0002450 3300049824 Bacteria 12613
561 Ga0501045_0455153 3300049824 Bacteria 951
562 Ga0501045_1439790 3300049824 Unclassified 500
563 nmdc:mga03n38_468352_c1 3300050490 Bacteria 703
564 nmdc:mga00v17_88025_c1 3300050491 Bacteria 1947
565 nmdc:mga06z11_53917_c1 3300050494 Bacteria 1181
566 nmdc:mga07m45_329451_c1 3300050496 Bacteria 887
567 nmdc:mga09592_688939_c1 3300050508 Bacteria 870
568 nmdc:mga06r32_606831_c1 3300050510 Bacteria 1065
569 nmdc:mga08y16_620258_c1 3300050511 Bacteria 1088
570 Ga0495601_0311672 3300053077 Bacteria 1025
571 Ga0500644_0004351 3300053088 Bacteria 3540
572 Ga0500562_004562 3300053108 Bacteria 3498
573 Ga0500608_174549 3300053122 Bacteria 917
574 Ga0500626_041832 3300053128 Bacteria 2071
575 Ga0500658_0045363 3300053134 Bacteria 1777
576 Ga0500564_109086 3300053138 Bacteria 1216
577 Ga0500568_0193812 3300053139 Bacteria 745
578 Ga0500622_0195894 3300053156 Bacteria 922
579 Ga0500636_0001890 3300053177 Bacteria 11469
580 Ga0500645_003129 3300053730 Bacteria 6894
581 Ga0500565_001261 3300053734 Bacteria 1656
582 Ga0500661_002466 3300055283 Bacteria 3485

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041451 Ga0451791_0025746 Ga0451791_0025746_65_472 114
2 3300046458 Ga0495591_063921 Ga0495591_063921_212_592 119
3 3300005295 Ga0065707_10105030 Ga0065707_101050304 124
4 3300005340 Ga0070689_100738574 Ga0070689_1007385742 124
5 3300005354 Ga0070675_100066881 Ga0070675_1000668813 124
6 3300005444 Ga0070694_100045455 Ga0070694_1000454552 124
7 3300005545 Ga0070695_100022455 Ga0070695_1000224553 124
8 3300005546 Ga0070696_100010058 Ga0070696_1000100583 124
9 3300005549 Ga0070704_100217433 Ga0070704_1002174331 124
10 3300005719 Ga0068861_100270155 Ga0068861_1002701553 124
11 3300025926 Ga0207659_10080176 Ga0207659_100801763 124
12 3300025936 Ga0207670_10662186 Ga0207670_106621862 124
13 3300025942 Ga0207689_11089476 Ga0207689_110894762 124
14 3300026118 Ga0207675_100105217 Ga0207675_1001052174 124
15 3300048912 Ga0496109_0455982 Ga0496109_0455982_10_384 124
16 3300003752 Ga0055539_1000524 Ga0055539_10005249 125
17 3300003756 Ga0055533_1000033 Ga0055533_1000033135 125
18 3300003759 Ga0055525_1001150 Ga0055525_10011508 125
19 3300025226 Ga0209674_100064 Ga0209674_100064114 125
20 3300025230 Ga0209563_100099 Ga0209563_100099114 125
21 3300025253 Ga0209677_100175 Ga0209677_10017523 125
22 3300039447 Ga0436361_0044045 Ga0436361_0044045_1401_1823 125
23 3300003781 Ga0055536_1039856 Ga0055536_10398563 126
24 3300003791 Ga0055530_10000771 Ga0055530_1000077116 126
25 3300003791 Ga0055530_10000810 Ga0055530_100008109 126
26 3300003791 Ga0055530_10003077 Ga0055530_1000307710 126
27 3300003792 Ga0055540_1024829 Ga0055540_10248292 126
28 3300003794 Ga0055531_10049685 Ga0055531_100496852 126
29 3300005327 Ga0070658_10107275 Ga0070658_101072751 126
30 3300005327 Ga0070658_10195570 Ga0070658_101955702 126
31 3300005331 Ga0070670_100089561 Ga0070670_1000895614 126
32 3300005338 Ga0068868_100391055 Ga0068868_1003910552 126
33 3300005355 Ga0070671_100203465 Ga0070671_1002034652 126
34 3300005456 Ga0070678_100134298 Ga0070678_1001342982 126
35 3300005459 Ga0068867_100510106 Ga0068867_1005101063 126
36 3300005548 Ga0070665_100162380 Ga0070665_1001623803 126
37 3300005563 Ga0068855_100123731 Ga0068855_1001237312 126
38 3300005563 Ga0068855_100123758 Ga0068855_1001237584 126
39 3300005563 Ga0068855_101146781 Ga0068855_1011467812 126
40 3300005614 Ga0068856_100561534 Ga0068856_1005615342 126
41 3300005614 Ga0068856_102025414 Ga0068856_1020254142 126
42 3300005616 Ga0068852_100318908 Ga0068852_1003189082 126
43 3300005834 Ga0068851_10256008 Ga0068851_102560082 126
44 3300006163 Ga0070715_10447997 Ga0070715_104479972 126
45 3300009036 Ga0105244_10019427 Ga0105244_100194274 126
46 3300009093 Ga0105240_10114002 Ga0105240_101140024 126
47 3300009553 Ga0105249_11870280 Ga0105249_118702802 126
48 3300010375 Ga0105239_11093337 Ga0105239_110933371 126
49 3300013100 Ga0157373_10179905 Ga0157373_101799052 126
50 3300013102 Ga0157371_10000206 Ga0157371_1000020624 126
51 3300013104 Ga0157370_10008242 Ga0157370_100082424 126
52 3300013105 Ga0157369_12087809 Ga0157369_120878092 126
53 3300013306 Ga0163162_10789010 Ga0163162_107890102 126
54 3300013308 Ga0157375_10018984 Ga0157375_100189843 126
55 3300014326 Ga0157380_10142640 Ga0157380_101426402 126
56 3300014326 Ga0157380_11565932 Ga0157380_115659322 126
57 3300014497 Ga0182008_10000362 Ga0182008_100003623 126
58 3300015261 Ga0182006_1042246 Ga0182006_10422462 126
59 3300015262 Ga0182007_10000061 Ga0182007_1000006142 126
60 3300015265 Ga0182005_1000413 Ga0182005_100041317 126
61 3300017792 Ga0163161_10000327 Ga0163161_1000032711 126
62 3300025231 Ga0207427_102399 Ga0207427_1023992 126
63 3300025256 Ga0209759_1009118 Ga0209759_10091184 126
64 3300025256 Ga0209759_1038691 Ga0209759_10386912 126
65 3300025292 Ga0209676_1000018 Ga0209676_1000018122 126
66 3300025298 Ga0209050_1000424 Ga0209050_100042427 126
67 3300025298 Ga0209050_1000610 Ga0209050_100061026 126
68 3300025298 Ga0209050_1007404 Ga0209050_10074047 126
69 3300025299 Ga0209256_1000061 Ga0209256_100006194 126
70 3300025303 Ga0209051_1000809 Ga0209051_100080924 126
71 3300025304 Ga0209257_1000035 Ga0209257_1000035122 126
72 3300025905 Ga0207685_10148203 Ga0207685_101482033 126
73 3300025909 Ga0207705_10076200 Ga0207705_100762003 126
74 3300025913 Ga0207695_10082179 Ga0207695_100821792 126
75 3300025931 Ga0207644_10673350 Ga0207644_106733502 126
76 3300025932 Ga0207690_10664094 Ga0207690_106640942 126
77 3300025949 Ga0207667_10095030 Ga0207667_100950304 126
78 3300025949 Ga0207667_10338553 Ga0207667_103385532 126
79 3300026067 Ga0207678_10714213 Ga0207678_107142132 126
80 3300026078 Ga0207702_10515970 Ga0207702_105159702 126
81 3300026078 Ga0207702_11459720 Ga0207702_114597202 126
82 3300026142 Ga0207698_10269460 Ga0207698_102694603 126
83 3300030521 Ga0307511_10192251 Ga0307511_101922511 126
84 3300030732 Ga0316176_1077866 Ga0316176_10778663 126
85 3300032002 Ga0307416_101346757 Ga0307416_1013467572 126
86 3300032004 Ga0307414_10332536 Ga0307414_103325362 126
87 3300041509 Ga0451843_0659177 Ga0451843_0659177_199_600 126
88 3300041512 Ga0451853_3784381 Ga0451853_3784381_452_853 126
89 3300044694 Ga0466963_0699745 Ga0466963_0699745_211_615 126
90 3300046453 Ga0495627_048333 Ga0495627_048333_470_871 126
91 3300046460 Ga0495638_0001027 Ga0495638_0001027_648_1049 126
92 3300046512 Ga0495610_0053495 Ga0495610_0053495_316_696 126
93 3300046515 Ga0495620_0192636 Ga0495620_0192636_246_626 126
94 3300046519 Ga0495632_0052539 Ga0495632_0052539_1325_1705 126
95 3300046524 Ga0495648_0164760 Ga0495648_0164760_640_1041 126
96 3300046525 Ga0495663_0002208 Ga0495663_0002208_4814_5215 126
97 3300046538 Ga0495609_0097071 Ga0495609_0097071_865_1266 126
98 3300046539 Ga0495621_0002800 Ga0495621_0002800_3742_4122 126
99 3300046558 Ga0495633_0014072 Ga0495633_0014072_3675_4076 126
100 3300046558 Ga0495633_0173228 Ga0495633_0173228_489_890 126
101 3300047320 Ga0495672_0047338 Ga0495672_0047338_1687_2088 126
102 3300047470 Ga0495681_0081520 Ga0495681_0081520_72_473 126
103 3300047472 Ga0495686_0267100 Ga0495686_0267100_523_903 126
104 3300048903 Ga0496100_0085837 Ga0496100_0085837_1341_1721 126
105 3300048905 Ga0496102_0016307 Ga0496102_0016307_4508_4888 126
106 3300048907 Ga0496104_0027645 Ga0496104_0027645_2465_2845 126
107 3300048908 Ga0496105_0018338 Ga0496105_0018338_1273_1653 126
108 3300048908 Ga0496105_0477379 Ga0496105_0477379_448_849 126
109 3300048909 Ga0496106_0785539 Ga0496106_0785539_10_390 126
110 3300048910 Ga0496107_0130550 Ga0496107_0130550_1180_1560 126
111 3300048912 Ga0496109_0021280 Ga0496109_0021280_1828_2208 126
112 3300048913 Ga0496110_0015011 Ga0496110_0015011_851_1231 126
113 3300048916 Ga0496113_0040939 Ga0496113_0040939_1307_1708 126
114 3300048917 Ga0496114_0003114 Ga0496114_0003114_10921_11301 126
115 3300048918 Ga0496115_0144963 Ga0496115_0144963_1237_1617 126
116 3300048919 Ga0496116_0006114 Ga0496116_0006114_8662_9063 126
117 3300048919 Ga0496116_0014356 Ga0496116_0014356_1777_2178 126
118 3300048920 Ga0496117_0002001 Ga0496117_0002001_5579_5980 126
119 3300048920 Ga0496117_0491169 Ga0496117_0491169_77_478 126
120 3300048921 Ga0496118_0000074 Ga0496118_0000074_161472_161873 126
121 3300048921 Ga0496118_0010014 Ga0496118_0010014_2343_2744 126
122 3300048921 Ga0496118_0052668 Ga0496118_0052668_2193_2594 126
123 3300048921 Ga0496118_0087856 Ga0496118_0087856_1119_1520 126
124 3300048921 Ga0496118_0102015 Ga0496118_0102015_307_708 126
125 3300048922 Ga0496119_0000209 Ga0496119_0000209_19971_20372 126
126 3300048922 Ga0496119_0221140 Ga0496119_0221140_89_490 126
127 3300048923 Ga0496120_0000271 Ga0496120_0000271_22938_23339 126
128 3300048924 Ga0496121_0041464 Ga0496121_0041464_1002_1403 126
129 3300048924 Ga0496121_0045581 Ga0496121_0045581_1168_1569 126
130 3300048924 Ga0496121_0087050 Ga0496121_0087050_632_1033 126
131 3300048924 Ga0496121_0168428 Ga0496121_0168428_600_1001 126
132 3300048924 Ga0496121_0183733 Ga0496121_0183733_165_566 126
133 3300048925 Ga0496122_0000806 Ga0496122_0000806_1441_1842 126
134 3300048925 Ga0496122_0003584 Ga0496122_0003584_11371_11772 126
135 3300048925 Ga0496122_0215029 Ga0496122_0215029_452_853 126
136 3300048925 Ga0496122_0235339 Ga0496122_0235339_299_700 126
137 3300048926 Ga0496123_0001338 Ga0496123_0001338_32729_33130 126
138 3300048926 Ga0496123_0066919 Ga0496123_0066919_620_1021 126
139 3300048926 Ga0496123_0152807 Ga0496123_0152807_661_1062 126
140 3300048926 Ga0496123_0369802 Ga0496123_0369802_79_480 126
141 3300048927 Ga0496124_0000447 Ga0496124_0000447_25701_26102 126
142 3300048927 Ga0496124_0000584 Ga0496124_0000584_33724_34125 126
143 3300048927 Ga0496124_0003380 Ga0496124_0003380_9217_9618 126
144 3300048927 Ga0496124_0006152 Ga0496124_0006152_7556_7957 126
145 3300048927 Ga0496124_0007796 Ga0496124_0007796_5607_6008 126
146 3300048927 Ga0496124_0022871 Ga0496124_0022871_5299_5700 126
147 3300048927 Ga0496124_0176699 Ga0496124_0176699_989_1390 126
148 3300048928 Ga0496125_0000144 Ga0496125_0000144_23680_24081 126
149 3300048928 Ga0496125_0000249 Ga0496125_0000249_22902_23303 126
150 3300048928 Ga0496125_0001175 Ga0496125_0001175_10558_10959 126
151 3300048928 Ga0496125_0084422 Ga0496125_0084422_181_582 126
152 3300048928 Ga0496125_0123116 Ga0496125_0123116_418_819 126
153 3300048929 Ga0496126_0000795 Ga0496126_0000795_33231_33632 126
154 3300049576 Ga0501040_0034073 Ga0501040_0034073_1680_2087 126
155 3300049577 Ga0501041_0412813 Ga0501041_0412813_217_624 126
156 3300049580 Ga0501046_0310480 Ga0501046_0310480_696_1103 126
157 3300049588 Ga0501072_0357775 Ga0501072_0357775_610_1017 126
158 3300049653 Ga0501206_021359 Ga0501206_021359_83_463 126
159 3300049741 Ga0501079_0418176 Ga0501079_0418176_56_463 126
160 3300049743 Ga0501081_0449409 Ga0501081_0449409_393_800 126
161 3300053077 Ga0495601_0311672 Ga0495601_0311672_66_446 126
162 3300053128 Ga0500626_041832 Ga0500626_041832_475_876 126
163 3300053134 Ga0500658_0045363 Ga0500658_0045363_57_437 126
164 3300053138 Ga0500564_109086 Ga0500564_109086_715_1095 126
165 3300053156 Ga0500622_0195894 Ga0500622_0195894_17_397 126
166 3300053177 Ga0500636_0001890 Ga0500636_0001890_10574_10954 126
167 3300053734 Ga0500565_001261 Ga0500565_001261_1207_1608 126
168 3300003771 Ga0055526_1001795 Ga0055526_100179514 127
169 3300003773 Ga0055537_1000201 Ga0055537_100020140 127
170 3300003775 Ga0055524_1035556 Ga0055524_10355562 127
171 3300003784 Ga0055534_1000075 Ga0055534_100007534 127
172 3300003790 Ga0055528_1000271 Ga0055528_100027150 127
173 3300003790 Ga0055528_1002305 Ga0055528_10023059 127
174 3300003791 Ga0055530_10121864 Ga0055530_101218641 127
175 3300003794 Ga0055531_10009298 Ga0055531_100092982 127
176 3300003794 Ga0055531_10041919 Ga0055531_100419192 127
177 3300006051 Ga0075364_10086872 Ga0075364_100868722 127
178 3300006178 Ga0075367_10220061 Ga0075367_102200612 127
179 3300014497 Ga0182008_10094359 Ga0182008_100943592 127
180 3300015261 Ga0182006_1024490 Ga0182006_10244902 127
181 3300017792 Ga0163161_10551661 Ga0163161_105516612 127
182 3300025263 Ga0209565_1000050 Ga0209565_1000050140 127
183 3300025273 Ga0209673_1000199 Ga0209673_100019921 127
184 3300025291 Ga0209675_1000007 Ga0209675_1000007466 127
185 3300025291 Ga0209675_1068761 Ga0209675_10687611 127
186 3300025295 Ga0209564_1000061 Ga0209564_1000061239 127
187 3300025298 Ga0209050_1051256 Ga0209050_10512562 127
188 3300025299 Ga0209256_1004229 Ga0209256_100422913 127
189 3300025299 Ga0209256_1043595 Ga0209256_10435952 127
190 3300025304 Ga0209257_1003209 Ga0209257_100320912 127
191 3300025304 Ga0209257_1024310 Ga0209257_10243101 127
192 3300025923 Ga0207681_10446966 Ga0207681_104469662 127
193 3300025972 Ga0207668_11062656 Ga0207668_110626562 127
194 3300030742 Ga0316183_1163337 Ga0316183_11633376 127
195 3300030760 Ga0265762_1017467 Ga0265762_10174672 127
196 3300032004 Ga0307414_11021311 Ga0307414_110213112 127
197 3300032005 Ga0307411_10383475 Ga0307411_103834752 127
198 3300035172 Ga0373955_0360139 Ga0373955_0360139_65_469 127
199 3300042006 Ga0439432_002824 Ga0439432_002824_4413_4814 127
200 3300042006 Ga0439432_022449 Ga0439432_022449_1181_1582 127
201 3300046453 Ga0495627_063540 Ga0495627_063540_416_817 127
202 3300046460 Ga0495638_0005621 Ga0495638_0005621_7497_7898 127
203 3300046512 Ga0495610_0001846 Ga0495610_0001846_5696_6097 127
204 3300046518 Ga0495631_0000377 Ga0495631_0000377_11800_12201 127
205 3300046522 Ga0495643_0000599 Ga0495643_0000599_26021_26422 127
206 3300046660 Ga0495625_0079473 Ga0495625_0079473_1444_1845 127
207 3300046660 Ga0495625_0342037 Ga0495625_0342037_67_468 127
208 3300046660 Ga0495625_0403392 Ga0495625_0403392_370_771 127
209 3300047320 Ga0495672_0000417 Ga0495672_0000417_24859_25260 127
210 3300047472 Ga0495686_0014989 Ga0495686_0014989_659_1060 127
211 3300048913 Ga0496110_0694397 Ga0496110_0694397_203_604 127
212 3300048919 Ga0496116_0190214 Ga0496116_0190214_487_888 127
213 3300048920 Ga0496117_0015149 Ga0496117_0015149_232_633 127
214 3300048921 Ga0496118_0003117 Ga0496118_0003117_8763_9164 127
215 3300048925 Ga0496122_0279074 Ga0496122_0279074_77_478 127
216 3300048926 Ga0496123_0062952 Ga0496123_0062952_1359_1760 127
217 3300048926 Ga0496123_0128180 Ga0496123_0128180_894_1310 127
218 3300048928 Ga0496125_0014229 Ga0496125_0014229_498_899 127
219 3300048928 Ga0496125_0291232 Ga0496125_0291232_26_442 127
220 3300049569 Ga0501032_0157428 Ga0501032_0157428_861_1283 127
221 3300049574 Ga0501038_0334226 Ga0501038_0334226_587_1009 127
222 3300049581 Ga0501047_0080878 Ga0501047_0080878_868_1272 127
223 3300049582 Ga0501048_0057688 Ga0501048_0057688_712_1116 127
224 3300049586 Ga0501070_0010434 Ga0501070_0010434_6013_6435 127
225 3300049742 Ga0501080_0549332 Ga0501080_0549332_418_840 127
226 3300049822 Ga0501035_0003656 Ga0501035_0003656_9697_10101 127
227 3300049823 Ga0501044_0033554 Ga0501044_0033554_2741_3145 127
228 3300050490 nmdc:mga03n38_468352_c1 nmdc:mga03n38_468352_c1_146_547 127
229 3300050491 nmdc:mga00v17_88025_c1 nmdc:mga00v17_88025_c1_1156_1557 127
230 3300050494 nmdc:mga06z11_53917_c1 nmdc:mga06z11_53917_c1_525_926 127
231 3300050496 nmdc:mga07m45_329451_c1 nmdc:mga07m45_329451_c1_316_717 127
232 iso_pu_bacteria 2643221654 2644303237 128
233 iso_pu_bacteria 2842757796 2842758102 129
234 iso_pu_bacteria 2852649853 2852650400 129
235 iso_pu_bacteria 2939589442 2939589934 129
236 iso_pu_bacteria 2941475908 2941476233 129
237 iso_pu_bacteria 2974307012 2974307521 129
238 iso_pu_bacteria 2977247770 2977248234 129
239 iso_pu_bacteria 2984514374 2984517275 129
240 3300025912 Ga0207707_10337008 Ga0207707_103370082 130
241 3300039453 Ga0436362_0770144 Ga0436362_0770144_240_632 130
242 iso_pu_bacteria 2593339239 2595451110 130
243 iso_pu_bacteria 8055878733 8055883562 130
244 3300005328 Ga0070676_10035979 Ga0070676_100359793 131
245 3300005331 Ga0070670_100053650 Ga0070670_1000536504 131
246 3300005333 Ga0070677_10001160 Ga0070677_100011606 131
247 3300005353 Ga0070669_100192754 Ga0070669_1001927542 131
248 3300005354 Ga0070675_100247771 Ga0070675_1002477711 131
249 3300005355 Ga0070671_100158279 Ga0070671_1001582792 131
250 3300005356 Ga0070674_100055454 Ga0070674_1000554542 131
251 3300005364 Ga0070673_100239877 Ga0070673_1002398772 131
252 3300005364 Ga0070673_100264984 Ga0070673_1002649842 131
253 3300005367 Ga0070667_100084105 Ga0070667_1000841052 131
254 3300005456 Ga0070678_100008183 Ga0070678_1000081836 131
255 3300005459 Ga0068867_100199954 Ga0068867_1001999541 131
256 3300005543 Ga0070672_100225072 Ga0070672_1002250722 131
257 3300005548 Ga0070665_100222965 Ga0070665_1002229653 131
258 3300005719 Ga0068861_100770564 Ga0068861_1007705641 131
259 3300005840 Ga0068870_10325987 Ga0068870_103259872 131
260 3300006237 Ga0097621_100304675 Ga0097621_1003046752 131
261 3300009098 Ga0105245_10244486 Ga0105245_102444862 131
262 3300009176 Ga0105242_10471059 Ga0105242_104710593 131
263 3300009177 Ga0105248_10485036 Ga0105248_104850363 131
264 3300013297 Ga0157378_10721458 Ga0157378_107214582 131
265 3300013306 Ga0163162_10036589 Ga0163162_100365894 131
266 3300013308 Ga0157375_10128613 Ga0157375_101286134 131
267 3300014325 Ga0163163_12768264 Ga0163163_127682642 131
268 3300014968 Ga0157379_10740318 Ga0157379_107403182 131
269 3300014969 Ga0157376_10867821 Ga0157376_108678212 131
270 3300017792 Ga0163161_10013856 Ga0163161_100138564 131
271 3300025315 Ga0207697_10170652 Ga0207697_101706521 131
272 3300025893 Ga0207682_10000804 Ga0207682_100008043 131
273 3300025907 Ga0207645_10050584 Ga0207645_100505843 131
274 3300025908 Ga0207643_10354228 Ga0207643_103542282 131
275 3300025923 Ga0207681_10301653 Ga0207681_103016533 131
276 3300025925 Ga0207650_10120337 Ga0207650_101203372 131
277 3300025926 Ga0207659_10020753 Ga0207659_100207534 131
278 3300025927 Ga0207687_10350261 Ga0207687_103502613 131
279 3300025931 Ga0207644_10331746 Ga0207644_103317461 131
280 3300025933 Ga0207706_10848419 Ga0207706_108484192 131
281 3300025934 Ga0207686_10333671 Ga0207686_103336713 131
282 3300025937 Ga0207669_10137467 Ga0207669_101374671 131
283 3300025940 Ga0207691_10083474 Ga0207691_100834742 131
284 3300025941 Ga0207711_10955469 Ga0207711_109554692 131
285 3300025960 Ga0207651_10260674 Ga0207651_102606742 131
286 3300025986 Ga0207658_10138061 Ga0207658_101380612 131
287 3300026067 Ga0207678_10084616 Ga0207678_100846163 131
288 3300026089 Ga0207648_10318910 Ga0207648_103189102 131
289 3300026121 Ga0207683_10010175 Ga0207683_100101756 131
290 3300028379 Ga0268266_10319031 Ga0268266_103190312 131
291 3300031824 Ga0307413_10201227 Ga0307413_102012273 131
292 3300031995 Ga0307409_100219814 Ga0307409_1002198142 131
293 3300032002 Ga0307416_100172782 Ga0307416_1001727823 131
294 3300035695 Ga0373927_0102494 Ga0373927_0102494_722_1120 131
295 3300035724 Ga0373933_1082063 Ga0373933_1082063_48_446 131
296 3300035725 Ga0373947_0197561 Ga0373947_0197561_707_1105 131
297 3300041997 Ga0439431_0004716 Ga0439431_0004716_854_1252 131
298 3300042134 Ga0450898_007681 Ga0450898_007681_952_1350 131
299 3300048915 Ga0496112_1381946 Ga0496112_1381946_82_480 131
300 3300048916 Ga0496113_0591554 Ga0496113_0591554_375_773 131
301 3300005333 Ga0070677_10357643 Ga0070677_103576432 132
302 3300005456 Ga0070678_100187252 Ga0070678_1001872522 132
303 3300009177 Ga0105248_11688165 Ga0105248_116881652 132
304 3300010375 Ga0105239_10531956 Ga0105239_105319562 132
305 3300013296 Ga0157374_11180734 Ga0157374_111807342 132
306 3300025893 Ga0207682_10569760 Ga0207682_105697602 132
307 3300025941 Ga0207711_10840100 Ga0207711_108401002 132
308 3300026121 Ga0207683_10261790 Ga0207683_102617902 132
309 3300028563 Ga0265319_1015317 Ga0265319_10153172 132
310 3300028573 Ga0265334_10129071 Ga0265334_101290712 132
311 3300028577 Ga0265318_10000771 Ga0265318_100007719 132
312 3300028800 Ga0265338_10186467 Ga0265338_101864672 132
313 3300028800 Ga0265338_10405982 Ga0265338_104059822 132
314 3300029957 Ga0265324_10090151 Ga0265324_100901512 132
315 3300031235 Ga0265330_10000896 Ga0265330_1000089616 132
316 3300031238 Ga0265332_10049022 Ga0265332_100490222 132
317 3300031238 Ga0265332_10049480 Ga0265332_100494802 132
318 3300031239 Ga0265328_10006698 Ga0265328_100066982 132
319 3300031240 Ga0265320_10001966 Ga0265320_100019663 132
320 3300031242 Ga0265329_10006674 Ga0265329_100066742 132
321 3300031249 Ga0265339_10021208 Ga0265339_100212083 132
322 3300031250 Ga0265331_10000655 Ga0265331_1000065516 132
323 3300031344 Ga0265316_10030113 Ga0265316_100301136 132
324 3300031595 Ga0265313_10030767 Ga0265313_100307673 132
325 3300031711 Ga0265314_10011405 Ga0265314_100114053 132
326 3300031712 Ga0265342_10000610 Ga0265342_1000061020 132
327 3300046455 Ga0495603_0243199 Ga0495603_0243199_239_640 132
328 3300002773 JGI25152J39213_1000033 JGI25152J39213_100003345 133
329 3300002774 JGI25150J39212_1000151 JGI25150J39212_100015113 133
330 3300003187 JGI25151J46595_10000142 JGI25151J46595_1000014238 133
331 3300003187 JGI25151J46595_10002153 JGI25151J46595_100021537 133
332 3300003215 JGI25153J46596_10000107 JGI25153J46596_1000010745 133
333 3300003759 Ga0055525_1000084 Ga0055525_1000084104 133
334 3300003773 Ga0055537_1007383 Ga0055537_10073833 133
335 3300003775 Ga0055524_1000013 Ga0055524_100001392 133
336 3300003775 Ga0055524_1001046 Ga0055524_10010467 133
337 3300003784 Ga0055534_1003936 Ga0055534_10039364 133
338 3300003792 Ga0055540_1024256 Ga0055540_10242563 133
339 3300005262 Ga0065165_1087303 Ga0065165_10873032 133
340 3300005290 Ga0065712_10366399 Ga0065712_103663992 133
341 3300005293 Ga0065715_10143022 Ga0065715_101430222 133
342 3300005328 Ga0070676_10010887 Ga0070676_100108876 133
343 3300005329 Ga0070683_100079138 Ga0070683_1000791383 133
344 3300005330 Ga0070690_100698536 Ga0070690_1006985361 133
345 3300005331 Ga0070670_100008583 Ga0070670_1000085837 133
346 3300005331 Ga0070670_100266907 Ga0070670_1002669073 133
347 3300005333 Ga0070677_10000532 Ga0070677_1000053210 133
348 3300005333 Ga0070677_10152565 Ga0070677_101525652 133
349 3300005334 Ga0068869_101439813 Ga0068869_1014398131 133
350 3300005336 Ga0070680_100058141 Ga0070680_1000581413 133
351 3300005338 Ga0068868_100201879 Ga0068868_1002018792 133
352 3300005338 Ga0068868_100946615 Ga0068868_1009466151 133
353 3300005344 Ga0070661_100172890 Ga0070661_1001728902 133
354 3300005347 Ga0070668_101241076 Ga0070668_1012410762 133
355 3300005354 Ga0070675_100001226 Ga0070675_10000122615 133
356 3300005354 Ga0070675_100031610 Ga0070675_1000316104 133
357 3300005355 Ga0070671_100002269 Ga0070671_10000226913 133
358 3300005355 Ga0070671_100127606 Ga0070671_1001276062 133
359 3300005356 Ga0070674_100134245 Ga0070674_1001342451 133
360 3300005356 Ga0070674_100429736 Ga0070674_1004297361 133
361 3300005364 Ga0070673_100162273 Ga0070673_1001622732 133
362 3300005364 Ga0070673_102025097 Ga0070673_1020250972 133
363 3300005366 Ga0070659_100889075 Ga0070659_1008890752 133
364 3300005367 Ga0070667_100372616 Ga0070667_1003726162 133
365 3300005456 Ga0070678_100043701 Ga0070678_1000437015 133
366 3300005456 Ga0070678_101038855 Ga0070678_1010388552 133
367 3300005457 Ga0070662_100008313 Ga0070662_1000083133 133
368 3300005459 Ga0068867_100003616 Ga0068867_1000036166 133
369 3300005459 Ga0068867_100345285 Ga0068867_1003452852 133
370 3300005459 Ga0068867_100395171 Ga0068867_1003951713 133
371 3300005459 Ga0068867_100576886 Ga0068867_1005768862 133
372 3300005530 Ga0070679_100005760 Ga0070679_1000057605 133
373 3300005530 Ga0070679_100355445 Ga0070679_1003554452 133
374 3300005535 Ga0070684_100438173 Ga0070684_1004381732 133
375 3300005539 Ga0068853_100280971 Ga0068853_1002809712 133
376 3300005543 Ga0070672_100011710 Ga0070672_1000117104 133
377 3300005543 Ga0070672_100050606 Ga0070672_1000506062 133
378 3300005543 Ga0070672_100082872 Ga0070672_1000828724 133
379 3300005543 Ga0070672_101026913 Ga0070672_1010269131 133
380 3300005548 Ga0070665_100207935 Ga0070665_1002079352 133
381 3300005564 Ga0070664_100060524 Ga0070664_1000605243 133
382 3300005577 Ga0068857_100695723 Ga0068857_1006957232 133
383 3300005616 Ga0068852_101236234 Ga0068852_1012362342 133
384 3300005618 Ga0068864_100008984 Ga0068864_1000089845 133
385 3300005718 Ga0068866_10193245 Ga0068866_101932453 133
386 3300005834 Ga0068851_10021181 Ga0068851_100211815 133
387 3300005840 Ga0068870_10170319 Ga0068870_101703193 133
388 3300005840 Ga0068870_10216397 Ga0068870_102163972 133
389 3300005841 Ga0068863_100834438 Ga0068863_1008344382 133
390 3300006048 Ga0075363_100318861 Ga0075363_1003188612 133
391 3300006175 Ga0070712_100335500 Ga0070712_1003355003 133
392 3300006237 Ga0097621_100009546 Ga0097621_1000095463 133
393 3300006353 Ga0075370_10449697 Ga0075370_104496972 133
394 3300006358 Ga0068871_100013746 Ga0068871_1000137463 133
395 3300006847 Ga0075431_100648042 Ga0075431_1006480423 133
396 3300006881 Ga0068865_100370346 Ga0068865_1003703462 133
397 3300009093 Ga0105240_10079655 Ga0105240_100796553 133
398 3300009098 Ga0105245_10035169 Ga0105245_100351694 133
399 3300009098 Ga0105245_10584753 Ga0105245_105847532 133
400 3300009148 Ga0105243_10179153 Ga0105243_101791532 133
401 3300009545 Ga0105237_11692355 Ga0105237_116923551 133
402 3300009551 Ga0105238_10000084 Ga0105238_1000008418 133
403 3300009551 Ga0105238_10410976 Ga0105238_104109762 133
404 3300009551 Ga0105238_10584158 Ga0105238_105841583 133
405 3300013102 Ga0157371_10280702 Ga0157371_102807022 133
406 3300013104 Ga0157370_10427707 Ga0157370_104277073 133
407 3300013104 Ga0157370_10431207 Ga0157370_104312072 133
408 3300013105 Ga0157369_10672406 Ga0157369_106724061 133
409 3300013306 Ga0163162_10805219 Ga0163162_108052192 133
410 3300013307 Ga0157372_10208049 Ga0157372_102080493 133
411 3300013307 Ga0157372_10239292 Ga0157372_102392923 133
412 3300014969 Ga0157376_11365261 Ga0157376_113652612 133
413 3300015265 Ga0182005_1009891 Ga0182005_10098912 133
414 3300017792 Ga0163161_10262606 Ga0163161_102626062 133
415 3300020078 Ga0206352_11326968 Ga0206352_113269682 133
416 3300022467 Ga0224712_10139864 Ga0224712_101398643 133
417 3300025230 Ga0209563_100025 Ga0209563_100025106 133
418 3300025253 Ga0209677_101039 Ga0209677_1010398 133
419 3300025258 Ga0209129_1000431 Ga0209129_10004317 133
420 3300025263 Ga0209565_1000066 Ga0209565_1000066165 133
421 3300025273 Ga0209673_1061709 Ga0209673_10617093 133
422 3300025291 Ga0209675_1000437 Ga0209675_100043712 133
423 3300025292 Ga0209676_1000075 Ga0209676_100007565 133
424 3300025294 Ga0209025_1001993 Ga0209025_100199315 133
425 3300025295 Ga0209564_1001906 Ga0209564_10019064 133
426 3300025297 Ga0209758_1007663 Ga0209758_10076635 133
427 3300025297 Ga0209758_1033199 Ga0209758_10331993 133
428 3300025299 Ga0209256_1002355 Ga0209256_100235511 133
429 3300025299 Ga0209256_1008618 Ga0209256_10086183 133
430 3300025303 Ga0209051_1006037 Ga0209051_10060374 133
431 3300025303 Ga0209051_1043373 Ga0209051_10433732 133
432 3300025321 Ga0207656_10295045 Ga0207656_102950452 133
433 3300025893 Ga0207682_10003073 Ga0207682_100030738 133
434 3300025893 Ga0207682_10123745 Ga0207682_101237452 133
435 3300025893 Ga0207682_10358892 Ga0207682_103588921 133
436 3300025899 Ga0207642_10167184 Ga0207642_101671842 133
437 3300025903 Ga0207680_10046055 Ga0207680_100460552 133
438 3300025907 Ga0207645_10055582 Ga0207645_100555823 133
439 3300025907 Ga0207645_10079980 Ga0207645_100799802 133
440 3300025907 Ga0207645_10087025 Ga0207645_100870252 133
441 3300025908 Ga0207643_10054285 Ga0207643_100542853 133
442 3300025908 Ga0207643_10166455 Ga0207643_101664552 133
443 3300025909 Ga0207705_10340361 Ga0207705_103403612 133
444 3300025913 Ga0207695_10204674 Ga0207695_102046742 133
445 3300025915 Ga0207693_10241086 Ga0207693_102410862 133
446 3300025917 Ga0207660_10028681 Ga0207660_100286813 133
447 3300025920 Ga0207649_10056951 Ga0207649_100569513 133
448 3300025921 Ga0207652_10011926 Ga0207652_100119262 133
449 3300025921 Ga0207652_11221874 Ga0207652_112218742 133
450 3300025923 Ga0207681_10023843 Ga0207681_100238433 133
451 3300025924 Ga0207694_10004778 Ga0207694_1000477810 133
452 3300025924 Ga0207694_10105564 Ga0207694_101055642 133
453 3300025925 Ga0207650_10000667 Ga0207650_1000066723 133
454 3300025925 Ga0207650_10401715 Ga0207650_104017151 133
455 3300025925 Ga0207650_10450859 Ga0207650_104508592 133
456 3300025925 Ga0207650_11248664 Ga0207650_112486642 133
457 3300025926 Ga0207659_10002105 Ga0207659_100021054 133
458 3300025926 Ga0207659_10214112 Ga0207659_102141122 133
459 3300025926 Ga0207659_10776007 Ga0207659_107760072 133
460 3300025927 Ga0207687_10073458 Ga0207687_100734583 133
461 3300025931 Ga0207644_10009455 Ga0207644_100094556 133
462 3300025931 Ga0207644_10498352 Ga0207644_104983522 133
463 3300025931 Ga0207644_10886171 Ga0207644_108861712 133
464 3300025932 Ga0207690_10699367 Ga0207690_106993672 133
465 3300025933 Ga0207706_10008467 Ga0207706_100084675 133
466 3300025934 Ga0207686_10669563 Ga0207686_106695631 133
467 3300025936 Ga0207670_10383055 Ga0207670_103830552 133
468 3300025937 Ga0207669_10001145 Ga0207669_100011457 133
469 3300025937 Ga0207669_10060730 Ga0207669_100607303 133
470 3300025937 Ga0207669_10150745 Ga0207669_101507453 133
471 3300025937 Ga0207669_10438272 Ga0207669_104382722 133
472 3300025938 Ga0207704_10305653 Ga0207704_103056532 133
473 3300025940 Ga0207691_10007338 Ga0207691_100073386 133
474 3300025940 Ga0207691_10030858 Ga0207691_100308583 133
475 3300025940 Ga0207691_10068826 Ga0207691_100688264 133
476 3300025942 Ga0207689_10581584 Ga0207689_105815842 133
477 3300025944 Ga0207661_10157076 Ga0207661_101570762 133
478 3300025944 Ga0207661_10172749 Ga0207661_101727493 133
479 3300025945 Ga0207679_10009792 Ga0207679_100097924 133
480 3300025960 Ga0207651_10015951 Ga0207651_100159512 133
481 3300025972 Ga0207668_10047610 Ga0207668_100476104 133
482 3300025986 Ga0207658_10116867 Ga0207658_101168672 133
483 3300026023 Ga0207677_10131730 Ga0207677_101317303 133
484 3300026041 Ga0207639_10411781 Ga0207639_104117812 133
485 3300026088 Ga0207641_10202290 Ga0207641_102022903 133
486 3300026088 Ga0207641_10303541 Ga0207641_103035413 133
487 3300026089 Ga0207648_10008667 Ga0207648_100086676 133
488 3300026089 Ga0207648_10056617 Ga0207648_100566175 133
489 3300026089 Ga0207648_10371640 Ga0207648_103716403 133
490 3300026089 Ga0207648_10918843 Ga0207648_109188432 133
491 3300026095 Ga0207676_10193504 Ga0207676_101935042 133
492 3300026118 Ga0207675_101797481 Ga0207675_1017974811 133
493 3300026121 Ga0207683_10002948 Ga0207683_100029485 133
494 3300026121 Ga0207683_10649439 Ga0207683_106494392 133
495 3300028379 Ga0268266_10624627 Ga0268266_106246272 133
496 3300028794 Ga0307515_10088177 Ga0307515_100881774 133
497 3300031456 Ga0307513_10246388 Ga0307513_102463882 133
498 3300031548 Ga0307408_100058064 Ga0307408_1000580642 133
499 3300031731 Ga0307405_10001995 Ga0307405_100019958 133
500 3300031824 Ga0307413_10229690 Ga0307413_102296903 133
501 3300031852 Ga0307410_10001182 Ga0307410_100011825 133
502 3300031852 Ga0307410_10526776 Ga0307410_105267761 133
503 3300031901 Ga0307406_10031956 Ga0307406_100319563 133
504 3300031901 Ga0307406_10149828 Ga0307406_101498282 133
505 3300031903 Ga0307407_10072632 Ga0307407_100726323 133
506 3300031903 Ga0307407_11199021 Ga0307407_111990212 133
507 3300031911 Ga0307412_10001505 Ga0307412_1000150516 133
508 3300031911 Ga0307412_10168641 Ga0307412_101686412 133
509 3300031995 Ga0307409_100581240 Ga0307409_1005812402 133
510 3300032002 Ga0307416_101189009 Ga0307416_1011890092 133
511 3300032004 Ga0307414_10043527 Ga0307414_100435274 133
512 3300032004 Ga0307414_10051032 Ga0307414_100510322 133
513 3300032005 Ga0307411_10000810 Ga0307411_1000081013 133
514 3300032005 Ga0307411_11301255 Ga0307411_113012552 133
515 3300032126 Ga0307415_100337235 Ga0307415_1003372351 133
516 3300035691 Ga0373931_0001775 Ga0373931_0001775_7819_8241 133
517 3300035695 Ga0373927_0208775 Ga0373927_0208775_256_660 133
518 3300035695 Ga0373927_1118932 Ga0373927_1118932_81_485 133
519 3300035725 Ga0373947_0384291 Ga0373947_0384291_386_790 133
520 3300036401 Ga0373937_0611785 Ga0373937_0611785_116_520 133
521 3300037068 Ga0373925_1557136 Ga0373925_1557136_83_487 133
522 3300037471 Ga0395905_0010184 Ga0395905_0010184_5280_5693 133
523 3300039145 Ga0237816_00299 Ga0237816_00299_2861_3262 133
524 3300045976 Ga0466967_0220668 Ga0466967_0220668_385_807 133
525 3300045976 Ga0466967_1928123 Ga0466967_1928123_71_475 133
526 3300046454 Ga0495592_0408035 Ga0495592_0408035_366_770 133
527 3300046473 Ga0495582_0236137 Ga0495582_0236137_385_789 133
528 3300046475 Ga0495639_0008923 Ga0495639_0008923_2700_3104 133
529 3300046511 Ga0495608_0210859 Ga0495608_0210859_185_589 133
530 3300046514 Ga0495618_0212915 Ga0495618_0212915_243_647 133
531 3300046516 Ga0495628_0364370 Ga0495628_0364370_526_930 133
532 3300046517 Ga0495630_0007539 Ga0495630_0007539_6143_6547 133
533 3300046684 Ga0495669_0082723 Ga0495669_0082723_565_969 133
534 3300046690 Ga0495624_0011941 Ga0495624_0011941_2350_2754 133
535 3300046809 Ga0495600_0490669 Ga0495600_0490669_149_553 133
536 3300047315 Ga0495581_0276198 Ga0495581_0276198_59_463 133
537 3300047319 Ga0495674_0007171 Ga0495674_0007171_6103_6507 133
538 3300047321 Ga0495676_0128395 Ga0495676_0128395_1013_1417 133
539 3300047444 Ga0495675_0360533 Ga0495675_0360533_220_624 133
540 3300047471 Ga0495684_0010912 Ga0495684_0010912_3380_3784 133
541 3300047472 Ga0495686_0007669 Ga0495686_0007669_4248_4649 133
542 3300048089 Ga0495614_0162884 Ga0495614_0162884_377_781 133
543 3300048912 Ga0496109_0045374 Ga0496109_0045374_1168_1572 133
544 3300048913 Ga0496110_0767264 Ga0496110_0767264_415_819 133
545 3300048917 Ga0496114_0018036 Ga0496114_0018036_4431_4838 133
546 3300048917 Ga0496114_0445622 Ga0496114_0445622_342_746 133
547 3300048919 Ga0496116_0240756 Ga0496116_0240756_122_526 133
548 3300048925 Ga0496122_0535104 Ga0496122_0535104_93_509 133
549 3300048925 Ga0496122_0561581 Ga0496122_0561581_20_436 133
550 3300048927 Ga0496124_0188890 Ga0496124_0188890_697_1101 133
551 3300048929 Ga0496126_0432824 Ga0496126_0432824_583_987 133
552 3300049569 Ga0501032_0012290 Ga0501032_0012290_1367_1783 133
553 3300049569 Ga0501032_0193594 Ga0501032_0193594_504_929 133
554 3300049570 Ga0501033_0014081 Ga0501033_0014081_5110_5526 133
555 3300049570 Ga0501033_0180902 Ga0501033_0180902_305_730 133
556 3300049571 Ga0501034_0141473 Ga0501034_0141473_1902_2318 133
557 3300049572 Ga0501036_0005157 Ga0501036_0005157_5036_5452 133
558 3300049572 Ga0501036_1066489 Ga0501036_1066489_183_590 133
559 3300049573 Ga0501037_0004374 Ga0501037_0004374_9777_10193 133
560 3300049573 Ga0501037_0227791 Ga0501037_0227791_22_447 133
561 3300049574 Ga0501038_0003804 Ga0501038_0003804_5283_5699 133
562 3300049575 Ga0501039_0010961 Ga0501039_0010961_5259_5675 133
563 3300049579 Ga0501043_0000112 Ga0501043_0000112_53936_54343 133
564 3300049579 Ga0501043_0027147 Ga0501043_0027147_477_902 133
565 3300049579 Ga0501043_0106119 Ga0501043_0106119_1682_2098 133
566 3300049580 Ga0501046_0000146 Ga0501046_0000146_53940_54347 133
567 3300049581 Ga0501047_0000192 Ga0501047_0000192_19958_20365 133
568 3300049581 Ga0501047_0027750 Ga0501047_0027750_936_1352 133
569 3300049581 Ga0501047_0415312 Ga0501047_0415312_539_964 133
570 3300049582 Ga0501048_0000874 Ga0501048_0000874_8579_8986 133
571 3300049584 Ga0501068_0106082 Ga0501068_0106082_65_481 133
572 3300049586 Ga0501070_0008181 Ga0501070_0008181_2604_3020 133
573 3300049586 Ga0501070_0152842 Ga0501070_0152842_297_722 133
574 3300049588 Ga0501072_0188346 Ga0501072_0188346_73_489 133
575 3300049744 Ga0501083_0172188 Ga0501083_0172188_878_1285 133
576 3300049822 Ga0501035_0007745 Ga0501035_0007745_9109_9534 133
577 3300049822 Ga0501035_0457163 Ga0501035_0457163_605_1021 133
578 3300049823 Ga0501044_0007912 Ga0501044_0007912_9276_9701 133
579 3300049823 Ga0501044_0045370 Ga0501044_0045370_35_451 133
580 3300049823 Ga0501044_0541438 Ga0501044_0541438_242_649 133
581 3300049824 Ga0501045_0002450 Ga0501045_0002450_3310_3717 133
582 3300049824 Ga0501045_0455153 Ga0501045_0455153_303_719 133
583 3300049824 Ga0501045_1439790 Ga0501045_1439790_32_439 133
584 3300050508 nmdc:mga09592_688939_c1 nmdc:mga09592_688939_c1_297_701 133
585 3300050510 nmdc:mga06r32_606831_c1 nmdc:mga06r32_606831_c1_633_1037 133
586 3300050511 nmdc:mga08y16_620258_c1 nmdc:mga08y16_620258_c1_109_513 133
587 3300053088 Ga0500644_0004351 Ga0500644_0004351_480_884 133
588 3300053108 Ga0500562_004562 Ga0500562_004562_317_721 133
589 3300053122 Ga0500608_174549 Ga0500608_174549_480_884 133
590 3300053139 Ga0500568_0193812 Ga0500568_0193812_35_439 133
591 3300053730 Ga0500645_003129 Ga0500645_003129_3305_3709 133
592 3300055283 Ga0500661_002466 Ga0500661_002466_607_1011 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

55

153

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3j9x-assembly1.cif.gz_A a virus that infects a hyperthermophile encapsidates a-form dna 0.8404 14 51
5n9g-assembly2.cif.gz_F tfiiib -tbp/brf2/dna and sant domain of bdp1- 0.8404 16 53
1thn-assembly1.cif.gz_A crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i 0.8219 1 127
5w7g-assembly1.cif.gz_A an envelope of a filamentous hyperthermophilic virus carries lipids in a horseshoe conformation 0.8168 16 51
1thn-assembly1.cif.gz_A crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i 0.8048 1 127
ID Description Score Start End Superfamily
4babB03 Mainly Alpha;Orthogonal Bundle;Enzyme I; Chain A, domain 2;Phenylalanine ammonia-lyase 1; domain 3 0.9393 16 44 1.10.274.20
4rodA01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.88 16 49 1.10.472.10
af_Q8QZR8_12_138_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.8698 14 47 1.10.472.10
3j9x101 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8492 16 51 1.20.58.800
af_Q4V8D6_60_167_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.8407 16 53 1.10.472.10
ID Description Score Start End GO Terms
AF-A0A2N1XKJ3-F1-model_v4 deleted 0.9786 4 111
AF-A4VGB2-F1-model_v4 Histidine kinase/HSP90-like ATPase domain-containing protein 0.9705 4 129
AF-A0A4Q3PC47-F1-model_v4 deleted 0.9697 4 86
AF-A0A7K3G6T1-F1-model_v4 Anti-sigma regulatory factor 0.9693 5 128
AF-A0A6J4NXT3-F1-model_v4 Anti-sigma B factor RsbT 0.9686 2 96

Feature Viewer

pLDDT pTM Quality
91.38 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map