F467140
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 592 | 330 | 582 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300025932|Ga0207690_10699367|Ga0207690_106993672 |
| Length | 153 |
| Sequence | MTSMSNAAWPCWPLTIGIKLTEPTTGGMLLLGERDIVMSRQQVRKLTQQIKFTLVDQTKMITAASELSRNTVVYGGGGEMRWEILQQGIKTGLRLWFEDKGPGIPDVALALTDGWTSGSGMGVGLSGSKRLVNEFEIRTVVGEGTCVIVTRWK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 2 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 3 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 4 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 5 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 6 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 7 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 8 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 9 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 177 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 183 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 184 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 185 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 219 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 223 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 224 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 225 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 226 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 227 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 228 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 229 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 276 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 277 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 278 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 279 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 280 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 281 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 282 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 283 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 284 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 285 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 286 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 303 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 311 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 312 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 313 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 320 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 321 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 322 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 325 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 326 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 328 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 329 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 330 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.8 |
| Metatranscriptomes | 0.51 |
| Isolates | 1.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.17 |
| Bulb | 0 |
| Endosphere | 14.53 |
| Nodule | 0 |
| Rhizoplane | 3.55 |
| Rhizosphere | 70.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1000033 | 3300002773 | Bacteria | 95187 |
| 2 | JGI25150J39212_1000151 | 3300002774 | Bacteria | 39298 |
| 3 | JGI25151J46595_10000142 | 3300003187 | Bacteria | 95187 |
| 4 | JGI25151J46595_10002153 | 3300003187 | Bacteria | 12230 |
| 5 | JGI25153J46596_10000107 | 3300003215 | Bacteria | 95187 |
| 6 | Ga0055539_1000524 | 3300003752 | Bacteria | 11718 |
| 7 | Ga0055533_1000033 | 3300003756 | Bacteria | 265716 |
| 8 | Ga0055525_1000084 | 3300003759 | Bacteria | 155319 |
| 9 | Ga0055525_1001150 | 3300003759 | Bacteria | 6259 |
| 10 | Ga0055526_1001795 | 3300003771 | Bacteria | 14858 |
| 11 | Ga0055537_1000201 | 3300003773 | Bacteria | 44718 |
| 12 | Ga0055537_1007383 | 3300003773 | Bacteria | 2655 |
| 13 | Ga0055524_1000013 | 3300003775 | Bacteria | 259850 |
| 14 | Ga0055524_1001046 | 3300003775 | Bacteria | 17071 |
| 15 | Ga0055524_1035556 | 3300003775 | Bacteria | 1356 |
| 16 | Ga0055536_1039856 | 3300003781 | Bacteria | 1124 |
| 17 | Ga0055534_1000075 | 3300003784 | Bacteria | 77072 |
| 18 | Ga0055534_1003936 | 3300003784 | Bacteria | 4478 |
| 19 | Ga0055528_1000271 | 3300003790 | Bacteria | 43963 |
| 20 | Ga0055528_1002305 | 3300003790 | Bacteria | 10341 |
| 21 | Ga0055530_10000771 | 3300003791 | Bacteria | 26703 |
| 22 | Ga0055530_10000810 | 3300003791 | Bacteria | 25993 |
| 23 | Ga0055530_10003077 | 3300003791 | Bacteria | 9917 |
| 24 | Ga0055530_10121864 | 3300003791 | Bacteria | 505 |
| 25 | Ga0055540_1024256 | 3300003792 | Bacteria | 1508 |
| 26 | Ga0055540_1024829 | 3300003792 | Bacteria | 1480 |
| 27 | Ga0055531_10009298 | 3300003794 | Bacteria | 5042 |
| 28 | Ga0055531_10041919 | 3300003794 | Bacteria | 1317 |
| 29 | Ga0055531_10049685 | 3300003794 | Bacteria | 1118 |
| 30 | Ga0065165_1087303 | 3300005262 | Bacteria | 800 |
| 31 | Ga0065712_10366399 | 3300005290 | Bacteria | 768 |
| 32 | Ga0065715_10143022 | 3300005293 | Bacteria | 1826 |
| 33 | Ga0065707_10105030 | 3300005295 | Bacteria | 2666 |
| 34 | Ga0070658_10107275 | 3300005327 | Bacteria | 2311 |
| 35 | Ga0070658_10195570 | 3300005327 | Bacteria | 1705 |
| 36 | Ga0070676_10010887 | 3300005328 | Bacteria | 4939 |
| 37 | Ga0070676_10035979 | 3300005328 | Bacteria | 2850 |
| 38 | Ga0070683_100079138 | 3300005329 | Bacteria | 3076 |
| 39 | Ga0070690_100698536 | 3300005330 | Bacteria | 779 |
| 40 | Ga0070670_100008583 | 3300005331 | Bacteria | 8716 |
| 41 | Ga0070670_100053650 | 3300005331 | Bacteria | 3461 |
| 42 | Ga0070670_100089561 | 3300005331 | Bacteria | 2645 |
| 43 | Ga0070670_100266907 | 3300005331 | Bacteria | 1493 |
| 44 | Ga0070677_10000532 | 3300005333 | Bacteria | 13026 |
| 45 | Ga0070677_10001160 | 3300005333 | Bacteria | 8472 |
| 46 | Ga0070677_10152565 | 3300005333 | Bacteria | 1076 |
| 47 | Ga0070677_10357643 | 3300005333 | Unclassified | 758 |
| 48 | Ga0068869_101439813 | 3300005334 | Bacteria | 611 |
| 49 | Ga0070680_100058141 | 3300005336 | Bacteria | 3162 |
| 50 | Ga0068868_100201879 | 3300005338 | Bacteria | 1658 |
| 51 | Ga0068868_100391055 | 3300005338 | Bacteria | 1198 |
| 52 | Ga0068868_100946615 | 3300005338 | Bacteria | 785 |
| 53 | Ga0070689_100738574 | 3300005340 | Bacteria | 862 |
| 54 | Ga0070661_100172890 | 3300005344 | Bacteria | 1641 |
| 55 | Ga0070668_101241076 | 3300005347 | Bacteria | 676 |
| 56 | Ga0070669_100192754 | 3300005353 | Bacteria | 1599 |
| 57 | Ga0070675_100001226 | 3300005354 | Bacteria | 18654 |
| 58 | Ga0070675_100031610 | 3300005354 | Bacteria | 4281 |
| 59 | Ga0070675_100066881 | 3300005354 | Bacteria | 2973 |
| 60 | Ga0070675_100247771 | 3300005354 | Bacteria | 1558 |
| 61 | Ga0070671_100002269 | 3300005355 | Bacteria | 14840 |
| 62 | Ga0070671_100127606 | 3300005355 | Bacteria | 2142 |
| 63 | Ga0070671_100158279 | 3300005355 | Bacteria | 1914 |
| 64 | Ga0070671_100203465 | 3300005355 | Bacteria | 1679 |
| 65 | Ga0070674_100055454 | 3300005356 | Bacteria | 2745 |
| 66 | Ga0070674_100134245 | 3300005356 | Bacteria | 1849 |
| 67 | Ga0070674_100429736 | 3300005356 | Bacteria | 1085 |
| 68 | Ga0070673_100162273 | 3300005364 | Bacteria | 1901 |
| 69 | Ga0070673_100239877 | 3300005364 | Bacteria | 1576 |
| 70 | Ga0070673_100264984 | 3300005364 | Bacteria | 1502 |
| 71 | Ga0070673_102025097 | 3300005364 | Bacteria | 547 |
| 72 | Ga0070659_100889075 | 3300005366 | Bacteria | 778 |
| 73 | Ga0070667_100084105 | 3300005367 | Bacteria | 2727 |
| 74 | Ga0070667_100372616 | 3300005367 | Bacteria | 1296 |
| 75 | Ga0070694_100045455 | 3300005444 | Bacteria | 2943 |
| 76 | Ga0070678_100008183 | 3300005456 | Bacteria | 6251 |
| 77 | Ga0070678_100043701 | 3300005456 | Bacteria | 3194 |
| 78 | Ga0070678_100134298 | 3300005456 | Bacteria | 1971 |
| 79 | Ga0070678_100187252 | 3300005456 | Bacteria | 1699 |
| 80 | Ga0070678_101038855 | 3300005456 | Bacteria | 754 |
| 81 | Ga0070662_100008313 | 3300005457 | Bacteria | 6763 |
| 82 | Ga0068867_100003616 | 3300005459 | Bacteria | 10876 |
| 83 | Ga0068867_100199954 | 3300005459 | Bacteria | 1599 |
| 84 | Ga0068867_100345285 | 3300005459 | Bacteria | 1240 |
| 85 | Ga0068867_100395171 | 3300005459 | Bacteria | 1165 |
| 86 | Ga0068867_100510106 | 3300005459 | Bacteria | 1035 |
| 87 | Ga0068867_100576886 | 3300005459 | Bacteria | 978 |
| 88 | Ga0070679_100005760 | 3300005530 | Bacteria | 11491 |
| 89 | Ga0070679_100355445 | 3300005530 | Unclassified | 1413 |
| 90 | Ga0070684_100438173 | 3300005535 | Bacteria | 1207 |
| 91 | Ga0068853_100280971 | 3300005539 | Bacteria | 1535 |
| 92 | Ga0070672_100011710 | 3300005543 | Bacteria | 6126 |
| 93 | Ga0070672_100050606 | 3300005543 | Bacteria | 3237 |
| 94 | Ga0070672_100082872 | 3300005543 | Bacteria | 2573 |
| 95 | Ga0070672_100225072 | 3300005543 | Bacteria | 1574 |
| 96 | Ga0070672_101026913 | 3300005543 | Bacteria | 731 |
| 97 | Ga0070695_100022455 | 3300005545 | Bacteria | 3870 |
| 98 | Ga0070696_100010058 | 3300005546 | Bacteria | 6330 |
| 99 | Ga0070665_100162380 | 3300005548 | Bacteria | 2236 |
| 100 | Ga0070665_100207935 | 3300005548 | Bacteria | 1958 |
| 101 | Ga0070665_100222965 | 3300005548 | Bacteria | 1886 |
| 102 | Ga0070704_100217433 | 3300005549 | Bacteria | 1552 |
| 103 | Ga0068855_100123731 | 3300005563 | Bacteria | 2959 |
| 104 | Ga0068855_100123758 | 3300005563 | Bacteria | 2958 |
| 105 | Ga0068855_101146781 | 3300005563 | Bacteria | 810 |
| 106 | Ga0070664_100060524 | 3300005564 | Bacteria | 3225 |
| 107 | Ga0068857_100695723 | 3300005577 | Bacteria | 966 |
| 108 | Ga0068856_100561534 | 3300005614 | Bacteria | 1163 |
| 109 | Ga0068856_102025414 | 3300005614 | Bacteria | 586 |
| 110 | Ga0068852_100318908 | 3300005616 | Bacteria | 1509 |
| 111 | Ga0068852_101236234 | 3300005616 | Bacteria | 768 |
| 112 | Ga0068864_100008984 | 3300005618 | Bacteria | 8242 |
| 113 | Ga0068866_10193245 | 3300005718 | Bacteria | 1211 |
| 114 | Ga0068861_100270155 | 3300005719 | Bacteria | 1460 |
| 115 | Ga0068861_100770564 | 3300005719 | Bacteria | 900 |
| 116 | Ga0068851_10021181 | 3300005834 | Bacteria | 3156 |
| 117 | Ga0068851_10256008 | 3300005834 | Bacteria | 994 |
| 118 | Ga0068870_10170319 | 3300005840 | Bacteria | 1299 |
| 119 | Ga0068870_10216397 | 3300005840 | Bacteria | 1170 |
| 120 | Ga0068870_10325987 | 3300005840 | Bacteria | 977 |
| 121 | Ga0068863_100834438 | 3300005841 | Bacteria | 920 |
| 122 | Ga0075363_100318861 | 3300006048 | Bacteria | 904 |
| 123 | Ga0075364_10086872 | 3300006051 | Bacteria | 2072 |
| 124 | Ga0070715_10447997 | 3300006163 | Bacteria | 728 |
| 125 | Ga0070712_100335500 | 3300006175 | Bacteria | 1233 |
| 126 | Ga0075367_10220061 | 3300006178 | Bacteria | 1188 |
| 127 | Ga0097621_100009546 | 3300006237 | Bacteria | 7048 |
| 128 | Ga0097621_100304675 | 3300006237 | Bacteria | 1408 |
| 129 | Ga0075370_10449697 | 3300006353 | Bacteria | 775 |
| 130 | Ga0068871_100013746 | 3300006358 | Bacteria | 6018 |
| 131 | Ga0075431_100648042 | 3300006847 | Bacteria | 1037 |
| 132 | Ga0068865_100370346 | 3300006881 | Bacteria | 1166 |
| 133 | Ga0105244_10019427 | 3300009036 | Bacteria | 3792 |
| 134 | Ga0105240_10079655 | 3300009093 | Bacteria | 4030 |
| 135 | Ga0105240_10114002 | 3300009093 | Bacteria | 3266 |
| 136 | Ga0105245_10035169 | 3300009098 | Bacteria | 4446 |
| 137 | Ga0105245_10244486 | 3300009098 | Bacteria | 1741 |
| 138 | Ga0105245_10584753 | 3300009098 | Bacteria | 1141 |
| 139 | Ga0105243_10179153 | 3300009148 | Bacteria | 1842 |
| 140 | Ga0105242_10471059 | 3300009176 | Bacteria | 1188 |
| 141 | Ga0105248_10485036 | 3300009177 | Bacteria | 1393 |
| 142 | Ga0105248_11688165 | 3300009177 | Unclassified | 718 |
| 143 | Ga0105237_11692355 | 3300009545 | Bacteria | 640 |
| 144 | Ga0105238_10000084 | 3300009551 | Bacteria | 106982 |
| 145 | Ga0105238_10410976 | 3300009551 | Bacteria | 1347 |
| 146 | Ga0105238_10584158 | 3300009551 | Bacteria | 1124 |
| 147 | Ga0105249_11870280 | 3300009553 | Bacteria | 673 |
| 148 | Ga0105239_10531956 | 3300010375 | Bacteria | 1338 |
| 149 | Ga0105239_11093337 | 3300010375 | Bacteria | 918 |
| 150 | Ga0157373_10179905 | 3300013100 | Bacteria | 1489 |
| 151 | Ga0157371_10000206 | 3300013102 | Bacteria | 86320 |
| 152 | Ga0157371_10280702 | 3300013102 | Bacteria | 1203 |
| 153 | Ga0157370_10008242 | 3300013104 | Bacteria | 11254 |
| 154 | Ga0157370_10427707 | 3300013104 | Bacteria | 1218 |
| 155 | Ga0157370_10431207 | 3300013104 | Bacteria | 1212 |
| 156 | Ga0157369_10672406 | 3300013105 | Bacteria | 1067 |
| 157 | Ga0157369_12087809 | 3300013105 | Bacteria | 575 |
| 158 | Ga0157374_11180734 | 3300013296 | Bacteria | 786 |
| 159 | Ga0157378_10721458 | 3300013297 | Bacteria | 1018 |
| 160 | Ga0163162_10036589 | 3300013306 | Bacteria | 4894 |
| 161 | Ga0163162_10789010 | 3300013306 | Bacteria | 1068 |
| 162 | Ga0163162_10805219 | 3300013306 | Bacteria | 1057 |
| 163 | Ga0157372_10208049 | 3300013307 | Bacteria | 2267 |
| 164 | Ga0157372_10239292 | 3300013307 | Bacteria | 2106 |
| 165 | Ga0157375_10018984 | 3300013308 | Bacteria | 6242 |
| 166 | Ga0157375_10128613 | 3300013308 | Bacteria | 2651 |
| 167 | Ga0163163_12768264 | 3300014325 | Bacteria | 547 |
| 168 | Ga0157380_10142640 | 3300014326 | Bacteria | 2060 |
| 169 | Ga0157380_11565932 | 3300014326 | Bacteria | 714 |
| 170 | Ga0182008_10000362 | 3300014497 | Bacteria | 35395 |
| 171 | Ga0182008_10094359 | 3300014497 | Bacteria | 1476 |
| 172 | Ga0157379_10740318 | 3300014968 | Bacteria | 925 |
| 173 | Ga0157376_10867821 | 3300014969 | Bacteria | 919 |
| 174 | Ga0157376_11365261 | 3300014969 | Bacteria | 740 |
| 175 | Ga0182006_1024490 | 3300015261 | Bacteria | 2488 |
| 176 | Ga0182006_1042246 | 3300015261 | Bacteria | 1787 |
| 177 | Ga0182007_10000061 | 3300015262 | Bacteria | 88102 |
| 178 | Ga0182005_1000413 | 3300015265 | Bacteria | 23140 |
| 179 | Ga0182005_1009891 | 3300015265 | Bacteria | 2757 |
| 180 | Ga0163161_10000327 | 3300017792 | Bacteria | 40625 |
| 181 | Ga0163161_10013856 | 3300017792 | Bacteria | 5616 |
| 182 | Ga0163161_10262606 | 3300017792 | Bacteria | 1349 |
| 183 | Ga0163161_10551661 | 3300017792 | Bacteria | 945 |
| 184 | Ga0206352_11326968 | 3300020078 | Bacteria | 1113 |
| 185 | Ga0224712_10139864 | 3300022467 | Bacteria | 1064 |
| 186 | Ga0209674_100064 | 3300025226 | Bacteria | 265769 |
| 187 | Ga0209563_100025 | 3300025230 | Bacteria | 596456 |
| 188 | Ga0209563_100099 | 3300025230 | Bacteria | 153336 |
| 189 | Ga0207427_102399 | 3300025231 | Bacteria | 5085 |
| 190 | Ga0209677_100175 | 3300025253 | Bacteria | 55052 |
| 191 | Ga0209677_101039 | 3300025253 | Bacteria | 13221 |
| 192 | Ga0209759_1009118 | 3300025256 | Bacteria | 3031 |
| 193 | Ga0209759_1038691 | 3300025256 | Bacteria | 845 |
| 194 | Ga0209129_1000431 | 3300025258 | Bacteria | 31539 |
| 195 | Ga0209565_1000050 | 3300025263 | Bacteria | 213856 |
| 196 | Ga0209565_1000066 | 3300025263 | Bacteria | 173062 |
| 197 | Ga0209673_1000199 | 3300025273 | Bacteria | 120904 |
| 198 | Ga0209673_1061709 | 3300025273 | Bacteria | 933 |
| 199 | Ga0209675_1000007 | 3300025291 | Bacteria | 683430 |
| 200 | Ga0209675_1000437 | 3300025291 | Bacteria | 33080 |
| 201 | Ga0209675_1068761 | 3300025291 | Bacteria | 680 |
| 202 | Ga0209676_1000018 | 3300025292 | Bacteria | 631385 |
| 203 | Ga0209676_1000075 | 3300025292 | Bacteria | 303609 |
| 204 | Ga0209025_1001993 | 3300025294 | Bacteria | 23406 |
| 205 | Ga0209564_1000061 | 3300025295 | Bacteria | 322795 |
| 206 | Ga0209564_1001906 | 3300025295 | Bacteria | 18662 |
| 207 | Ga0209758_1007663 | 3300025297 | Bacteria | 7272 |
| 208 | Ga0209758_1033199 | 3300025297 | Bacteria | 2079 |
| 209 | Ga0209050_1000424 | 3300025298 | Bacteria | 77803 |
| 210 | Ga0209050_1000610 | 3300025298 | Bacteria | 56686 |
| 211 | Ga0209050_1007404 | 3300025298 | Bacteria | 6165 |
| 212 | Ga0209050_1051256 | 3300025298 | Bacteria | 1042 |
| 213 | Ga0209256_1000061 | 3300025299 | Bacteria | 260890 |
| 214 | Ga0209256_1002355 | 3300025299 | Bacteria | 15718 |
| 215 | Ga0209256_1004229 | 3300025299 | Bacteria | 9203 |
| 216 | Ga0209256_1008618 | 3300025299 | Bacteria | 4678 |
| 217 | Ga0209256_1043595 | 3300025299 | Bacteria | 1125 |
| 218 | Ga0209051_1000809 | 3300025303 | Bacteria | 32636 |
| 219 | Ga0209051_1006037 | 3300025303 | Bacteria | 6915 |
| 220 | Ga0209051_1043373 | 3300025303 | Bacteria | 1579 |
| 221 | Ga0209257_1000035 | 3300025304 | Bacteria | 631463 |
| 222 | Ga0209257_1003209 | 3300025304 | Bacteria | 14464 |
| 223 | Ga0209257_1024310 | 3300025304 | Bacteria | 2101 |
| 224 | Ga0207697_10170652 | 3300025315 | Bacteria | 951 |
| 225 | Ga0207656_10295045 | 3300025321 | Bacteria | 802 |
| 226 | Ga0207682_10000804 | 3300025893 | Bacteria | 14510 |
| 227 | Ga0207682_10003073 | 3300025893 | Bacteria | 7322 |
| 228 | Ga0207682_10123745 | 3300025893 | Bacteria | 1149 |
| 229 | Ga0207682_10358892 | 3300025893 | Bacteria | 687 |
| 230 | Ga0207682_10569760 | 3300025893 | Bacteria | 535 |
| 231 | Ga0207642_10167184 | 3300025899 | Bacteria | 1186 |
| 232 | Ga0207680_10046055 | 3300025903 | Bacteria | 2576 |
| 233 | Ga0207685_10148203 | 3300025905 | Bacteria | 1059 |
| 234 | Ga0207645_10050584 | 3300025907 | Bacteria | 2653 |
| 235 | Ga0207645_10055582 | 3300025907 | Bacteria | 2527 |
| 236 | Ga0207645_10079980 | 3300025907 | Bacteria | 2095 |
| 237 | Ga0207645_10087025 | 3300025907 | Bacteria | 2007 |
| 238 | Ga0207643_10054285 | 3300025908 | Bacteria | 2277 |
| 239 | Ga0207643_10166455 | 3300025908 | Bacteria | 1328 |
| 240 | Ga0207643_10354228 | 3300025908 | Bacteria | 922 |
| 241 | Ga0207705_10076200 | 3300025909 | Bacteria | 2438 |
| 242 | Ga0207705_10340361 | 3300025909 | Bacteria | 1155 |
| 243 | Ga0207707_10337008 | 3300025912 | Bacteria | 1301 |
| 244 | Ga0207695_10082179 | 3300025913 | Bacteria | 3258 |
| 245 | Ga0207695_10204674 | 3300025913 | Bacteria | 1887 |
| 246 | Ga0207693_10241086 | 3300025915 | Bacteria | 1419 |
| 247 | Ga0207660_10028681 | 3300025917 | Bacteria | 3808 |
| 248 | Ga0207649_10056951 | 3300025920 | Bacteria | 2442 |
| 249 | Ga0207652_10011926 | 3300025921 | Bacteria | 7014 |
| 250 | Ga0207652_11221874 | 3300025921 | Unclassified | 653 |
| 251 | Ga0207681_10023843 | 3300025923 | Bacteria | 3919 |
| 252 | Ga0207681_10301653 | 3300025923 | Bacteria | 1268 |
| 253 | Ga0207681_10446966 | 3300025923 | Bacteria | 1051 |
| 254 | Ga0207694_10004778 | 3300025924 | Bacteria | 10532 |
| 255 | Ga0207694_10105564 | 3300025924 | Bacteria | 2236 |
| 256 | Ga0207650_10000667 | 3300025925 | Bacteria | 26981 |
| 257 | Ga0207650_10120337 | 3300025925 | Bacteria | 2043 |
| 258 | Ga0207650_10401715 | 3300025925 | Bacteria | 1134 |
| 259 | Ga0207650_10450859 | 3300025925 | Bacteria | 1071 |
| 260 | Ga0207650_11248664 | 3300025925 | Bacteria | 632 |
| 261 | Ga0207659_10002105 | 3300025926 | Bacteria | 11788 |
| 262 | Ga0207659_10020753 | 3300025926 | Bacteria | 4349 |
| 263 | Ga0207659_10080176 | 3300025926 | Bacteria | 2411 |
| 264 | Ga0207659_10214112 | 3300025926 | Bacteria | 1546 |
| 265 | Ga0207659_10776007 | 3300025926 | Bacteria | 823 |
| 266 | Ga0207687_10073458 | 3300025927 | Bacteria | 2448 |
| 267 | Ga0207687_10350261 | 3300025927 | Bacteria | 1203 |
| 268 | Ga0207644_10009455 | 3300025931 | Bacteria | 6401 |
| 269 | Ga0207644_10331746 | 3300025931 | Bacteria | 1232 |
| 270 | Ga0207644_10498352 | 3300025931 | Bacteria | 1004 |
| 271 | Ga0207644_10673350 | 3300025931 | Bacteria | 862 |
| 272 | Ga0207644_10886171 | 3300025931 | Bacteria | 748 |
| 273 | Ga0207690_10664094 | 3300025932 | Bacteria | 855 |
| 274 | Ga0207690_10699367 | 3300025932 | Bacteria | 833 |
| 275 | Ga0207706_10008467 | 3300025933 | Bacteria | 9487 |
| 276 | Ga0207706_10848419 | 3300025933 | Bacteria | 774 |
| 277 | Ga0207686_10333671 | 3300025934 | Bacteria | 1137 |
| 278 | Ga0207686_10669563 | 3300025934 | Bacteria | 822 |
| 279 | Ga0207670_10383055 | 3300025936 | Bacteria | 1121 |
| 280 | Ga0207670_10662186 | 3300025936 | Bacteria | 862 |
| 281 | Ga0207669_10001145 | 3300025937 | Bacteria | 11318 |
| 282 | Ga0207669_10060730 | 3300025937 | Bacteria | 2319 |
| 283 | Ga0207669_10137467 | 3300025937 | Bacteria | 1690 |
| 284 | Ga0207669_10150745 | 3300025937 | Bacteria | 1628 |
| 285 | Ga0207669_10438272 | 3300025937 | Bacteria | 1032 |
| 286 | Ga0207704_10305653 | 3300025938 | Bacteria | 1220 |
| 287 | Ga0207691_10007338 | 3300025940 | Bacteria | 10633 |
| 288 | Ga0207691_10030858 | 3300025940 | Bacteria | 5006 |
| 289 | Ga0207691_10068826 | 3300025940 | Bacteria | 3198 |
| 290 | Ga0207691_10083474 | 3300025940 | Bacteria | 2868 |
| 291 | Ga0207711_10840100 | 3300025941 | Unclassified | 855 |
| 292 | Ga0207711_10955469 | 3300025941 | Bacteria | 796 |
| 293 | Ga0207689_10581584 | 3300025942 | Bacteria | 941 |
| 294 | Ga0207689_11089476 | 3300025942 | Bacteria | 673 |
| 295 | Ga0207661_10157076 | 3300025944 | Bacteria | 1971 |
| 296 | Ga0207661_10172749 | 3300025944 | Bacteria | 1882 |
| 297 | Ga0207679_10009792 | 3300025945 | Bacteria | 6149 |
| 298 | Ga0207667_10095030 | 3300025949 | Bacteria | 3077 |
| 299 | Ga0207667_10338553 | 3300025949 | Bacteria | 1535 |
| 300 | Ga0207651_10015951 | 3300025960 | Bacteria | 4384 |
| 301 | Ga0207651_10260674 | 3300025960 | Bacteria | 1423 |
| 302 | Ga0207668_10047610 | 3300025972 | Bacteria | 2937 |
| 303 | Ga0207668_11062656 | 3300025972 | Bacteria | 725 |
| 304 | Ga0207658_10116867 | 3300025986 | Bacteria | 2119 |
| 305 | Ga0207658_10138061 | 3300025986 | Bacteria | 1969 |
| 306 | Ga0207677_10131730 | 3300026023 | Bacteria | 1900 |
| 307 | Ga0207639_10411781 | 3300026041 | Bacteria | 1220 |
| 308 | Ga0207678_10084616 | 3300026067 | Bacteria | 2712 |
| 309 | Ga0207678_10714213 | 3300026067 | Bacteria | 882 |
| 310 | Ga0207702_10515970 | 3300026078 | Bacteria | 1166 |
| 311 | Ga0207702_11459720 | 3300026078 | Bacteria | 678 |
| 312 | Ga0207641_10202290 | 3300026088 | Bacteria | 1832 |
| 313 | Ga0207641_10303541 | 3300026088 | Bacteria | 1509 |
| 314 | Ga0207648_10008667 | 3300026089 | Bacteria | 9815 |
| 315 | Ga0207648_10056617 | 3300026089 | Bacteria | 3421 |
| 316 | Ga0207648_10318910 | 3300026089 | Bacteria | 1396 |
| 317 | Ga0207648_10371640 | 3300026089 | Bacteria | 1291 |
| 318 | Ga0207648_10918843 | 3300026089 | Bacteria | 818 |
| 319 | Ga0207676_10193504 | 3300026095 | Bacteria | 1791 |
| 320 | Ga0207675_100105217 | 3300026118 | Bacteria | 2660 |
| 321 | Ga0207675_101797481 | 3300026118 | Bacteria | 632 |
| 322 | Ga0207683_10002948 | 3300026121 | Bacteria | 14846 |
| 323 | Ga0207683_10010175 | 3300026121 | Bacteria | 8021 |
| 324 | Ga0207683_10261790 | 3300026121 | Bacteria | 1579 |
| 325 | Ga0207683_10649439 | 3300026121 | Bacteria | 977 |
| 326 | Ga0207698_10269460 | 3300026142 | Bacteria | 1569 |
| 327 | Ga0268266_10319031 | 3300028379 | Bacteria | 1454 |
| 328 | Ga0268266_10624627 | 3300028379 | Bacteria | 1036 |
| 329 | Ga0265319_1015317 | 3300028563 | Bacteria | 2978 |
| 330 | Ga0265334_10129071 | 3300028573 | Bacteria | 900 |
| 331 | Ga0265318_10000771 | 3300028577 | Bacteria | 21283 |
| 332 | Ga0307515_10088177 | 3300028794 | Bacteria | 3926 |
| 333 | Ga0265338_10186467 | 3300028800 | Bacteria | 1576 |
| 334 | Ga0265338_10405982 | 3300028800 | Bacteria | 970 |
| 335 | Ga0265324_10090151 | 3300029957 | Bacteria | 1043 |
| 336 | Ga0307511_10192251 | 3300030521 | Bacteria | 1076 |
| 337 | Ga0316176_1077866 | 3300030732 | Bacteria | 2650 |
| 338 | Ga0316183_1163337 | 3300030742 | Bacteria | 12825 |
| 339 | Ga0265762_1017467 | 3300030760 | Bacteria | 1305 |
| 340 | Ga0265330_10000896 | 3300031235 | Bacteria | 18445 |
| 341 | Ga0265332_10049022 | 3300031238 | Bacteria | 1816 |
| 342 | Ga0265332_10049480 | 3300031238 | Bacteria | 1807 |
| 343 | Ga0265328_10006698 | 3300031239 | Bacteria | 4852 |
| 344 | Ga0265320_10001966 | 3300031240 | Bacteria | 14521 |
| 345 | Ga0265329_10006674 | 3300031242 | Bacteria | 4554 |
| 346 | Ga0265339_10021208 | 3300031249 | Bacteria | 3785 |
| 347 | Ga0265331_10000655 | 3300031250 | Bacteria | 29967 |
| 348 | Ga0265316_10030113 | 3300031344 | Bacteria | 4454 |
| 349 | Ga0307513_10246388 | 3300031456 | Bacteria | 1587 |
| 350 | Ga0307408_100058064 | 3300031548 | Bacteria | 2812 |
| 351 | Ga0265313_10030767 | 3300031595 | Bacteria | 2759 |
| 352 | Ga0265314_10011405 | 3300031711 | Bacteria | 7341 |
| 353 | Ga0265342_10000610 | 3300031712 | Bacteria | 37712 |
| 354 | Ga0307405_10001995 | 3300031731 | Bacteria | 8832 |
| 355 | Ga0307413_10201227 | 3300031824 | Bacteria | 1438 |
| 356 | Ga0307413_10229690 | 3300031824 | Bacteria | 1362 |
| 357 | Ga0307410_10001182 | 3300031852 | Bacteria | 11532 |
| 358 | Ga0307410_10526776 | 3300031852 | Bacteria | 976 |
| 359 | Ga0307406_10031956 | 3300031901 | Bacteria | 3209 |
| 360 | Ga0307406_10149828 | 3300031901 | Bacteria | 1663 |
| 361 | Ga0307407_10072632 | 3300031903 | Bacteria | 2053 |
| 362 | Ga0307407_11199021 | 3300031903 | Bacteria | 593 |
| 363 | Ga0307412_10001505 | 3300031911 | Bacteria | 12936 |
| 364 | Ga0307412_10168641 | 3300031911 | Bacteria | 1635 |
| 365 | Ga0307409_100219814 | 3300031995 | Bacteria | 1714 |
| 366 | Ga0307409_100581240 | 3300031995 | Bacteria | 1104 |
| 367 | Ga0307416_100172782 | 3300032002 | Bacteria | 2014 |
| 368 | Ga0307416_101189009 | 3300032002 | Bacteria | 868 |
| 369 | Ga0307416_101346757 | 3300032002 | Bacteria | 820 |
| 370 | Ga0307414_10043527 | 3300032004 | Bacteria | 3059 |
| 371 | Ga0307414_10051032 | 3300032004 | Bacteria | 2869 |
| 372 | Ga0307414_10332536 | 3300032004 | Bacteria | 1297 |
| 373 | Ga0307414_11021311 | 3300032004 | Bacteria | 762 |
| 374 | Ga0307411_10000810 | 3300032005 | Bacteria | 11680 |
| 375 | Ga0307411_10383475 | 3300032005 | Bacteria | 1157 |
| 376 | Ga0307411_11301255 | 3300032005 | Bacteria | 662 |
| 377 | Ga0307415_100337235 | 3300032126 | Bacteria | 1264 |
| 378 | Ga0373955_0360139 | 3300035172 | Bacteria | 882 |
| 379 | Ga0373931_0001775 | 3300035691 | Bacteria | 9370 |
| 380 | Ga0373927_0102494 | 3300035695 | Bacteria | 1862 |
| 381 | Ga0373927_0208775 | 3300035695 | Bacteria | 1283 |
| 382 | Ga0373927_1118932 | 3300035695 | Bacteria | 519 |
| 383 | Ga0373933_1082063 | 3300035724 | Bacteria | 528 |
| 384 | Ga0373947_0197561 | 3300035725 | Bacteria | 1315 |
| 385 | Ga0373947_0384291 | 3300035725 | Bacteria | 945 |
| 386 | Ga0373937_0611785 | 3300036401 | Bacteria | 1034 |
| 387 | Ga0373925_1557136 | 3300037068 | Bacteria | 540 |
| 388 | Ga0395905_0010184 | 3300037471 | Bacteria | 9163 |
| 389 | Ga0237816_00299 | 3300039145 | Bacteria | 4231 |
| 390 | Ga0436361_0044045 | 3300039447 | Bacteria | 1915 |
| 391 | Ga0436362_0770144 | 3300039453 | Bacteria | 749 |
| 392 | Ga0451791_0025746 | 3300041451 | Bacteria | 597 |
| 393 | Ga0451843_0659177 | 3300041509 | Bacteria | 806 |
| 394 | Ga0451853_3784381 | 3300041512 | Bacteria | 901 |
| 395 | Ga0439431_0004716 | 3300041997 | Bacteria | 2999 |
| 396 | Ga0439432_002824 | 3300042006 | Bacteria | 6476 |
| 397 | Ga0439432_022449 | 3300042006 | Bacteria | 2084 |
| 398 | Ga0450898_007681 | 3300042134 | Bacteria | 1684 |
| 399 | Ga0466963_0699745 | 3300044694 | Unclassified | 715 |
| 400 | Ga0466967_0220668 | 3300045976 | Bacteria | 1801 |
| 401 | Ga0466967_1928123 | 3300045976 | Bacteria | 587 |
| 402 | Ga0495627_048333 | 3300046453 | Bacteria | 1287 |
| 403 | Ga0495627_063540 | 3300046453 | Bacteria | 1088 |
| 404 | Ga0495592_0408035 | 3300046454 | Bacteria | 859 |
| 405 | Ga0495603_0243199 | 3300046455 | Bacteria | 1036 |
| 406 | Ga0495591_063921 | 3300046458 | Bacteria | 971 |
| 407 | Ga0495638_0001027 | 3300046460 | Bacteria | 27709 |
| 408 | Ga0495638_0005621 | 3300046460 | Bacteria | 9252 |
| 409 | Ga0495582_0236137 | 3300046473 | Bacteria | 1047 |
| 410 | Ga0495639_0008923 | 3300046475 | Bacteria | 4297 |
| 411 | Ga0495608_0210859 | 3300046511 | Bacteria | 1221 |
| 412 | Ga0495610_0001846 | 3300046512 | Bacteria | 18362 |
| 413 | Ga0495610_0053495 | 3300046512 | Bacteria | 1955 |
| 414 | Ga0495618_0212915 | 3300046514 | Bacteria | 1221 |
| 415 | Ga0495620_0192636 | 3300046515 | Bacteria | 786 |
| 416 | Ga0495628_0364370 | 3300046516 | Bacteria | 1060 |
| 417 | Ga0495630_0007539 | 3300046517 | Bacteria | 7777 |
| 418 | Ga0495631_0000377 | 3300046518 | Bacteria | 30621 |
| 419 | Ga0495632_0052539 | 3300046519 | Bacteria | 2003 |
| 420 | Ga0495643_0000599 | 3300046522 | Bacteria | 43638 |
| 421 | Ga0495648_0164760 | 3300046524 | Bacteria | 1142 |
| 422 | Ga0495663_0002208 | 3300046525 | Bacteria | 5921 |
| 423 | Ga0495609_0097071 | 3300046538 | Bacteria | 1278 |
| 424 | Ga0495621_0002800 | 3300046539 | Bacteria | 4742 |
| 425 | Ga0495633_0014072 | 3300046558 | Bacteria | 4195 |
| 426 | Ga0495633_0173228 | 3300046558 | Bacteria | 994 |
| 427 | Ga0495625_0079473 | 3300046660 | Bacteria | 2286 |
| 428 | Ga0495625_0342037 | 3300046660 | Bacteria | 948 |
| 429 | Ga0495625_0403392 | 3300046660 | Bacteria | 853 |
| 430 | Ga0495669_0082723 | 3300046684 | Bacteria | 1475 |
| 431 | Ga0495624_0011941 | 3300046690 | Bacteria | 5953 |
| 432 | Ga0495600_0490669 | 3300046809 | Bacteria | 756 |
| 433 | Ga0495581_0276198 | 3300047315 | Bacteria | 982 |
| 434 | Ga0495674_0007171 | 3300047319 | Bacteria | 10659 |
| 435 | Ga0495672_0000417 | 3300047320 | Bacteria | 51409 |
| 436 | Ga0495672_0047338 | 3300047320 | Bacteria | 2558 |
| 437 | Ga0495676_0128395 | 3300047321 | Bacteria | 1834 |
| 438 | Ga0495675_0360533 | 3300047444 | Bacteria | 853 |
| 439 | Ga0495681_0081520 | 3300047470 | Bacteria | 1443 |
| 440 | Ga0495684_0010912 | 3300047471 | Bacteria | 7022 |
| 441 | Ga0495686_0007669 | 3300047472 | Bacteria | 8054 |
| 442 | Ga0495686_0014989 | 3300047472 | Bacteria | 5313 |
| 443 | Ga0495686_0267100 | 3300047472 | Bacteria | 955 |
| 444 | Ga0495614_0162884 | 3300048089 | Bacteria | 998 |
| 445 | Ga0496100_0085837 | 3300048903 | Bacteria | 2137 |
| 446 | Ga0496102_0016307 | 3300048905 | Bacteria | 6489 |
| 447 | Ga0496104_0027645 | 3300048907 | Bacteria | 5251 |
| 448 | Ga0496105_0018338 | 3300048908 | Bacteria | 5621 |
| 449 | Ga0496105_0477379 | 3300048908 | Bacteria | 981 |
| 450 | Ga0496106_0785539 | 3300048909 | Bacteria | 756 |
| 451 | Ga0496107_0130550 | 3300048910 | Bacteria | 1855 |
| 452 | Ga0496109_0021280 | 3300048912 | Bacteria | 5734 |
| 453 | Ga0496109_0045374 | 3300048912 | Bacteria | 3988 |
| 454 | Ga0496109_0455982 | 3300048912 | Bacteria | 1207 |
| 455 | Ga0496110_0015011 | 3300048913 | Bacteria | 6442 |
| 456 | Ga0496110_0694397 | 3300048913 | Bacteria | 919 |
| 457 | Ga0496110_0767264 | 3300048913 | Bacteria | 868 |
| 458 | Ga0496112_1381946 | 3300048915 | Bacteria | 619 |
| 459 | Ga0496113_0040939 | 3300048916 | Bacteria | 3416 |
| 460 | Ga0496113_0591554 | 3300048916 | Bacteria | 889 |
| 461 | Ga0496114_0003114 | 3300048917 | Bacteria | 12721 |
| 462 | Ga0496114_0018036 | 3300048917 | Bacteria | 5702 |
| 463 | Ga0496114_0445622 | 3300048917 | Bacteria | 1147 |
| 464 | Ga0496115_0144963 | 3300048918 | Bacteria | 1960 |
| 465 | Ga0496116_0006114 | 3300048919 | Bacteria | 11011 |
| 466 | Ga0496116_0014356 | 3300048919 | Bacteria | 6332 |
| 467 | Ga0496116_0190214 | 3300048919 | Bacteria | 1087 |
| 468 | Ga0496116_0240756 | 3300048919 | Bacteria | 909 |
| 469 | Ga0496117_0002001 | 3300048920 | Bacteria | 26998 |
| 470 | Ga0496117_0015149 | 3300048920 | Bacteria | 6596 |
| 471 | Ga0496117_0491169 | 3300048920 | Bacteria | 597 |
| 472 | Ga0496118_0000074 | 3300048921 | Bacteria | 196515 |
| 473 | Ga0496118_0003117 | 3300048921 | Bacteria | 21240 |
| 474 | Ga0496118_0010014 | 3300048921 | Bacteria | 9453 |
| 475 | Ga0496118_0052668 | 3300048921 | Bacteria | 3101 |
| 476 | Ga0496118_0087856 | 3300048921 | Bacteria | 2153 |
| 477 | Ga0496118_0102015 | 3300048921 | Bacteria | 1935 |
| 478 | Ga0496119_0000209 | 3300048922 | Bacteria | 83605 |
| 479 | Ga0496119_0221140 | 3300048922 | Bacteria | 969 |
| 480 | Ga0496120_0000271 | 3300048923 | Bacteria | 86589 |
| 481 | Ga0496121_0041464 | 3300048924 | Bacteria | 4021 |
| 482 | Ga0496121_0045581 | 3300048924 | Bacteria | 3765 |
| 483 | Ga0496121_0087050 | 3300048924 | Bacteria | 2453 |
| 484 | Ga0496121_0168428 | 3300048924 | Bacteria | 1594 |
| 485 | Ga0496121_0183733 | 3300048924 | Bacteria | 1506 |
| 486 | Ga0496122_0000806 | 3300048925 | Bacteria | 60153 |
| 487 | Ga0496122_0003584 | 3300048925 | Bacteria | 20262 |
| 488 | Ga0496122_0215029 | 3300048925 | Bacteria | 1109 |
| 489 | Ga0496122_0235339 | 3300048925 | Bacteria | 1037 |
| 490 | Ga0496122_0279074 | 3300048925 | Bacteria | 914 |
| 491 | Ga0496122_0535104 | 3300048925 | Bacteria | 562 |
| 492 | Ga0496122_0561581 | 3300048925 | Bacteria | 541 |
| 493 | Ga0496123_0001338 | 3300048926 | Bacteria | 34837 |
| 494 | Ga0496123_0062952 | 3300048926 | Bacteria | 2373 |
| 495 | Ga0496123_0066919 | 3300048926 | Bacteria | 2272 |
| 496 | Ga0496123_0128180 | 3300048926 | Bacteria | 1412 |
| 497 | Ga0496123_0152807 | 3300048926 | Bacteria | 1242 |
| 498 | Ga0496123_0369802 | 3300048926 | Bacteria | 661 |
| 499 | Ga0496124_0000447 | 3300048927 | Bacteria | 72640 |
| 500 | Ga0496124_0000584 | 3300048927 | Bacteria | 61524 |
| 501 | Ga0496124_0003380 | 3300048927 | Bacteria | 19595 |
| 502 | Ga0496124_0006152 | 3300048927 | Bacteria | 13166 |
| 503 | Ga0496124_0007796 | 3300048927 | Bacteria | 11309 |
| 504 | Ga0496124_0022871 | 3300048927 | Bacteria | 5722 |
| 505 | Ga0496124_0176699 | 3300048927 | Bacteria | 1647 |
| 506 | Ga0496124_0188890 | 3300048927 | Bacteria | 1578 |
| 507 | Ga0496125_0000144 | 3300048928 | Bacteria | 156270 |
| 508 | Ga0496125_0000249 | 3300048928 | Bacteria | 110627 |
| 509 | Ga0496125_0001175 | 3300048928 | Bacteria | 39654 |
| 510 | Ga0496125_0014229 | 3300048928 | Bacteria | 7757 |
| 511 | Ga0496125_0084422 | 3300048928 | Bacteria | 2411 |
| 512 | Ga0496125_0123116 | 3300048928 | Bacteria | 1844 |
| 513 | Ga0496125_0291232 | 3300048928 | Bacteria | 1005 |
| 514 | Ga0496126_0000795 | 3300048929 | Bacteria | 56626 |
| 515 | Ga0496126_0432824 | 3300048929 | Bacteria | 1062 |
| 516 | Ga0501032_0012290 | 3300049569 | Bacteria | 6125 |
| 517 | Ga0501032_0157428 | 3300049569 | Bacteria | 1492 |
| 518 | Ga0501032_0193594 | 3300049569 | Bacteria | 1328 |
| 519 | Ga0501033_0014081 | 3300049570 | Bacteria | 6081 |
| 520 | Ga0501033_0180902 | 3300049570 | Bacteria | 1511 |
| 521 | Ga0501034_0141473 | 3300049571 | Bacteria | 2385 |
| 522 | Ga0501036_0005157 | 3300049572 | Bacteria | 10561 |
| 523 | Ga0501036_1066489 | 3300049572 | Bacteria | 660 |
| 524 | Ga0501037_0004374 | 3300049573 | Bacteria | 10257 |
| 525 | Ga0501037_0227791 | 3300049573 | Bacteria | 1309 |
| 526 | Ga0501038_0003804 | 3300049574 | Bacteria | 14045 |
| 527 | Ga0501038_0334226 | 3300049574 | Bacteria | 1183 |
| 528 | Ga0501039_0010961 | 3300049575 | Bacteria | 6909 |
| 529 | Ga0501040_0034073 | 3300049576 | Bacteria | 3450 |
| 530 | Ga0501041_0412813 | 3300049577 | Bacteria | 856 |
| 531 | Ga0501043_0000112 | 3300049579 | Bacteria | 76249 |
| 532 | Ga0501043_0027147 | 3300049579 | Bacteria | 4494 |
| 533 | Ga0501043_0106119 | 3300049579 | Bacteria | 2206 |
| 534 | Ga0501046_0000146 | 3300049580 | Bacteria | 74204 |
| 535 | Ga0501046_0310480 | 3300049580 | Bacteria | 1150 |
| 536 | Ga0501047_0000192 | 3300049581 | Bacteria | 74300 |
| 537 | Ga0501047_0027750 | 3300049581 | Bacteria | 5454 |
| 538 | Ga0501047_0080878 | 3300049581 | Bacteria | 3123 |
| 539 | Ga0501047_0415312 | 3300049581 | Bacteria | 1177 |
| 540 | Ga0501048_0000874 | 3300049582 | Bacteria | 22228 |
| 541 | Ga0501048_0057688 | 3300049582 | Bacteria | 2753 |
| 542 | Ga0501068_0106082 | 3300049584 | Bacteria | 1744 |
| 543 | Ga0501070_0008181 | 3300049586 | Bacteria | 8844 |
| 544 | Ga0501070_0010434 | 3300049586 | Bacteria | 7853 |
| 545 | Ga0501070_0152842 | 3300049586 | Bacteria | 1904 |
| 546 | Ga0501072_0188346 | 3300049588 | Bacteria | 1646 |
| 547 | Ga0501072_0357775 | 3300049588 | Bacteria | 1159 |
| 548 | Ga0501206_021359 | 3300049653 | Bacteria | 924 |
| 549 | Ga0501079_0418176 | 3300049741 | Bacteria | 1052 |
| 550 | Ga0501080_0549332 | 3300049742 | Bacteria | 1029 |
| 551 | Ga0501081_0449409 | 3300049743 | Bacteria | 957 |
| 552 | Ga0501083_0172188 | 3300049744 | Bacteria | 1415 |
| 553 | Ga0501035_0003656 | 3300049822 | Bacteria | 14665 |
| 554 | Ga0501035_0007745 | 3300049822 | Bacteria | 10033 |
| 555 | Ga0501035_0457163 | 3300049822 | Bacteria | 1055 |
| 556 | Ga0501044_0007912 | 3300049823 | Bacteria | 11689 |
| 557 | Ga0501044_0033554 | 3300049823 | Bacteria | 5393 |
| 558 | Ga0501044_0045370 | 3300049823 | Bacteria | 4553 |
| 559 | Ga0501044_0541438 | 3300049823 | Bacteria | 1062 |
| 560 | Ga0501045_0002450 | 3300049824 | Bacteria | 12613 |
| 561 | Ga0501045_0455153 | 3300049824 | Bacteria | 951 |
| 562 | Ga0501045_1439790 | 3300049824 | Unclassified | 500 |
| 563 | nmdc:mga03n38_468352_c1 | 3300050490 | Bacteria | 703 |
| 564 | nmdc:mga00v17_88025_c1 | 3300050491 | Bacteria | 1947 |
| 565 | nmdc:mga06z11_53917_c1 | 3300050494 | Bacteria | 1181 |
| 566 | nmdc:mga07m45_329451_c1 | 3300050496 | Bacteria | 887 |
| 567 | nmdc:mga09592_688939_c1 | 3300050508 | Bacteria | 870 |
| 568 | nmdc:mga06r32_606831_c1 | 3300050510 | Bacteria | 1065 |
| 569 | nmdc:mga08y16_620258_c1 | 3300050511 | Bacteria | 1088 |
| 570 | Ga0495601_0311672 | 3300053077 | Bacteria | 1025 |
| 571 | Ga0500644_0004351 | 3300053088 | Bacteria | 3540 |
| 572 | Ga0500562_004562 | 3300053108 | Bacteria | 3498 |
| 573 | Ga0500608_174549 | 3300053122 | Bacteria | 917 |
| 574 | Ga0500626_041832 | 3300053128 | Bacteria | 2071 |
| 575 | Ga0500658_0045363 | 3300053134 | Bacteria | 1777 |
| 576 | Ga0500564_109086 | 3300053138 | Bacteria | 1216 |
| 577 | Ga0500568_0193812 | 3300053139 | Bacteria | 745 |
| 578 | Ga0500622_0195894 | 3300053156 | Bacteria | 922 |
| 579 | Ga0500636_0001890 | 3300053177 | Bacteria | 11469 |
| 580 | Ga0500645_003129 | 3300053730 | Bacteria | 6894 |
| 581 | Ga0500565_001261 | 3300053734 | Bacteria | 1656 |
| 582 | Ga0500661_002466 | 3300055283 | Bacteria | 3485 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041451 | Ga0451791_0025746 | Ga0451791_0025746_65_472 | 114 |
| 2 | 3300046458 | Ga0495591_063921 | Ga0495591_063921_212_592 | 119 |
| 3 | 3300005295 | Ga0065707_10105030 | Ga0065707_101050304 | 124 |
| 4 | 3300005340 | Ga0070689_100738574 | Ga0070689_1007385742 | 124 |
| 5 | 3300005354 | Ga0070675_100066881 | Ga0070675_1000668813 | 124 |
| 6 | 3300005444 | Ga0070694_100045455 | Ga0070694_1000454552 | 124 |
| 7 | 3300005545 | Ga0070695_100022455 | Ga0070695_1000224553 | 124 |
| 8 | 3300005546 | Ga0070696_100010058 | Ga0070696_1000100583 | 124 |
| 9 | 3300005549 | Ga0070704_100217433 | Ga0070704_1002174331 | 124 |
| 10 | 3300005719 | Ga0068861_100270155 | Ga0068861_1002701553 | 124 |
| 11 | 3300025926 | Ga0207659_10080176 | Ga0207659_100801763 | 124 |
| 12 | 3300025936 | Ga0207670_10662186 | Ga0207670_106621862 | 124 |
| 13 | 3300025942 | Ga0207689_11089476 | Ga0207689_110894762 | 124 |
| 14 | 3300026118 | Ga0207675_100105217 | Ga0207675_1001052174 | 124 |
| 15 | 3300048912 | Ga0496109_0455982 | Ga0496109_0455982_10_384 | 124 |
| 16 | 3300003752 | Ga0055539_1000524 | Ga0055539_10005249 | 125 |
| 17 | 3300003756 | Ga0055533_1000033 | Ga0055533_1000033135 | 125 |
| 18 | 3300003759 | Ga0055525_1001150 | Ga0055525_10011508 | 125 |
| 19 | 3300025226 | Ga0209674_100064 | Ga0209674_100064114 | 125 |
| 20 | 3300025230 | Ga0209563_100099 | Ga0209563_100099114 | 125 |
| 21 | 3300025253 | Ga0209677_100175 | Ga0209677_10017523 | 125 |
| 22 | 3300039447 | Ga0436361_0044045 | Ga0436361_0044045_1401_1823 | 125 |
| 23 | 3300003781 | Ga0055536_1039856 | Ga0055536_10398563 | 126 |
| 24 | 3300003791 | Ga0055530_10000771 | Ga0055530_1000077116 | 126 |
| 25 | 3300003791 | Ga0055530_10000810 | Ga0055530_100008109 | 126 |
| 26 | 3300003791 | Ga0055530_10003077 | Ga0055530_1000307710 | 126 |
| 27 | 3300003792 | Ga0055540_1024829 | Ga0055540_10248292 | 126 |
| 28 | 3300003794 | Ga0055531_10049685 | Ga0055531_100496852 | 126 |
| 29 | 3300005327 | Ga0070658_10107275 | Ga0070658_101072751 | 126 |
| 30 | 3300005327 | Ga0070658_10195570 | Ga0070658_101955702 | 126 |
| 31 | 3300005331 | Ga0070670_100089561 | Ga0070670_1000895614 | 126 |
| 32 | 3300005338 | Ga0068868_100391055 | Ga0068868_1003910552 | 126 |
| 33 | 3300005355 | Ga0070671_100203465 | Ga0070671_1002034652 | 126 |
| 34 | 3300005456 | Ga0070678_100134298 | Ga0070678_1001342982 | 126 |
| 35 | 3300005459 | Ga0068867_100510106 | Ga0068867_1005101063 | 126 |
| 36 | 3300005548 | Ga0070665_100162380 | Ga0070665_1001623803 | 126 |
| 37 | 3300005563 | Ga0068855_100123731 | Ga0068855_1001237312 | 126 |
| 38 | 3300005563 | Ga0068855_100123758 | Ga0068855_1001237584 | 126 |
| 39 | 3300005563 | Ga0068855_101146781 | Ga0068855_1011467812 | 126 |
| 40 | 3300005614 | Ga0068856_100561534 | Ga0068856_1005615342 | 126 |
| 41 | 3300005614 | Ga0068856_102025414 | Ga0068856_1020254142 | 126 |
| 42 | 3300005616 | Ga0068852_100318908 | Ga0068852_1003189082 | 126 |
| 43 | 3300005834 | Ga0068851_10256008 | Ga0068851_102560082 | 126 |
| 44 | 3300006163 | Ga0070715_10447997 | Ga0070715_104479972 | 126 |
| 45 | 3300009036 | Ga0105244_10019427 | Ga0105244_100194274 | 126 |
| 46 | 3300009093 | Ga0105240_10114002 | Ga0105240_101140024 | 126 |
| 47 | 3300009553 | Ga0105249_11870280 | Ga0105249_118702802 | 126 |
| 48 | 3300010375 | Ga0105239_11093337 | Ga0105239_110933371 | 126 |
| 49 | 3300013100 | Ga0157373_10179905 | Ga0157373_101799052 | 126 |
| 50 | 3300013102 | Ga0157371_10000206 | Ga0157371_1000020624 | 126 |
| 51 | 3300013104 | Ga0157370_10008242 | Ga0157370_100082424 | 126 |
| 52 | 3300013105 | Ga0157369_12087809 | Ga0157369_120878092 | 126 |
| 53 | 3300013306 | Ga0163162_10789010 | Ga0163162_107890102 | 126 |
| 54 | 3300013308 | Ga0157375_10018984 | Ga0157375_100189843 | 126 |
| 55 | 3300014326 | Ga0157380_10142640 | Ga0157380_101426402 | 126 |
| 56 | 3300014326 | Ga0157380_11565932 | Ga0157380_115659322 | 126 |
| 57 | 3300014497 | Ga0182008_10000362 | Ga0182008_100003623 | 126 |
| 58 | 3300015261 | Ga0182006_1042246 | Ga0182006_10422462 | 126 |
| 59 | 3300015262 | Ga0182007_10000061 | Ga0182007_1000006142 | 126 |
| 60 | 3300015265 | Ga0182005_1000413 | Ga0182005_100041317 | 126 |
| 61 | 3300017792 | Ga0163161_10000327 | Ga0163161_1000032711 | 126 |
| 62 | 3300025231 | Ga0207427_102399 | Ga0207427_1023992 | 126 |
| 63 | 3300025256 | Ga0209759_1009118 | Ga0209759_10091184 | 126 |
| 64 | 3300025256 | Ga0209759_1038691 | Ga0209759_10386912 | 126 |
| 65 | 3300025292 | Ga0209676_1000018 | Ga0209676_1000018122 | 126 |
| 66 | 3300025298 | Ga0209050_1000424 | Ga0209050_100042427 | 126 |
| 67 | 3300025298 | Ga0209050_1000610 | Ga0209050_100061026 | 126 |
| 68 | 3300025298 | Ga0209050_1007404 | Ga0209050_10074047 | 126 |
| 69 | 3300025299 | Ga0209256_1000061 | Ga0209256_100006194 | 126 |
| 70 | 3300025303 | Ga0209051_1000809 | Ga0209051_100080924 | 126 |
| 71 | 3300025304 | Ga0209257_1000035 | Ga0209257_1000035122 | 126 |
| 72 | 3300025905 | Ga0207685_10148203 | Ga0207685_101482033 | 126 |
| 73 | 3300025909 | Ga0207705_10076200 | Ga0207705_100762003 | 126 |
| 74 | 3300025913 | Ga0207695_10082179 | Ga0207695_100821792 | 126 |
| 75 | 3300025931 | Ga0207644_10673350 | Ga0207644_106733502 | 126 |
| 76 | 3300025932 | Ga0207690_10664094 | Ga0207690_106640942 | 126 |
| 77 | 3300025949 | Ga0207667_10095030 | Ga0207667_100950304 | 126 |
| 78 | 3300025949 | Ga0207667_10338553 | Ga0207667_103385532 | 126 |
| 79 | 3300026067 | Ga0207678_10714213 | Ga0207678_107142132 | 126 |
| 80 | 3300026078 | Ga0207702_10515970 | Ga0207702_105159702 | 126 |
| 81 | 3300026078 | Ga0207702_11459720 | Ga0207702_114597202 | 126 |
| 82 | 3300026142 | Ga0207698_10269460 | Ga0207698_102694603 | 126 |
| 83 | 3300030521 | Ga0307511_10192251 | Ga0307511_101922511 | 126 |
| 84 | 3300030732 | Ga0316176_1077866 | Ga0316176_10778663 | 126 |
| 85 | 3300032002 | Ga0307416_101346757 | Ga0307416_1013467572 | 126 |
| 86 | 3300032004 | Ga0307414_10332536 | Ga0307414_103325362 | 126 |
| 87 | 3300041509 | Ga0451843_0659177 | Ga0451843_0659177_199_600 | 126 |
| 88 | 3300041512 | Ga0451853_3784381 | Ga0451853_3784381_452_853 | 126 |
| 89 | 3300044694 | Ga0466963_0699745 | Ga0466963_0699745_211_615 | 126 |
| 90 | 3300046453 | Ga0495627_048333 | Ga0495627_048333_470_871 | 126 |
| 91 | 3300046460 | Ga0495638_0001027 | Ga0495638_0001027_648_1049 | 126 |
| 92 | 3300046512 | Ga0495610_0053495 | Ga0495610_0053495_316_696 | 126 |
| 93 | 3300046515 | Ga0495620_0192636 | Ga0495620_0192636_246_626 | 126 |
| 94 | 3300046519 | Ga0495632_0052539 | Ga0495632_0052539_1325_1705 | 126 |
| 95 | 3300046524 | Ga0495648_0164760 | Ga0495648_0164760_640_1041 | 126 |
| 96 | 3300046525 | Ga0495663_0002208 | Ga0495663_0002208_4814_5215 | 126 |
| 97 | 3300046538 | Ga0495609_0097071 | Ga0495609_0097071_865_1266 | 126 |
| 98 | 3300046539 | Ga0495621_0002800 | Ga0495621_0002800_3742_4122 | 126 |
| 99 | 3300046558 | Ga0495633_0014072 | Ga0495633_0014072_3675_4076 | 126 |
| 100 | 3300046558 | Ga0495633_0173228 | Ga0495633_0173228_489_890 | 126 |
| 101 | 3300047320 | Ga0495672_0047338 | Ga0495672_0047338_1687_2088 | 126 |
| 102 | 3300047470 | Ga0495681_0081520 | Ga0495681_0081520_72_473 | 126 |
| 103 | 3300047472 | Ga0495686_0267100 | Ga0495686_0267100_523_903 | 126 |
| 104 | 3300048903 | Ga0496100_0085837 | Ga0496100_0085837_1341_1721 | 126 |
| 105 | 3300048905 | Ga0496102_0016307 | Ga0496102_0016307_4508_4888 | 126 |
| 106 | 3300048907 | Ga0496104_0027645 | Ga0496104_0027645_2465_2845 | 126 |
| 107 | 3300048908 | Ga0496105_0018338 | Ga0496105_0018338_1273_1653 | 126 |
| 108 | 3300048908 | Ga0496105_0477379 | Ga0496105_0477379_448_849 | 126 |
| 109 | 3300048909 | Ga0496106_0785539 | Ga0496106_0785539_10_390 | 126 |
| 110 | 3300048910 | Ga0496107_0130550 | Ga0496107_0130550_1180_1560 | 126 |
| 111 | 3300048912 | Ga0496109_0021280 | Ga0496109_0021280_1828_2208 | 126 |
| 112 | 3300048913 | Ga0496110_0015011 | Ga0496110_0015011_851_1231 | 126 |
| 113 | 3300048916 | Ga0496113_0040939 | Ga0496113_0040939_1307_1708 | 126 |
| 114 | 3300048917 | Ga0496114_0003114 | Ga0496114_0003114_10921_11301 | 126 |
| 115 | 3300048918 | Ga0496115_0144963 | Ga0496115_0144963_1237_1617 | 126 |
| 116 | 3300048919 | Ga0496116_0006114 | Ga0496116_0006114_8662_9063 | 126 |
| 117 | 3300048919 | Ga0496116_0014356 | Ga0496116_0014356_1777_2178 | 126 |
| 118 | 3300048920 | Ga0496117_0002001 | Ga0496117_0002001_5579_5980 | 126 |
| 119 | 3300048920 | Ga0496117_0491169 | Ga0496117_0491169_77_478 | 126 |
| 120 | 3300048921 | Ga0496118_0000074 | Ga0496118_0000074_161472_161873 | 126 |
| 121 | 3300048921 | Ga0496118_0010014 | Ga0496118_0010014_2343_2744 | 126 |
| 122 | 3300048921 | Ga0496118_0052668 | Ga0496118_0052668_2193_2594 | 126 |
| 123 | 3300048921 | Ga0496118_0087856 | Ga0496118_0087856_1119_1520 | 126 |
| 124 | 3300048921 | Ga0496118_0102015 | Ga0496118_0102015_307_708 | 126 |
| 125 | 3300048922 | Ga0496119_0000209 | Ga0496119_0000209_19971_20372 | 126 |
| 126 | 3300048922 | Ga0496119_0221140 | Ga0496119_0221140_89_490 | 126 |
| 127 | 3300048923 | Ga0496120_0000271 | Ga0496120_0000271_22938_23339 | 126 |
| 128 | 3300048924 | Ga0496121_0041464 | Ga0496121_0041464_1002_1403 | 126 |
| 129 | 3300048924 | Ga0496121_0045581 | Ga0496121_0045581_1168_1569 | 126 |
| 130 | 3300048924 | Ga0496121_0087050 | Ga0496121_0087050_632_1033 | 126 |
| 131 | 3300048924 | Ga0496121_0168428 | Ga0496121_0168428_600_1001 | 126 |
| 132 | 3300048924 | Ga0496121_0183733 | Ga0496121_0183733_165_566 | 126 |
| 133 | 3300048925 | Ga0496122_0000806 | Ga0496122_0000806_1441_1842 | 126 |
| 134 | 3300048925 | Ga0496122_0003584 | Ga0496122_0003584_11371_11772 | 126 |
| 135 | 3300048925 | Ga0496122_0215029 | Ga0496122_0215029_452_853 | 126 |
| 136 | 3300048925 | Ga0496122_0235339 | Ga0496122_0235339_299_700 | 126 |
| 137 | 3300048926 | Ga0496123_0001338 | Ga0496123_0001338_32729_33130 | 126 |
| 138 | 3300048926 | Ga0496123_0066919 | Ga0496123_0066919_620_1021 | 126 |
| 139 | 3300048926 | Ga0496123_0152807 | Ga0496123_0152807_661_1062 | 126 |
| 140 | 3300048926 | Ga0496123_0369802 | Ga0496123_0369802_79_480 | 126 |
| 141 | 3300048927 | Ga0496124_0000447 | Ga0496124_0000447_25701_26102 | 126 |
| 142 | 3300048927 | Ga0496124_0000584 | Ga0496124_0000584_33724_34125 | 126 |
| 143 | 3300048927 | Ga0496124_0003380 | Ga0496124_0003380_9217_9618 | 126 |
| 144 | 3300048927 | Ga0496124_0006152 | Ga0496124_0006152_7556_7957 | 126 |
| 145 | 3300048927 | Ga0496124_0007796 | Ga0496124_0007796_5607_6008 | 126 |
| 146 | 3300048927 | Ga0496124_0022871 | Ga0496124_0022871_5299_5700 | 126 |
| 147 | 3300048927 | Ga0496124_0176699 | Ga0496124_0176699_989_1390 | 126 |
| 148 | 3300048928 | Ga0496125_0000144 | Ga0496125_0000144_23680_24081 | 126 |
| 149 | 3300048928 | Ga0496125_0000249 | Ga0496125_0000249_22902_23303 | 126 |
| 150 | 3300048928 | Ga0496125_0001175 | Ga0496125_0001175_10558_10959 | 126 |
| 151 | 3300048928 | Ga0496125_0084422 | Ga0496125_0084422_181_582 | 126 |
| 152 | 3300048928 | Ga0496125_0123116 | Ga0496125_0123116_418_819 | 126 |
| 153 | 3300048929 | Ga0496126_0000795 | Ga0496126_0000795_33231_33632 | 126 |
| 154 | 3300049576 | Ga0501040_0034073 | Ga0501040_0034073_1680_2087 | 126 |
| 155 | 3300049577 | Ga0501041_0412813 | Ga0501041_0412813_217_624 | 126 |
| 156 | 3300049580 | Ga0501046_0310480 | Ga0501046_0310480_696_1103 | 126 |
| 157 | 3300049588 | Ga0501072_0357775 | Ga0501072_0357775_610_1017 | 126 |
| 158 | 3300049653 | Ga0501206_021359 | Ga0501206_021359_83_463 | 126 |
| 159 | 3300049741 | Ga0501079_0418176 | Ga0501079_0418176_56_463 | 126 |
| 160 | 3300049743 | Ga0501081_0449409 | Ga0501081_0449409_393_800 | 126 |
| 161 | 3300053077 | Ga0495601_0311672 | Ga0495601_0311672_66_446 | 126 |
| 162 | 3300053128 | Ga0500626_041832 | Ga0500626_041832_475_876 | 126 |
| 163 | 3300053134 | Ga0500658_0045363 | Ga0500658_0045363_57_437 | 126 |
| 164 | 3300053138 | Ga0500564_109086 | Ga0500564_109086_715_1095 | 126 |
| 165 | 3300053156 | Ga0500622_0195894 | Ga0500622_0195894_17_397 | 126 |
| 166 | 3300053177 | Ga0500636_0001890 | Ga0500636_0001890_10574_10954 | 126 |
| 167 | 3300053734 | Ga0500565_001261 | Ga0500565_001261_1207_1608 | 126 |
| 168 | 3300003771 | Ga0055526_1001795 | Ga0055526_100179514 | 127 |
| 169 | 3300003773 | Ga0055537_1000201 | Ga0055537_100020140 | 127 |
| 170 | 3300003775 | Ga0055524_1035556 | Ga0055524_10355562 | 127 |
| 171 | 3300003784 | Ga0055534_1000075 | Ga0055534_100007534 | 127 |
| 172 | 3300003790 | Ga0055528_1000271 | Ga0055528_100027150 | 127 |
| 173 | 3300003790 | Ga0055528_1002305 | Ga0055528_10023059 | 127 |
| 174 | 3300003791 | Ga0055530_10121864 | Ga0055530_101218641 | 127 |
| 175 | 3300003794 | Ga0055531_10009298 | Ga0055531_100092982 | 127 |
| 176 | 3300003794 | Ga0055531_10041919 | Ga0055531_100419192 | 127 |
| 177 | 3300006051 | Ga0075364_10086872 | Ga0075364_100868722 | 127 |
| 178 | 3300006178 | Ga0075367_10220061 | Ga0075367_102200612 | 127 |
| 179 | 3300014497 | Ga0182008_10094359 | Ga0182008_100943592 | 127 |
| 180 | 3300015261 | Ga0182006_1024490 | Ga0182006_10244902 | 127 |
| 181 | 3300017792 | Ga0163161_10551661 | Ga0163161_105516612 | 127 |
| 182 | 3300025263 | Ga0209565_1000050 | Ga0209565_1000050140 | 127 |
| 183 | 3300025273 | Ga0209673_1000199 | Ga0209673_100019921 | 127 |
| 184 | 3300025291 | Ga0209675_1000007 | Ga0209675_1000007466 | 127 |
| 185 | 3300025291 | Ga0209675_1068761 | Ga0209675_10687611 | 127 |
| 186 | 3300025295 | Ga0209564_1000061 | Ga0209564_1000061239 | 127 |
| 187 | 3300025298 | Ga0209050_1051256 | Ga0209050_10512562 | 127 |
| 188 | 3300025299 | Ga0209256_1004229 | Ga0209256_100422913 | 127 |
| 189 | 3300025299 | Ga0209256_1043595 | Ga0209256_10435952 | 127 |
| 190 | 3300025304 | Ga0209257_1003209 | Ga0209257_100320912 | 127 |
| 191 | 3300025304 | Ga0209257_1024310 | Ga0209257_10243101 | 127 |
| 192 | 3300025923 | Ga0207681_10446966 | Ga0207681_104469662 | 127 |
| 193 | 3300025972 | Ga0207668_11062656 | Ga0207668_110626562 | 127 |
| 194 | 3300030742 | Ga0316183_1163337 | Ga0316183_11633376 | 127 |
| 195 | 3300030760 | Ga0265762_1017467 | Ga0265762_10174672 | 127 |
| 196 | 3300032004 | Ga0307414_11021311 | Ga0307414_110213112 | 127 |
| 197 | 3300032005 | Ga0307411_10383475 | Ga0307411_103834752 | 127 |
| 198 | 3300035172 | Ga0373955_0360139 | Ga0373955_0360139_65_469 | 127 |
| 199 | 3300042006 | Ga0439432_002824 | Ga0439432_002824_4413_4814 | 127 |
| 200 | 3300042006 | Ga0439432_022449 | Ga0439432_022449_1181_1582 | 127 |
| 201 | 3300046453 | Ga0495627_063540 | Ga0495627_063540_416_817 | 127 |
| 202 | 3300046460 | Ga0495638_0005621 | Ga0495638_0005621_7497_7898 | 127 |
| 203 | 3300046512 | Ga0495610_0001846 | Ga0495610_0001846_5696_6097 | 127 |
| 204 | 3300046518 | Ga0495631_0000377 | Ga0495631_0000377_11800_12201 | 127 |
| 205 | 3300046522 | Ga0495643_0000599 | Ga0495643_0000599_26021_26422 | 127 |
| 206 | 3300046660 | Ga0495625_0079473 | Ga0495625_0079473_1444_1845 | 127 |
| 207 | 3300046660 | Ga0495625_0342037 | Ga0495625_0342037_67_468 | 127 |
| 208 | 3300046660 | Ga0495625_0403392 | Ga0495625_0403392_370_771 | 127 |
| 209 | 3300047320 | Ga0495672_0000417 | Ga0495672_0000417_24859_25260 | 127 |
| 210 | 3300047472 | Ga0495686_0014989 | Ga0495686_0014989_659_1060 | 127 |
| 211 | 3300048913 | Ga0496110_0694397 | Ga0496110_0694397_203_604 | 127 |
| 212 | 3300048919 | Ga0496116_0190214 | Ga0496116_0190214_487_888 | 127 |
| 213 | 3300048920 | Ga0496117_0015149 | Ga0496117_0015149_232_633 | 127 |
| 214 | 3300048921 | Ga0496118_0003117 | Ga0496118_0003117_8763_9164 | 127 |
| 215 | 3300048925 | Ga0496122_0279074 | Ga0496122_0279074_77_478 | 127 |
| 216 | 3300048926 | Ga0496123_0062952 | Ga0496123_0062952_1359_1760 | 127 |
| 217 | 3300048926 | Ga0496123_0128180 | Ga0496123_0128180_894_1310 | 127 |
| 218 | 3300048928 | Ga0496125_0014229 | Ga0496125_0014229_498_899 | 127 |
| 219 | 3300048928 | Ga0496125_0291232 | Ga0496125_0291232_26_442 | 127 |
| 220 | 3300049569 | Ga0501032_0157428 | Ga0501032_0157428_861_1283 | 127 |
| 221 | 3300049574 | Ga0501038_0334226 | Ga0501038_0334226_587_1009 | 127 |
| 222 | 3300049581 | Ga0501047_0080878 | Ga0501047_0080878_868_1272 | 127 |
| 223 | 3300049582 | Ga0501048_0057688 | Ga0501048_0057688_712_1116 | 127 |
| 224 | 3300049586 | Ga0501070_0010434 | Ga0501070_0010434_6013_6435 | 127 |
| 225 | 3300049742 | Ga0501080_0549332 | Ga0501080_0549332_418_840 | 127 |
| 226 | 3300049822 | Ga0501035_0003656 | Ga0501035_0003656_9697_10101 | 127 |
| 227 | 3300049823 | Ga0501044_0033554 | Ga0501044_0033554_2741_3145 | 127 |
| 228 | 3300050490 | nmdc:mga03n38_468352_c1 | nmdc:mga03n38_468352_c1_146_547 | 127 |
| 229 | 3300050491 | nmdc:mga00v17_88025_c1 | nmdc:mga00v17_88025_c1_1156_1557 | 127 |
| 230 | 3300050494 | nmdc:mga06z11_53917_c1 | nmdc:mga06z11_53917_c1_525_926 | 127 |
| 231 | 3300050496 | nmdc:mga07m45_329451_c1 | nmdc:mga07m45_329451_c1_316_717 | 127 |
| 232 | iso_pu_bacteria | 2643221654 | 2644303237 | 128 |
| 233 | iso_pu_bacteria | 2842757796 | 2842758102 | 129 |
| 234 | iso_pu_bacteria | 2852649853 | 2852650400 | 129 |
| 235 | iso_pu_bacteria | 2939589442 | 2939589934 | 129 |
| 236 | iso_pu_bacteria | 2941475908 | 2941476233 | 129 |
| 237 | iso_pu_bacteria | 2974307012 | 2974307521 | 129 |
| 238 | iso_pu_bacteria | 2977247770 | 2977248234 | 129 |
| 239 | iso_pu_bacteria | 2984514374 | 2984517275 | 129 |
| 240 | 3300025912 | Ga0207707_10337008 | Ga0207707_103370082 | 130 |
| 241 | 3300039453 | Ga0436362_0770144 | Ga0436362_0770144_240_632 | 130 |
| 242 | iso_pu_bacteria | 2593339239 | 2595451110 | 130 |
| 243 | iso_pu_bacteria | 8055878733 | 8055883562 | 130 |
| 244 | 3300005328 | Ga0070676_10035979 | Ga0070676_100359793 | 131 |
| 245 | 3300005331 | Ga0070670_100053650 | Ga0070670_1000536504 | 131 |
| 246 | 3300005333 | Ga0070677_10001160 | Ga0070677_100011606 | 131 |
| 247 | 3300005353 | Ga0070669_100192754 | Ga0070669_1001927542 | 131 |
| 248 | 3300005354 | Ga0070675_100247771 | Ga0070675_1002477711 | 131 |
| 249 | 3300005355 | Ga0070671_100158279 | Ga0070671_1001582792 | 131 |
| 250 | 3300005356 | Ga0070674_100055454 | Ga0070674_1000554542 | 131 |
| 251 | 3300005364 | Ga0070673_100239877 | Ga0070673_1002398772 | 131 |
| 252 | 3300005364 | Ga0070673_100264984 | Ga0070673_1002649842 | 131 |
| 253 | 3300005367 | Ga0070667_100084105 | Ga0070667_1000841052 | 131 |
| 254 | 3300005456 | Ga0070678_100008183 | Ga0070678_1000081836 | 131 |
| 255 | 3300005459 | Ga0068867_100199954 | Ga0068867_1001999541 | 131 |
| 256 | 3300005543 | Ga0070672_100225072 | Ga0070672_1002250722 | 131 |
| 257 | 3300005548 | Ga0070665_100222965 | Ga0070665_1002229653 | 131 |
| 258 | 3300005719 | Ga0068861_100770564 | Ga0068861_1007705641 | 131 |
| 259 | 3300005840 | Ga0068870_10325987 | Ga0068870_103259872 | 131 |
| 260 | 3300006237 | Ga0097621_100304675 | Ga0097621_1003046752 | 131 |
| 261 | 3300009098 | Ga0105245_10244486 | Ga0105245_102444862 | 131 |
| 262 | 3300009176 | Ga0105242_10471059 | Ga0105242_104710593 | 131 |
| 263 | 3300009177 | Ga0105248_10485036 | Ga0105248_104850363 | 131 |
| 264 | 3300013297 | Ga0157378_10721458 | Ga0157378_107214582 | 131 |
| 265 | 3300013306 | Ga0163162_10036589 | Ga0163162_100365894 | 131 |
| 266 | 3300013308 | Ga0157375_10128613 | Ga0157375_101286134 | 131 |
| 267 | 3300014325 | Ga0163163_12768264 | Ga0163163_127682642 | 131 |
| 268 | 3300014968 | Ga0157379_10740318 | Ga0157379_107403182 | 131 |
| 269 | 3300014969 | Ga0157376_10867821 | Ga0157376_108678212 | 131 |
| 270 | 3300017792 | Ga0163161_10013856 | Ga0163161_100138564 | 131 |
| 271 | 3300025315 | Ga0207697_10170652 | Ga0207697_101706521 | 131 |
| 272 | 3300025893 | Ga0207682_10000804 | Ga0207682_100008043 | 131 |
| 273 | 3300025907 | Ga0207645_10050584 | Ga0207645_100505843 | 131 |
| 274 | 3300025908 | Ga0207643_10354228 | Ga0207643_103542282 | 131 |
| 275 | 3300025923 | Ga0207681_10301653 | Ga0207681_103016533 | 131 |
| 276 | 3300025925 | Ga0207650_10120337 | Ga0207650_101203372 | 131 |
| 277 | 3300025926 | Ga0207659_10020753 | Ga0207659_100207534 | 131 |
| 278 | 3300025927 | Ga0207687_10350261 | Ga0207687_103502613 | 131 |
| 279 | 3300025931 | Ga0207644_10331746 | Ga0207644_103317461 | 131 |
| 280 | 3300025933 | Ga0207706_10848419 | Ga0207706_108484192 | 131 |
| 281 | 3300025934 | Ga0207686_10333671 | Ga0207686_103336713 | 131 |
| 282 | 3300025937 | Ga0207669_10137467 | Ga0207669_101374671 | 131 |
| 283 | 3300025940 | Ga0207691_10083474 | Ga0207691_100834742 | 131 |
| 284 | 3300025941 | Ga0207711_10955469 | Ga0207711_109554692 | 131 |
| 285 | 3300025960 | Ga0207651_10260674 | Ga0207651_102606742 | 131 |
| 286 | 3300025986 | Ga0207658_10138061 | Ga0207658_101380612 | 131 |
| 287 | 3300026067 | Ga0207678_10084616 | Ga0207678_100846163 | 131 |
| 288 | 3300026089 | Ga0207648_10318910 | Ga0207648_103189102 | 131 |
| 289 | 3300026121 | Ga0207683_10010175 | Ga0207683_100101756 | 131 |
| 290 | 3300028379 | Ga0268266_10319031 | Ga0268266_103190312 | 131 |
| 291 | 3300031824 | Ga0307413_10201227 | Ga0307413_102012273 | 131 |
| 292 | 3300031995 | Ga0307409_100219814 | Ga0307409_1002198142 | 131 |
| 293 | 3300032002 | Ga0307416_100172782 | Ga0307416_1001727823 | 131 |
| 294 | 3300035695 | Ga0373927_0102494 | Ga0373927_0102494_722_1120 | 131 |
| 295 | 3300035724 | Ga0373933_1082063 | Ga0373933_1082063_48_446 | 131 |
| 296 | 3300035725 | Ga0373947_0197561 | Ga0373947_0197561_707_1105 | 131 |
| 297 | 3300041997 | Ga0439431_0004716 | Ga0439431_0004716_854_1252 | 131 |
| 298 | 3300042134 | Ga0450898_007681 | Ga0450898_007681_952_1350 | 131 |
| 299 | 3300048915 | Ga0496112_1381946 | Ga0496112_1381946_82_480 | 131 |
| 300 | 3300048916 | Ga0496113_0591554 | Ga0496113_0591554_375_773 | 131 |
| 301 | 3300005333 | Ga0070677_10357643 | Ga0070677_103576432 | 132 |
| 302 | 3300005456 | Ga0070678_100187252 | Ga0070678_1001872522 | 132 |
| 303 | 3300009177 | Ga0105248_11688165 | Ga0105248_116881652 | 132 |
| 304 | 3300010375 | Ga0105239_10531956 | Ga0105239_105319562 | 132 |
| 305 | 3300013296 | Ga0157374_11180734 | Ga0157374_111807342 | 132 |
| 306 | 3300025893 | Ga0207682_10569760 | Ga0207682_105697602 | 132 |
| 307 | 3300025941 | Ga0207711_10840100 | Ga0207711_108401002 | 132 |
| 308 | 3300026121 | Ga0207683_10261790 | Ga0207683_102617902 | 132 |
| 309 | 3300028563 | Ga0265319_1015317 | Ga0265319_10153172 | 132 |
| 310 | 3300028573 | Ga0265334_10129071 | Ga0265334_101290712 | 132 |
| 311 | 3300028577 | Ga0265318_10000771 | Ga0265318_100007719 | 132 |
| 312 | 3300028800 | Ga0265338_10186467 | Ga0265338_101864672 | 132 |
| 313 | 3300028800 | Ga0265338_10405982 | Ga0265338_104059822 | 132 |
| 314 | 3300029957 | Ga0265324_10090151 | Ga0265324_100901512 | 132 |
| 315 | 3300031235 | Ga0265330_10000896 | Ga0265330_1000089616 | 132 |
| 316 | 3300031238 | Ga0265332_10049022 | Ga0265332_100490222 | 132 |
| 317 | 3300031238 | Ga0265332_10049480 | Ga0265332_100494802 | 132 |
| 318 | 3300031239 | Ga0265328_10006698 | Ga0265328_100066982 | 132 |
| 319 | 3300031240 | Ga0265320_10001966 | Ga0265320_100019663 | 132 |
| 320 | 3300031242 | Ga0265329_10006674 | Ga0265329_100066742 | 132 |
| 321 | 3300031249 | Ga0265339_10021208 | Ga0265339_100212083 | 132 |
| 322 | 3300031250 | Ga0265331_10000655 | Ga0265331_1000065516 | 132 |
| 323 | 3300031344 | Ga0265316_10030113 | Ga0265316_100301136 | 132 |
| 324 | 3300031595 | Ga0265313_10030767 | Ga0265313_100307673 | 132 |
| 325 | 3300031711 | Ga0265314_10011405 | Ga0265314_100114053 | 132 |
| 326 | 3300031712 | Ga0265342_10000610 | Ga0265342_1000061020 | 132 |
| 327 | 3300046455 | Ga0495603_0243199 | Ga0495603_0243199_239_640 | 132 |
| 328 | 3300002773 | JGI25152J39213_1000033 | JGI25152J39213_100003345 | 133 |
| 329 | 3300002774 | JGI25150J39212_1000151 | JGI25150J39212_100015113 | 133 |
| 330 | 3300003187 | JGI25151J46595_10000142 | JGI25151J46595_1000014238 | 133 |
| 331 | 3300003187 | JGI25151J46595_10002153 | JGI25151J46595_100021537 | 133 |
| 332 | 3300003215 | JGI25153J46596_10000107 | JGI25153J46596_1000010745 | 133 |
| 333 | 3300003759 | Ga0055525_1000084 | Ga0055525_1000084104 | 133 |
| 334 | 3300003773 | Ga0055537_1007383 | Ga0055537_10073833 | 133 |
| 335 | 3300003775 | Ga0055524_1000013 | Ga0055524_100001392 | 133 |
| 336 | 3300003775 | Ga0055524_1001046 | Ga0055524_10010467 | 133 |
| 337 | 3300003784 | Ga0055534_1003936 | Ga0055534_10039364 | 133 |
| 338 | 3300003792 | Ga0055540_1024256 | Ga0055540_10242563 | 133 |
| 339 | 3300005262 | Ga0065165_1087303 | Ga0065165_10873032 | 133 |
| 340 | 3300005290 | Ga0065712_10366399 | Ga0065712_103663992 | 133 |
| 341 | 3300005293 | Ga0065715_10143022 | Ga0065715_101430222 | 133 |
| 342 | 3300005328 | Ga0070676_10010887 | Ga0070676_100108876 | 133 |
| 343 | 3300005329 | Ga0070683_100079138 | Ga0070683_1000791383 | 133 |
| 344 | 3300005330 | Ga0070690_100698536 | Ga0070690_1006985361 | 133 |
| 345 | 3300005331 | Ga0070670_100008583 | Ga0070670_1000085837 | 133 |
| 346 | 3300005331 | Ga0070670_100266907 | Ga0070670_1002669073 | 133 |
| 347 | 3300005333 | Ga0070677_10000532 | Ga0070677_1000053210 | 133 |
| 348 | 3300005333 | Ga0070677_10152565 | Ga0070677_101525652 | 133 |
| 349 | 3300005334 | Ga0068869_101439813 | Ga0068869_1014398131 | 133 |
| 350 | 3300005336 | Ga0070680_100058141 | Ga0070680_1000581413 | 133 |
| 351 | 3300005338 | Ga0068868_100201879 | Ga0068868_1002018792 | 133 |
| 352 | 3300005338 | Ga0068868_100946615 | Ga0068868_1009466151 | 133 |
| 353 | 3300005344 | Ga0070661_100172890 | Ga0070661_1001728902 | 133 |
| 354 | 3300005347 | Ga0070668_101241076 | Ga0070668_1012410762 | 133 |
| 355 | 3300005354 | Ga0070675_100001226 | Ga0070675_10000122615 | 133 |
| 356 | 3300005354 | Ga0070675_100031610 | Ga0070675_1000316104 | 133 |
| 357 | 3300005355 | Ga0070671_100002269 | Ga0070671_10000226913 | 133 |
| 358 | 3300005355 | Ga0070671_100127606 | Ga0070671_1001276062 | 133 |
| 359 | 3300005356 | Ga0070674_100134245 | Ga0070674_1001342451 | 133 |
| 360 | 3300005356 | Ga0070674_100429736 | Ga0070674_1004297361 | 133 |
| 361 | 3300005364 | Ga0070673_100162273 | Ga0070673_1001622732 | 133 |
| 362 | 3300005364 | Ga0070673_102025097 | Ga0070673_1020250972 | 133 |
| 363 | 3300005366 | Ga0070659_100889075 | Ga0070659_1008890752 | 133 |
| 364 | 3300005367 | Ga0070667_100372616 | Ga0070667_1003726162 | 133 |
| 365 | 3300005456 | Ga0070678_100043701 | Ga0070678_1000437015 | 133 |
| 366 | 3300005456 | Ga0070678_101038855 | Ga0070678_1010388552 | 133 |
| 367 | 3300005457 | Ga0070662_100008313 | Ga0070662_1000083133 | 133 |
| 368 | 3300005459 | Ga0068867_100003616 | Ga0068867_1000036166 | 133 |
| 369 | 3300005459 | Ga0068867_100345285 | Ga0068867_1003452852 | 133 |
| 370 | 3300005459 | Ga0068867_100395171 | Ga0068867_1003951713 | 133 |
| 371 | 3300005459 | Ga0068867_100576886 | Ga0068867_1005768862 | 133 |
| 372 | 3300005530 | Ga0070679_100005760 | Ga0070679_1000057605 | 133 |
| 373 | 3300005530 | Ga0070679_100355445 | Ga0070679_1003554452 | 133 |
| 374 | 3300005535 | Ga0070684_100438173 | Ga0070684_1004381732 | 133 |
| 375 | 3300005539 | Ga0068853_100280971 | Ga0068853_1002809712 | 133 |
| 376 | 3300005543 | Ga0070672_100011710 | Ga0070672_1000117104 | 133 |
| 377 | 3300005543 | Ga0070672_100050606 | Ga0070672_1000506062 | 133 |
| 378 | 3300005543 | Ga0070672_100082872 | Ga0070672_1000828724 | 133 |
| 379 | 3300005543 | Ga0070672_101026913 | Ga0070672_1010269131 | 133 |
| 380 | 3300005548 | Ga0070665_100207935 | Ga0070665_1002079352 | 133 |
| 381 | 3300005564 | Ga0070664_100060524 | Ga0070664_1000605243 | 133 |
| 382 | 3300005577 | Ga0068857_100695723 | Ga0068857_1006957232 | 133 |
| 383 | 3300005616 | Ga0068852_101236234 | Ga0068852_1012362342 | 133 |
| 384 | 3300005618 | Ga0068864_100008984 | Ga0068864_1000089845 | 133 |
| 385 | 3300005718 | Ga0068866_10193245 | Ga0068866_101932453 | 133 |
| 386 | 3300005834 | Ga0068851_10021181 | Ga0068851_100211815 | 133 |
| 387 | 3300005840 | Ga0068870_10170319 | Ga0068870_101703193 | 133 |
| 388 | 3300005840 | Ga0068870_10216397 | Ga0068870_102163972 | 133 |
| 389 | 3300005841 | Ga0068863_100834438 | Ga0068863_1008344382 | 133 |
| 390 | 3300006048 | Ga0075363_100318861 | Ga0075363_1003188612 | 133 |
| 391 | 3300006175 | Ga0070712_100335500 | Ga0070712_1003355003 | 133 |
| 392 | 3300006237 | Ga0097621_100009546 | Ga0097621_1000095463 | 133 |
| 393 | 3300006353 | Ga0075370_10449697 | Ga0075370_104496972 | 133 |
| 394 | 3300006358 | Ga0068871_100013746 | Ga0068871_1000137463 | 133 |
| 395 | 3300006847 | Ga0075431_100648042 | Ga0075431_1006480423 | 133 |
| 396 | 3300006881 | Ga0068865_100370346 | Ga0068865_1003703462 | 133 |
| 397 | 3300009093 | Ga0105240_10079655 | Ga0105240_100796553 | 133 |
| 398 | 3300009098 | Ga0105245_10035169 | Ga0105245_100351694 | 133 |
| 399 | 3300009098 | Ga0105245_10584753 | Ga0105245_105847532 | 133 |
| 400 | 3300009148 | Ga0105243_10179153 | Ga0105243_101791532 | 133 |
| 401 | 3300009545 | Ga0105237_11692355 | Ga0105237_116923551 | 133 |
| 402 | 3300009551 | Ga0105238_10000084 | Ga0105238_1000008418 | 133 |
| 403 | 3300009551 | Ga0105238_10410976 | Ga0105238_104109762 | 133 |
| 404 | 3300009551 | Ga0105238_10584158 | Ga0105238_105841583 | 133 |
| 405 | 3300013102 | Ga0157371_10280702 | Ga0157371_102807022 | 133 |
| 406 | 3300013104 | Ga0157370_10427707 | Ga0157370_104277073 | 133 |
| 407 | 3300013104 | Ga0157370_10431207 | Ga0157370_104312072 | 133 |
| 408 | 3300013105 | Ga0157369_10672406 | Ga0157369_106724061 | 133 |
| 409 | 3300013306 | Ga0163162_10805219 | Ga0163162_108052192 | 133 |
| 410 | 3300013307 | Ga0157372_10208049 | Ga0157372_102080493 | 133 |
| 411 | 3300013307 | Ga0157372_10239292 | Ga0157372_102392923 | 133 |
| 412 | 3300014969 | Ga0157376_11365261 | Ga0157376_113652612 | 133 |
| 413 | 3300015265 | Ga0182005_1009891 | Ga0182005_10098912 | 133 |
| 414 | 3300017792 | Ga0163161_10262606 | Ga0163161_102626062 | 133 |
| 415 | 3300020078 | Ga0206352_11326968 | Ga0206352_113269682 | 133 |
| 416 | 3300022467 | Ga0224712_10139864 | Ga0224712_101398643 | 133 |
| 417 | 3300025230 | Ga0209563_100025 | Ga0209563_100025106 | 133 |
| 418 | 3300025253 | Ga0209677_101039 | Ga0209677_1010398 | 133 |
| 419 | 3300025258 | Ga0209129_1000431 | Ga0209129_10004317 | 133 |
| 420 | 3300025263 | Ga0209565_1000066 | Ga0209565_1000066165 | 133 |
| 421 | 3300025273 | Ga0209673_1061709 | Ga0209673_10617093 | 133 |
| 422 | 3300025291 | Ga0209675_1000437 | Ga0209675_100043712 | 133 |
| 423 | 3300025292 | Ga0209676_1000075 | Ga0209676_100007565 | 133 |
| 424 | 3300025294 | Ga0209025_1001993 | Ga0209025_100199315 | 133 |
| 425 | 3300025295 | Ga0209564_1001906 | Ga0209564_10019064 | 133 |
| 426 | 3300025297 | Ga0209758_1007663 | Ga0209758_10076635 | 133 |
| 427 | 3300025297 | Ga0209758_1033199 | Ga0209758_10331993 | 133 |
| 428 | 3300025299 | Ga0209256_1002355 | Ga0209256_100235511 | 133 |
| 429 | 3300025299 | Ga0209256_1008618 | Ga0209256_10086183 | 133 |
| 430 | 3300025303 | Ga0209051_1006037 | Ga0209051_10060374 | 133 |
| 431 | 3300025303 | Ga0209051_1043373 | Ga0209051_10433732 | 133 |
| 432 | 3300025321 | Ga0207656_10295045 | Ga0207656_102950452 | 133 |
| 433 | 3300025893 | Ga0207682_10003073 | Ga0207682_100030738 | 133 |
| 434 | 3300025893 | Ga0207682_10123745 | Ga0207682_101237452 | 133 |
| 435 | 3300025893 | Ga0207682_10358892 | Ga0207682_103588921 | 133 |
| 436 | 3300025899 | Ga0207642_10167184 | Ga0207642_101671842 | 133 |
| 437 | 3300025903 | Ga0207680_10046055 | Ga0207680_100460552 | 133 |
| 438 | 3300025907 | Ga0207645_10055582 | Ga0207645_100555823 | 133 |
| 439 | 3300025907 | Ga0207645_10079980 | Ga0207645_100799802 | 133 |
| 440 | 3300025907 | Ga0207645_10087025 | Ga0207645_100870252 | 133 |
| 441 | 3300025908 | Ga0207643_10054285 | Ga0207643_100542853 | 133 |
| 442 | 3300025908 | Ga0207643_10166455 | Ga0207643_101664552 | 133 |
| 443 | 3300025909 | Ga0207705_10340361 | Ga0207705_103403612 | 133 |
| 444 | 3300025913 | Ga0207695_10204674 | Ga0207695_102046742 | 133 |
| 445 | 3300025915 | Ga0207693_10241086 | Ga0207693_102410862 | 133 |
| 446 | 3300025917 | Ga0207660_10028681 | Ga0207660_100286813 | 133 |
| 447 | 3300025920 | Ga0207649_10056951 | Ga0207649_100569513 | 133 |
| 448 | 3300025921 | Ga0207652_10011926 | Ga0207652_100119262 | 133 |
| 449 | 3300025921 | Ga0207652_11221874 | Ga0207652_112218742 | 133 |
| 450 | 3300025923 | Ga0207681_10023843 | Ga0207681_100238433 | 133 |
| 451 | 3300025924 | Ga0207694_10004778 | Ga0207694_1000477810 | 133 |
| 452 | 3300025924 | Ga0207694_10105564 | Ga0207694_101055642 | 133 |
| 453 | 3300025925 | Ga0207650_10000667 | Ga0207650_1000066723 | 133 |
| 454 | 3300025925 | Ga0207650_10401715 | Ga0207650_104017151 | 133 |
| 455 | 3300025925 | Ga0207650_10450859 | Ga0207650_104508592 | 133 |
| 456 | 3300025925 | Ga0207650_11248664 | Ga0207650_112486642 | 133 |
| 457 | 3300025926 | Ga0207659_10002105 | Ga0207659_100021054 | 133 |
| 458 | 3300025926 | Ga0207659_10214112 | Ga0207659_102141122 | 133 |
| 459 | 3300025926 | Ga0207659_10776007 | Ga0207659_107760072 | 133 |
| 460 | 3300025927 | Ga0207687_10073458 | Ga0207687_100734583 | 133 |
| 461 | 3300025931 | Ga0207644_10009455 | Ga0207644_100094556 | 133 |
| 462 | 3300025931 | Ga0207644_10498352 | Ga0207644_104983522 | 133 |
| 463 | 3300025931 | Ga0207644_10886171 | Ga0207644_108861712 | 133 |
| 464 | 3300025932 | Ga0207690_10699367 | Ga0207690_106993672 | 133 |
| 465 | 3300025933 | Ga0207706_10008467 | Ga0207706_100084675 | 133 |
| 466 | 3300025934 | Ga0207686_10669563 | Ga0207686_106695631 | 133 |
| 467 | 3300025936 | Ga0207670_10383055 | Ga0207670_103830552 | 133 |
| 468 | 3300025937 | Ga0207669_10001145 | Ga0207669_100011457 | 133 |
| 469 | 3300025937 | Ga0207669_10060730 | Ga0207669_100607303 | 133 |
| 470 | 3300025937 | Ga0207669_10150745 | Ga0207669_101507453 | 133 |
| 471 | 3300025937 | Ga0207669_10438272 | Ga0207669_104382722 | 133 |
| 472 | 3300025938 | Ga0207704_10305653 | Ga0207704_103056532 | 133 |
| 473 | 3300025940 | Ga0207691_10007338 | Ga0207691_100073386 | 133 |
| 474 | 3300025940 | Ga0207691_10030858 | Ga0207691_100308583 | 133 |
| 475 | 3300025940 | Ga0207691_10068826 | Ga0207691_100688264 | 133 |
| 476 | 3300025942 | Ga0207689_10581584 | Ga0207689_105815842 | 133 |
| 477 | 3300025944 | Ga0207661_10157076 | Ga0207661_101570762 | 133 |
| 478 | 3300025944 | Ga0207661_10172749 | Ga0207661_101727493 | 133 |
| 479 | 3300025945 | Ga0207679_10009792 | Ga0207679_100097924 | 133 |
| 480 | 3300025960 | Ga0207651_10015951 | Ga0207651_100159512 | 133 |
| 481 | 3300025972 | Ga0207668_10047610 | Ga0207668_100476104 | 133 |
| 482 | 3300025986 | Ga0207658_10116867 | Ga0207658_101168672 | 133 |
| 483 | 3300026023 | Ga0207677_10131730 | Ga0207677_101317303 | 133 |
| 484 | 3300026041 | Ga0207639_10411781 | Ga0207639_104117812 | 133 |
| 485 | 3300026088 | Ga0207641_10202290 | Ga0207641_102022903 | 133 |
| 486 | 3300026088 | Ga0207641_10303541 | Ga0207641_103035413 | 133 |
| 487 | 3300026089 | Ga0207648_10008667 | Ga0207648_100086676 | 133 |
| 488 | 3300026089 | Ga0207648_10056617 | Ga0207648_100566175 | 133 |
| 489 | 3300026089 | Ga0207648_10371640 | Ga0207648_103716403 | 133 |
| 490 | 3300026089 | Ga0207648_10918843 | Ga0207648_109188432 | 133 |
| 491 | 3300026095 | Ga0207676_10193504 | Ga0207676_101935042 | 133 |
| 492 | 3300026118 | Ga0207675_101797481 | Ga0207675_1017974811 | 133 |
| 493 | 3300026121 | Ga0207683_10002948 | Ga0207683_100029485 | 133 |
| 494 | 3300026121 | Ga0207683_10649439 | Ga0207683_106494392 | 133 |
| 495 | 3300028379 | Ga0268266_10624627 | Ga0268266_106246272 | 133 |
| 496 | 3300028794 | Ga0307515_10088177 | Ga0307515_100881774 | 133 |
| 497 | 3300031456 | Ga0307513_10246388 | Ga0307513_102463882 | 133 |
| 498 | 3300031548 | Ga0307408_100058064 | Ga0307408_1000580642 | 133 |
| 499 | 3300031731 | Ga0307405_10001995 | Ga0307405_100019958 | 133 |
| 500 | 3300031824 | Ga0307413_10229690 | Ga0307413_102296903 | 133 |
| 501 | 3300031852 | Ga0307410_10001182 | Ga0307410_100011825 | 133 |
| 502 | 3300031852 | Ga0307410_10526776 | Ga0307410_105267761 | 133 |
| 503 | 3300031901 | Ga0307406_10031956 | Ga0307406_100319563 | 133 |
| 504 | 3300031901 | Ga0307406_10149828 | Ga0307406_101498282 | 133 |
| 505 | 3300031903 | Ga0307407_10072632 | Ga0307407_100726323 | 133 |
| 506 | 3300031903 | Ga0307407_11199021 | Ga0307407_111990212 | 133 |
| 507 | 3300031911 | Ga0307412_10001505 | Ga0307412_1000150516 | 133 |
| 508 | 3300031911 | Ga0307412_10168641 | Ga0307412_101686412 | 133 |
| 509 | 3300031995 | Ga0307409_100581240 | Ga0307409_1005812402 | 133 |
| 510 | 3300032002 | Ga0307416_101189009 | Ga0307416_1011890092 | 133 |
| 511 | 3300032004 | Ga0307414_10043527 | Ga0307414_100435274 | 133 |
| 512 | 3300032004 | Ga0307414_10051032 | Ga0307414_100510322 | 133 |
| 513 | 3300032005 | Ga0307411_10000810 | Ga0307411_1000081013 | 133 |
| 514 | 3300032005 | Ga0307411_11301255 | Ga0307411_113012552 | 133 |
| 515 | 3300032126 | Ga0307415_100337235 | Ga0307415_1003372351 | 133 |
| 516 | 3300035691 | Ga0373931_0001775 | Ga0373931_0001775_7819_8241 | 133 |
| 517 | 3300035695 | Ga0373927_0208775 | Ga0373927_0208775_256_660 | 133 |
| 518 | 3300035695 | Ga0373927_1118932 | Ga0373927_1118932_81_485 | 133 |
| 519 | 3300035725 | Ga0373947_0384291 | Ga0373947_0384291_386_790 | 133 |
| 520 | 3300036401 | Ga0373937_0611785 | Ga0373937_0611785_116_520 | 133 |
| 521 | 3300037068 | Ga0373925_1557136 | Ga0373925_1557136_83_487 | 133 |
| 522 | 3300037471 | Ga0395905_0010184 | Ga0395905_0010184_5280_5693 | 133 |
| 523 | 3300039145 | Ga0237816_00299 | Ga0237816_00299_2861_3262 | 133 |
| 524 | 3300045976 | Ga0466967_0220668 | Ga0466967_0220668_385_807 | 133 |
| 525 | 3300045976 | Ga0466967_1928123 | Ga0466967_1928123_71_475 | 133 |
| 526 | 3300046454 | Ga0495592_0408035 | Ga0495592_0408035_366_770 | 133 |
| 527 | 3300046473 | Ga0495582_0236137 | Ga0495582_0236137_385_789 | 133 |
| 528 | 3300046475 | Ga0495639_0008923 | Ga0495639_0008923_2700_3104 | 133 |
| 529 | 3300046511 | Ga0495608_0210859 | Ga0495608_0210859_185_589 | 133 |
| 530 | 3300046514 | Ga0495618_0212915 | Ga0495618_0212915_243_647 | 133 |
| 531 | 3300046516 | Ga0495628_0364370 | Ga0495628_0364370_526_930 | 133 |
| 532 | 3300046517 | Ga0495630_0007539 | Ga0495630_0007539_6143_6547 | 133 |
| 533 | 3300046684 | Ga0495669_0082723 | Ga0495669_0082723_565_969 | 133 |
| 534 | 3300046690 | Ga0495624_0011941 | Ga0495624_0011941_2350_2754 | 133 |
| 535 | 3300046809 | Ga0495600_0490669 | Ga0495600_0490669_149_553 | 133 |
| 536 | 3300047315 | Ga0495581_0276198 | Ga0495581_0276198_59_463 | 133 |
| 537 | 3300047319 | Ga0495674_0007171 | Ga0495674_0007171_6103_6507 | 133 |
| 538 | 3300047321 | Ga0495676_0128395 | Ga0495676_0128395_1013_1417 | 133 |
| 539 | 3300047444 | Ga0495675_0360533 | Ga0495675_0360533_220_624 | 133 |
| 540 | 3300047471 | Ga0495684_0010912 | Ga0495684_0010912_3380_3784 | 133 |
| 541 | 3300047472 | Ga0495686_0007669 | Ga0495686_0007669_4248_4649 | 133 |
| 542 | 3300048089 | Ga0495614_0162884 | Ga0495614_0162884_377_781 | 133 |
| 543 | 3300048912 | Ga0496109_0045374 | Ga0496109_0045374_1168_1572 | 133 |
| 544 | 3300048913 | Ga0496110_0767264 | Ga0496110_0767264_415_819 | 133 |
| 545 | 3300048917 | Ga0496114_0018036 | Ga0496114_0018036_4431_4838 | 133 |
| 546 | 3300048917 | Ga0496114_0445622 | Ga0496114_0445622_342_746 | 133 |
| 547 | 3300048919 | Ga0496116_0240756 | Ga0496116_0240756_122_526 | 133 |
| 548 | 3300048925 | Ga0496122_0535104 | Ga0496122_0535104_93_509 | 133 |
| 549 | 3300048925 | Ga0496122_0561581 | Ga0496122_0561581_20_436 | 133 |
| 550 | 3300048927 | Ga0496124_0188890 | Ga0496124_0188890_697_1101 | 133 |
| 551 | 3300048929 | Ga0496126_0432824 | Ga0496126_0432824_583_987 | 133 |
| 552 | 3300049569 | Ga0501032_0012290 | Ga0501032_0012290_1367_1783 | 133 |
| 553 | 3300049569 | Ga0501032_0193594 | Ga0501032_0193594_504_929 | 133 |
| 554 | 3300049570 | Ga0501033_0014081 | Ga0501033_0014081_5110_5526 | 133 |
| 555 | 3300049570 | Ga0501033_0180902 | Ga0501033_0180902_305_730 | 133 |
| 556 | 3300049571 | Ga0501034_0141473 | Ga0501034_0141473_1902_2318 | 133 |
| 557 | 3300049572 | Ga0501036_0005157 | Ga0501036_0005157_5036_5452 | 133 |
| 558 | 3300049572 | Ga0501036_1066489 | Ga0501036_1066489_183_590 | 133 |
| 559 | 3300049573 | Ga0501037_0004374 | Ga0501037_0004374_9777_10193 | 133 |
| 560 | 3300049573 | Ga0501037_0227791 | Ga0501037_0227791_22_447 | 133 |
| 561 | 3300049574 | Ga0501038_0003804 | Ga0501038_0003804_5283_5699 | 133 |
| 562 | 3300049575 | Ga0501039_0010961 | Ga0501039_0010961_5259_5675 | 133 |
| 563 | 3300049579 | Ga0501043_0000112 | Ga0501043_0000112_53936_54343 | 133 |
| 564 | 3300049579 | Ga0501043_0027147 | Ga0501043_0027147_477_902 | 133 |
| 565 | 3300049579 | Ga0501043_0106119 | Ga0501043_0106119_1682_2098 | 133 |
| 566 | 3300049580 | Ga0501046_0000146 | Ga0501046_0000146_53940_54347 | 133 |
| 567 | 3300049581 | Ga0501047_0000192 | Ga0501047_0000192_19958_20365 | 133 |
| 568 | 3300049581 | Ga0501047_0027750 | Ga0501047_0027750_936_1352 | 133 |
| 569 | 3300049581 | Ga0501047_0415312 | Ga0501047_0415312_539_964 | 133 |
| 570 | 3300049582 | Ga0501048_0000874 | Ga0501048_0000874_8579_8986 | 133 |
| 571 | 3300049584 | Ga0501068_0106082 | Ga0501068_0106082_65_481 | 133 |
| 572 | 3300049586 | Ga0501070_0008181 | Ga0501070_0008181_2604_3020 | 133 |
| 573 | 3300049586 | Ga0501070_0152842 | Ga0501070_0152842_297_722 | 133 |
| 574 | 3300049588 | Ga0501072_0188346 | Ga0501072_0188346_73_489 | 133 |
| 575 | 3300049744 | Ga0501083_0172188 | Ga0501083_0172188_878_1285 | 133 |
| 576 | 3300049822 | Ga0501035_0007745 | Ga0501035_0007745_9109_9534 | 133 |
| 577 | 3300049822 | Ga0501035_0457163 | Ga0501035_0457163_605_1021 | 133 |
| 578 | 3300049823 | Ga0501044_0007912 | Ga0501044_0007912_9276_9701 | 133 |
| 579 | 3300049823 | Ga0501044_0045370 | Ga0501044_0045370_35_451 | 133 |
| 580 | 3300049823 | Ga0501044_0541438 | Ga0501044_0541438_242_649 | 133 |
| 581 | 3300049824 | Ga0501045_0002450 | Ga0501045_0002450_3310_3717 | 133 |
| 582 | 3300049824 | Ga0501045_0455153 | Ga0501045_0455153_303_719 | 133 |
| 583 | 3300049824 | Ga0501045_1439790 | Ga0501045_1439790_32_439 | 133 |
| 584 | 3300050508 | nmdc:mga09592_688939_c1 | nmdc:mga09592_688939_c1_297_701 | 133 |
| 585 | 3300050510 | nmdc:mga06r32_606831_c1 | nmdc:mga06r32_606831_c1_633_1037 | 133 |
| 586 | 3300050511 | nmdc:mga08y16_620258_c1 | nmdc:mga08y16_620258_c1_109_513 | 133 |
| 587 | 3300053088 | Ga0500644_0004351 | Ga0500644_0004351_480_884 | 133 |
| 588 | 3300053108 | Ga0500562_004562 | Ga0500562_004562_317_721 | 133 |
| 589 | 3300053122 | Ga0500608_174549 | Ga0500608_174549_480_884 | 133 |
| 590 | 3300053139 | Ga0500568_0193812 | Ga0500568_0193812_35_439 | 133 |
| 591 | 3300053730 | Ga0500645_003129 | Ga0500645_003129_3305_3709 | 133 |
| 592 | 3300055283 | Ga0500661_002466 | Ga0500661_002466_607_1011 | 133 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3j9x-assembly1.cif.gz_A | a virus that infects a hyperthermophile encapsidates a-form dna | 0.8404 | 14 | 51 |
| 5n9g-assembly2.cif.gz_F | tfiiib -tbp/brf2/dna and sant domain of bdp1- | 0.8404 | 16 | 53 |
| 1thn-assembly1.cif.gz_A | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i | 0.8219 | 1 | 127 |
| 5w7g-assembly1.cif.gz_A | an envelope of a filamentous hyperthermophilic virus carries lipids in a horseshoe conformation | 0.8168 | 16 | 51 |
| 1thn-assembly1.cif.gz_A | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form i | 0.8048 | 1 | 127 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4babB03 | Mainly Alpha;Orthogonal Bundle;Enzyme I; Chain A, domain 2;Phenylalanine ammonia-lyase 1; domain 3 | 0.9393 | 16 | 44 | 1.10.274.20 |
| 4rodA01 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.88 | 16 | 49 | 1.10.472.10 |
| af_Q8QZR8_12_138_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.8698 | 14 | 47 | 1.10.472.10 |
| 3j9x101 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8492 | 16 | 51 | 1.20.58.800 |
| af_Q4V8D6_60_167_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.8407 | 16 | 53 | 1.10.472.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N1XKJ3-F1-model_v4 | deleted | 0.9786 | 4 | 111 |
|
| AF-A4VGB2-F1-model_v4 | Histidine kinase/HSP90-like ATPase domain-containing protein | 0.9705 | 4 | 129 |
|
| AF-A0A4Q3PC47-F1-model_v4 | deleted | 0.9697 | 4 | 86 |
|
| AF-A0A7K3G6T1-F1-model_v4 | Anti-sigma regulatory factor | 0.9693 | 5 | 128 |
|
| AF-A0A6J4NXT3-F1-model_v4 | Anti-sigma B factor RsbT | 0.9686 | 2 | 96 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar