F467158
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 592 | 273 | 592 | 96 |
Family's Representative Sequence
| Representative Sequence | 3300045049|Ga0466959_0004905|Ga0466959_0004905_2714_3007 |
| Length | 91 |
| Sequence | MPAYIIVETDITDPEQYERYKAASPGAIAAAGGRFLAVLEGDWHPSRLVVLEFEDLDAAKRFYESEEYAAARKLREGAARLSMVAVAGVEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 74 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 77 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 82 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 119 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 120 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 121 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 122 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 123 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 124 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 125 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 132 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 133 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 134 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 136 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 138 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 139 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 140 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 143 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 145 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 146 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 147 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 148 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 149 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 150 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 151 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 152 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 153 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 154 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 156 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 157 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 158 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 159 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 160 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 161 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 162 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 168 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 169 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 170 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 171 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 172 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 173 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 174 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 175 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 176 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 177 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 178 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 179 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 180 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 181 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 182 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 183 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 184 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 185 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 186 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 187 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 188 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 226 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 270 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 273 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.17 |
| Nodule | 0 |
| Rhizoplane | 4.39 |
| Rhizosphere | 94.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10046131 | 3300003203 | Bacteria | 1495 |
| 2 | rootH2_10070391 | 3300003320 | Bacteria | 1535 |
| 3 | JGI25407J50210_10022749 | 3300003373 | Bacteria | 1629 |
| 4 | Ga0070658_10009450 | 3300005327 | Bacteria | 7839 |
| 5 | Ga0070658_10192754 | 3300005327 | Bacteria | 1718 |
| 6 | Ga0070658_10212063 | 3300005327 | Bacteria | 1636 |
| 7 | Ga0070658_10280594 | 3300005327 | Bacteria | 1418 |
| 8 | Ga0070658_10423686 | 3300005327 | Bacteria | 1145 |
| 9 | Ga0070658_10448519 | 3300005327 | Bacteria | 1111 |
| 10 | Ga0070658_10572659 | 3300005327 | Bacteria | 978 |
| 11 | Ga0070680_100217097 | 3300005336 | Bacteria | 1614 |
| 12 | Ga0070680_100552767 | 3300005336 | Bacteria | 987 |
| 13 | Ga0070680_101394368 | 3300005336 | Unclassified | 607 |
| 14 | Ga0070682_100130681 | 3300005337 | Bacteria | 1699 |
| 15 | Ga0070682_100605611 | 3300005337 | Bacteria | 866 |
| 16 | Ga0070682_100726919 | 3300005337 | Bacteria | 799 |
| 17 | Ga0070660_100006295 | 3300005339 | Bacteria | 8222 |
| 18 | Ga0070660_100185104 | 3300005339 | Bacteria | 1686 |
| 19 | Ga0070660_100522439 | 3300005339 | Bacteria | 989 |
| 20 | Ga0070660_100901114 | 3300005339 | Unclassified | 746 |
| 21 | Ga0070691_10169540 | 3300005341 | Bacteria | 1130 |
| 22 | Ga0070661_100545945 | 3300005344 | Bacteria | 932 |
| 23 | Ga0070668_100425936 | 3300005347 | Bacteria | 1137 |
| 24 | Ga0070671_100202953 | 3300005355 | Bacteria | 1681 |
| 25 | Ga0070671_101590387 | 3300005355 | Bacteria | 579 |
| 26 | Ga0070659_100104588 | 3300005366 | Bacteria | 2281 |
| 27 | Ga0070659_100419140 | 3300005366 | Bacteria | 1132 |
| 28 | Ga0070709_10059036 | 3300005434 | Bacteria | 2435 |
| 29 | Ga0070709_10132303 | 3300005434 | Bacteria | 1704 |
| 30 | Ga0070709_10458383 | 3300005434 | Unclassified | 962 |
| 31 | Ga0070714_100006800 | 3300005435 | Bacteria | 8864 |
| 32 | Ga0070714_100050816 | 3300005435 | Bacteria | 3533 |
| 33 | Ga0070714_100106907 | 3300005435 | Bacteria | 2472 |
| 34 | Ga0070714_100172145 | 3300005435 | Bacteria | 1965 |
| 35 | Ga0070714_100416896 | 3300005435 | Bacteria | 1271 |
| 36 | Ga0070714_100933467 | 3300005435 | Bacteria | 843 |
| 37 | Ga0070713_100029034 | 3300005436 | Bacteria | 4374 |
| 38 | Ga0070713_100054419 | 3300005436 | Bacteria | 3320 |
| 39 | Ga0070713_100114150 | 3300005436 | Bacteria | 2359 |
| 40 | Ga0070713_101909018 | 3300005436 | Unclassified | 576 |
| 41 | Ga0070710_10007726 | 3300005437 | Bacteria | 5214 |
| 42 | Ga0070711_100031534 | 3300005439 | Bacteria | 3519 |
| 43 | Ga0070711_101046150 | 3300005439 | Unclassified | 702 |
| 44 | Ga0070711_101842963 | 3300005439 | Bacteria | 531 |
| 45 | Ga0070705_100834774 | 3300005440 | Bacteria | 736 |
| 46 | Ga0070700_100156540 | 3300005441 | Bacteria | 1564 |
| 47 | Ga0070694_101103257 | 3300005444 | Bacteria | 662 |
| 48 | Ga0070708_101234786 | 3300005445 | Bacteria | 699 |
| 49 | Ga0070708_101807674 | 3300005445 | Bacteria | 567 |
| 50 | Ga0070678_100662154 | 3300005456 | Bacteria | 937 |
| 51 | Ga0070681_10043324 | 3300005458 | Bacteria | 4509 |
| 52 | Ga0070681_10045322 | 3300005458 | Bacteria | 4400 |
| 53 | Ga0070681_10141953 | 3300005458 | Bacteria | 2331 |
| 54 | Ga0070681_10372808 | 3300005458 | Bacteria | 1338 |
| 55 | Ga0070681_10935539 | 3300005458 | Bacteria | 786 |
| 56 | Ga0070707_100846238 | 3300005468 | Unclassified | 879 |
| 57 | Ga0070698_100152739 | 3300005471 | Bacteria | 2255 |
| 58 | Ga0070698_100751000 | 3300005471 | Unclassified | 919 |
| 59 | Ga0070699_100209676 | 3300005518 | Bacteria | 1734 |
| 60 | Ga0070679_100185790 | 3300005530 | Unclassified | 2049 |
| 61 | Ga0070679_100224029 | 3300005530 | Bacteria | 1841 |
| 62 | Ga0070679_100224516 | 3300005530 | Bacteria | 1839 |
| 63 | Ga0070679_100262111 | 3300005530 | Unclassified | 1683 |
| 64 | Ga0070679_100421654 | 3300005530 | Bacteria | 1280 |
| 65 | Ga0070679_100557141 | 3300005530 | Bacteria | 1090 |
| 66 | Ga0070679_101925900 | 3300005530 | Bacteria | 540 |
| 67 | Ga0070684_100213157 | 3300005535 | Bacteria | 1760 |
| 68 | Ga0070684_100249127 | 3300005535 | Bacteria | 1623 |
| 69 | Ga0068853_100658199 | 3300005539 | Unclassified | 997 |
| 70 | Ga0070695_100000393 | 3300005545 | Bacteria | 22683 |
| 71 | Ga0070695_100890657 | 3300005545 | Bacteria | 718 |
| 72 | Ga0070693_100130382 | 3300005547 | Bacteria | 1571 |
| 73 | Ga0070665_102647762 | 3300005548 | Bacteria | 502 |
| 74 | Ga0068855_100218222 | 3300005563 | Bacteria | 2140 |
| 75 | Ga0068855_100454303 | 3300005563 | Bacteria | 1397 |
| 76 | Ga0068855_101612540 | 3300005563 | Bacteria | 664 |
| 77 | Ga0068855_101637636 | 3300005563 | Bacteria | 658 |
| 78 | Ga0070664_100116565 | 3300005564 | Bacteria | 2336 |
| 79 | Ga0068857_100622715 | 3300005577 | Bacteria | 1021 |
| 80 | Ga0068854_100364816 | 3300005578 | Bacteria | 1186 |
| 81 | Ga0068856_100878027 | 3300005614 | Bacteria | 916 |
| 82 | Ga0068856_101139016 | 3300005614 | Bacteria | 797 |
| 83 | Ga0068856_101238604 | 3300005614 | Bacteria | 762 |
| 84 | Ga0068856_102241033 | 3300005614 | Unclassified | 555 |
| 85 | Ga0068852_100159024 | 3300005616 | Bacteria | 2108 |
| 86 | Ga0068852_101002001 | 3300005616 | Bacteria | 854 |
| 87 | Ga0068864_101111706 | 3300005618 | Bacteria | 787 |
| 88 | Ga0068858_102536587 | 3300005842 | Unclassified | 506 |
| 89 | Ga0068858_102546356 | 3300005842 | Unclassified | 505 |
| 90 | Ga0081455_10037432 | 3300005937 | Bacteria | 4309 |
| 91 | Ga0081538_10001113 | 3300005981 | Bacteria | 28482 |
| 92 | Ga0081538_10011209 | 3300005981 | Bacteria | 7281 |
| 93 | Ga0081539_10016103 | 3300005985 | Bacteria | 5370 |
| 94 | Ga0070717_10028548 | 3300006028 | Bacteria | 4467 |
| 95 | Ga0070717_10124547 | 3300006028 | Bacteria | 2211 |
| 96 | Ga0070717_10400465 | 3300006028 | Bacteria | 1233 |
| 97 | Ga0070716_100016476 | 3300006173 | Bacteria | 3815 |
| 98 | Ga0070712_100122418 | 3300006175 | Bacteria | 1959 |
| 99 | Ga0075427_10000590 | 3300006194 | Bacteria | 4242 |
| 100 | Ga0075428_100029322 | 3300006844 | Bacteria | 6087 |
| 101 | Ga0075428_100200463 | 3300006844 | Bacteria | 2157 |
| 102 | Ga0075430_100007745 | 3300006846 | Bacteria | 9072 |
| 103 | Ga0075431_100020961 | 3300006847 | Bacteria | 6679 |
| 104 | Ga0075431_100335778 | 3300006847 | Bacteria | 1521 |
| 105 | Ga0075433_10013824 | 3300006852 | Bacteria | 6580 |
| 106 | Ga0075433_10013946 | 3300006852 | Bacteria | 6552 |
| 107 | Ga0075434_100018664 | 3300006871 | Bacteria | 6702 |
| 108 | Ga0075434_100183739 | 3300006871 | Bacteria | 2111 |
| 109 | Ga0075429_100024384 | 3300006880 | Bacteria | 5248 |
| 110 | Ga0075436_100919114 | 3300006914 | Unclassified | 655 |
| 111 | Ga0075435_100583535 | 3300007076 | Bacteria | 969 |
| 112 | Ga0075435_101229320 | 3300007076 | Unclassified | 656 |
| 113 | Ga0075435_101254532 | 3300007076 | Unclassified | 649 |
| 114 | Ga0105240_10024931 | 3300009093 | Bacteria | 7873 |
| 115 | Ga0105240_10146420 | 3300009093 | Bacteria | 2818 |
| 116 | Ga0105240_10200209 | 3300009093 | Bacteria | 2341 |
| 117 | Ga0105240_10756032 | 3300009093 | Bacteria | 1056 |
| 118 | Ga0105240_11104345 | 3300009093 | Bacteria | 844 |
| 119 | Ga0111539_10028289 | 3300009094 | Bacteria | 6841 |
| 120 | Ga0111539_10427798 | 3300009094 | Bacteria | 1542 |
| 121 | Ga0105245_10212951 | 3300009098 | Bacteria | 1861 |
| 122 | Ga0105245_10264112 | 3300009098 | Bacteria | 1676 |
| 123 | Ga0114129_10012071 | 3300009147 | Bacteria | 12295 |
| 124 | Ga0114129_10043881 | 3300009147 | Bacteria | 6291 |
| 125 | Ga0105241_10923862 | 3300009174 | Bacteria | 812 |
| 126 | Ga0105248_10655463 | 3300009177 | Bacteria | 1184 |
| 127 | Ga0105237_10959375 | 3300009545 | Bacteria | 862 |
| 128 | Ga0105237_11942488 | 3300009545 | Unclassified | 597 |
| 129 | Ga0105237_12745622 | 3300009545 | Bacteria | 503 |
| 130 | Ga0105238_10189611 | 3300009551 | Bacteria | 2032 |
| 131 | Ga0105238_11367508 | 3300009551 | Bacteria | 735 |
| 132 | Ga0105239_11743761 | 3300010375 | Bacteria | 721 |
| 133 | Ga0105239_13473863 | 3300010375 | Unclassified | 512 |
| 134 | Ga0157373_10524082 | 3300013100 | Bacteria | 858 |
| 135 | Ga0157371_11217932 | 3300013102 | Bacteria | 580 |
| 136 | Ga0157371_11537898 | 3300013102 | Unclassified | 520 |
| 137 | Ga0157370_10016123 | 3300013104 | Bacteria | 7574 |
| 138 | Ga0157370_10022411 | 3300013104 | Bacteria | 6284 |
| 139 | Ga0157370_10041821 | 3300013104 | Bacteria | 4418 |
| 140 | Ga0157370_11005617 | 3300013104 | Bacteria | 755 |
| 141 | Ga0157370_11023825 | 3300013104 | Unclassified | 747 |
| 142 | Ga0157369_10004660 | 3300013105 | Bacteria | 16119 |
| 143 | Ga0157369_10255103 | 3300013105 | Unclassified | 1830 |
| 144 | Ga0157369_10539709 | 3300013105 | Bacteria | 1206 |
| 145 | Ga0157369_12213467 | 3300013105 | Unclassified | 557 |
| 146 | Ga0157374_10030374 | 3300013296 | Bacteria | 4906 |
| 147 | Ga0157372_10021043 | 3300013307 | Bacteria | 7044 |
| 148 | Ga0157372_10276256 | 3300013307 | Bacteria | 1953 |
| 149 | Ga0157372_11417669 | 3300013307 | Bacteria | 801 |
| 150 | Ga0157372_11499639 | 3300013307 | Unclassified | 777 |
| 151 | Ga0157372_11535550 | 3300013307 | Bacteria | 767 |
| 152 | Ga0157372_11894864 | 3300013307 | Unclassified | 685 |
| 153 | Ga0163163_12635275 | 3300014325 | Bacteria | 560 |
| 154 | Ga0157380_10198918 | 3300014326 | Bacteria | 1776 |
| 155 | Ga0182008_10022715 | 3300014497 | Bacteria | 3211 |
| 156 | Ga0182008_10044103 | 3300014497 | Bacteria | 2218 |
| 157 | Ga0182008_10159391 | 3300014497 | Bacteria | 1135 |
| 158 | Ga0157377_10825116 | 3300014745 | Bacteria | 686 |
| 159 | Ga0157379_11140813 | 3300014968 | Unclassified | 748 |
| 160 | Ga0182006_1215840 | 3300015261 | Bacteria | 633 |
| 161 | Ga0182007_10191617 | 3300015262 | Bacteria | 711 |
| 162 | Ga0182005_1249758 | 3300015265 | Bacteria | 548 |
| 163 | Ga0206356_11791757 | 3300020070 | Bacteria | 2442 |
| 164 | Ga0206354_10534634 | 3300020081 | Bacteria | 1314 |
| 165 | Ga0213875_10054897 | 3300021388 | Bacteria | 1865 |
| 166 | Ga0207692_10769539 | 3300025898 | Bacteria | 628 |
| 167 | Ga0207685_10415115 | 3300025905 | Bacteria | 693 |
| 168 | Ga0207699_10049801 | 3300025906 | Bacteria | 2467 |
| 169 | Ga0207699_10050976 | 3300025906 | Bacteria | 2444 |
| 170 | Ga0207699_10213505 | 3300025906 | Bacteria | 1313 |
| 171 | Ga0207699_10860877 | 3300025906 | Bacteria | 668 |
| 172 | Ga0207705_10012826 | 3300025909 | Bacteria | 6052 |
| 173 | Ga0207705_10164124 | 3300025909 | Bacteria | 1670 |
| 174 | Ga0207705_10199224 | 3300025909 | Bacteria | 1517 |
| 175 | Ga0207705_10282637 | 3300025909 | Bacteria | 1270 |
| 176 | Ga0207705_10362974 | 3300025909 | Bacteria | 1117 |
| 177 | Ga0207707_10033680 | 3300025912 | Bacteria | 4483 |
| 178 | Ga0207707_10154079 | 3300025912 | Bacteria | 2009 |
| 179 | Ga0207707_10657421 | 3300025912 | Bacteria | 883 |
| 180 | Ga0207707_10928319 | 3300025912 | Bacteria | 718 |
| 181 | Ga0207695_10177963 | 3300025913 | Bacteria | 2049 |
| 182 | Ga0207695_10237900 | 3300025913 | Bacteria | 1723 |
| 183 | Ga0207695_10446189 | 3300025913 | Bacteria | 1177 |
| 184 | Ga0207671_10164564 | 3300025914 | Bacteria | 1719 |
| 185 | Ga0207693_10000964 | 3300025915 | Bacteria | 25831 |
| 186 | Ga0207663_10030999 | 3300025916 | Bacteria | 3159 |
| 187 | Ga0207663_10743448 | 3300025916 | Bacteria | 779 |
| 188 | Ga0207660_10120381 | 3300025917 | Bacteria | 1987 |
| 189 | Ga0207660_10128139 | 3300025917 | Bacteria | 1929 |
| 190 | Ga0207660_11185890 | 3300025917 | Bacteria | 621 |
| 191 | Ga0207657_10013269 | 3300025919 | Bacteria | 8084 |
| 192 | Ga0207657_10192349 | 3300025919 | Bacteria | 1645 |
| 193 | Ga0207657_10274661 | 3300025919 | Bacteria | 1339 |
| 194 | Ga0207657_10750019 | 3300025919 | Unclassified | 756 |
| 195 | Ga0207649_10139689 | 3300025920 | Bacteria | 1656 |
| 196 | Ga0207649_10353800 | 3300025920 | Bacteria | 1088 |
| 197 | Ga0207652_10038728 | 3300025921 | Bacteria | 4043 |
| 198 | Ga0207652_10154228 | 3300025921 | Bacteria | 2057 |
| 199 | Ga0207652_10182420 | 3300025921 | Bacteria | 1887 |
| 200 | Ga0207652_10660449 | 3300025921 | Bacteria | 934 |
| 201 | Ga0207652_10941014 | 3300025921 | Bacteria | 762 |
| 202 | Ga0207646_10424447 | 3300025922 | Unclassified | 1200 |
| 203 | Ga0207694_10224550 | 3300025924 | Bacteria | 1533 |
| 204 | Ga0207694_11229355 | 3300025924 | Bacteria | 634 |
| 205 | Ga0207687_10186143 | 3300025927 | Bacteria | 1612 |
| 206 | Ga0207687_11355093 | 3300025927 | Bacteria | 611 |
| 207 | Ga0207700_10008053 | 3300025928 | Bacteria | 6499 |
| 208 | Ga0207700_10047569 | 3300025928 | Bacteria | 3180 |
| 209 | Ga0207700_11875538 | 3300025928 | Bacteria | 526 |
| 210 | Ga0207664_10005790 | 3300025929 | Bacteria | 8451 |
| 211 | Ga0207664_10077497 | 3300025929 | Bacteria | 2693 |
| 212 | Ga0207664_10165711 | 3300025929 | Bacteria | 1888 |
| 213 | Ga0207664_10211736 | 3300025929 | Bacteria | 1677 |
| 214 | Ga0207664_10321852 | 3300025929 | Bacteria | 1365 |
| 215 | Ga0207664_10365407 | 3300025929 | Bacteria | 1279 |
| 216 | Ga0207664_10473922 | 3300025929 | Bacteria | 1119 |
| 217 | Ga0207664_10487097 | 3300025929 | Bacteria | 1103 |
| 218 | Ga0207664_10868285 | 3300025929 | Bacteria | 811 |
| 219 | Ga0207664_11925129 | 3300025929 | Unclassified | 514 |
| 220 | Ga0207644_10288647 | 3300025931 | Bacteria | 1319 |
| 221 | Ga0207644_11008232 | 3300025931 | Bacteria | 699 |
| 222 | Ga0207690_10029640 | 3300025932 | Bacteria | 3483 |
| 223 | Ga0207690_10335033 | 3300025932 | Bacteria | 1193 |
| 224 | Ga0207669_10135749 | 3300025937 | Bacteria | 1699 |
| 225 | Ga0207704_10148872 | 3300025938 | Bacteria | 1649 |
| 226 | Ga0207665_10013449 | 3300025939 | Bacteria | 5381 |
| 227 | Ga0207691_10760564 | 3300025940 | Unclassified | 815 |
| 228 | Ga0207711_10397713 | 3300025941 | Bacteria | 1280 |
| 229 | Ga0207711_11341213 | 3300025941 | Bacteria | 658 |
| 230 | Ga0207679_10092077 | 3300025945 | Bacteria | 2348 |
| 231 | Ga0207667_10125374 | 3300025949 | Bacteria | 2645 |
| 232 | Ga0207667_10223449 | 3300025949 | Bacteria | 1929 |
| 233 | Ga0207667_11052084 | 3300025949 | Bacteria | 799 |
| 234 | Ga0207703_12005476 | 3300026035 | Unclassified | 555 |
| 235 | Ga0207639_10581606 | 3300026041 | Unclassified | 1031 |
| 236 | Ga0207639_11469845 | 3300026041 | Bacteria | 640 |
| 237 | Ga0207678_10274274 | 3300026067 | Bacteria | 1447 |
| 238 | Ga0207708_10225274 | 3300026075 | Bacteria | 1504 |
| 239 | Ga0207702_10391668 | 3300026078 | Bacteria | 1338 |
| 240 | Ga0207702_10886400 | 3300026078 | Bacteria | 884 |
| 241 | Ga0207702_12107708 | 3300026078 | Unclassified | 553 |
| 242 | Ga0207702_12341002 | 3300026078 | Unclassified | 522 |
| 243 | Ga0207676_11420523 | 3300026095 | Bacteria | 690 |
| 244 | Ga0207674_10431926 | 3300026116 | Bacteria | 1273 |
| 245 | Ga0207683_10634836 | 3300026121 | Bacteria | 989 |
| 246 | Ga0207698_10067080 | 3300026142 | Bacteria | 2828 |
| 247 | Ga0207698_10490712 | 3300026142 | Bacteria | 1193 |
| 248 | Ga0207428_10001190 | 3300027907 | Bacteria | 28004 |
| 249 | Ga0265337_1057367 | 3300028556 | Bacteria | 1084 |
| 250 | Ga0265337_1063791 | 3300028556 | Bacteria | 1018 |
| 251 | Ga0265337_1093821 | 3300028556 | Bacteria | 818 |
| 252 | Ga0265326_10022511 | 3300028558 | Bacteria | 1805 |
| 253 | Ga0265319_1002310 | 3300028563 | Bacteria | 10520 |
| 254 | Ga0265319_1002945 | 3300028563 | Bacteria | 9062 |
| 255 | Ga0265319_1054326 | 3300028563 | Bacteria | 1314 |
| 256 | Ga0265334_10009809 | 3300028573 | Bacteria | 4048 |
| 257 | Ga0265334_10158113 | 3300028573 | Bacteria | 797 |
| 258 | Ga0265318_10002950 | 3300028577 | Bacteria | 8818 |
| 259 | Ga0265318_10010568 | 3300028577 | Bacteria | 4012 |
| 260 | Ga0265323_10146950 | 3300028653 | Bacteria | 756 |
| 261 | Ga0265322_10009592 | 3300028654 | Bacteria | 2809 |
| 262 | Ga0265322_10080691 | 3300028654 | Bacteria | 923 |
| 263 | Ga0265336_10001570 | 3300028666 | Bacteria | 10254 |
| 264 | Ga0265336_10022541 | 3300028666 | Bacteria | 2004 |
| 265 | Ga0265336_10041327 | 3300028666 | Bacteria | 1410 |
| 266 | Ga0265338_10004508 | 3300028800 | Bacteria | 18779 |
| 267 | Ga0265338_10016515 | 3300028800 | Bacteria | 8024 |
| 268 | Ga0265338_10016873 | 3300028800 | Bacteria | 7905 |
| 269 | Ga0265338_10021437 | 3300028800 | Bacteria | 6737 |
| 270 | Ga0265338_10021638 | 3300028800 | Bacteria | 6695 |
| 271 | Ga0265338_10026870 | 3300028800 | Bacteria | 5791 |
| 272 | Ga0265338_10045918 | 3300028800 | Bacteria | 4010 |
| 273 | Ga0265338_10059124 | 3300028800 | Bacteria | 3378 |
| 274 | Ga0265324_10011282 | 3300029957 | Bacteria | 3410 |
| 275 | Ga0265324_10277865 | 3300029957 | Unclassified | 569 |
| 276 | Ga0265330_10028516 | 3300031235 | Bacteria | 2515 |
| 277 | Ga0265330_10029044 | 3300031235 | Bacteria | 2488 |
| 278 | Ga0265332_10014621 | 3300031238 | Bacteria | 3471 |
| 279 | Ga0265332_10018345 | 3300031238 | Bacteria | 3087 |
| 280 | Ga0265332_10407797 | 3300031238 | Bacteria | 561 |
| 281 | Ga0265332_10486575 | 3300031238 | Unclassified | 511 |
| 282 | Ga0265328_10032438 | 3300031239 | Bacteria | 1938 |
| 283 | Ga0265320_10026485 | 3300031240 | Bacteria | 3033 |
| 284 | Ga0265320_10064391 | 3300031240 | Bacteria | 1741 |
| 285 | Ga0265325_10000453 | 3300031241 | Bacteria | 29634 |
| 286 | Ga0265329_10004254 | 3300031242 | Bacteria | 6011 |
| 287 | Ga0265329_10104851 | 3300031242 | Bacteria | 901 |
| 288 | Ga0265340_10003413 | 3300031247 | Bacteria | 8974 |
| 289 | Ga0265340_10037720 | 3300031247 | Bacteria | 2393 |
| 290 | Ga0265339_10005781 | 3300031249 | Bacteria | 8211 |
| 291 | Ga0265339_10031744 | 3300031249 | Bacteria | 2983 |
| 292 | Ga0265339_10036063 | 3300031249 | Bacteria | 2769 |
| 293 | Ga0265339_10044507 | 3300031249 | Bacteria | 2448 |
| 294 | Ga0265331_10012453 | 3300031250 | Bacteria | 4607 |
| 295 | Ga0265331_10030466 | 3300031250 | Bacteria | 2686 |
| 296 | Ga0265331_10045650 | 3300031250 | Bacteria | 2115 |
| 297 | Ga0265327_10010269 | 3300031251 | Bacteria | 6602 |
| 298 | Ga0265327_10012478 | 3300031251 | Bacteria | 5726 |
| 299 | Ga0265327_10032624 | 3300031251 | Bacteria | 2912 |
| 300 | Ga0265327_10121724 | 3300031251 | Bacteria | 1236 |
| 301 | Ga0265316_10033792 | 3300031344 | Bacteria | 4160 |
| 302 | Ga0265316_10052875 | 3300031344 | Bacteria | 3184 |
| 303 | Ga0265316_10455245 | 3300031344 | Bacteria | 917 |
| 304 | Ga0265313_10025257 | 3300031595 | Bacteria | 3153 |
| 305 | Ga0265313_10043563 | 3300031595 | Bacteria | 2197 |
| 306 | Ga0265313_10049938 | 3300031595 | Bacteria | 2010 |
| 307 | Ga0265314_10002833 | 3300031711 | Bacteria | 17262 |
| 308 | Ga0265314_10022158 | 3300031711 | Bacteria | 4869 |
| 309 | Ga0265342_10002319 | 3300031712 | Bacteria | 16552 |
| 310 | Ga0265342_10030763 | 3300031712 | Bacteria | 3323 |
| 311 | Ga0307405_10020909 | 3300031731 | Bacteria | 3668 |
| 312 | Ga0307413_10203025 | 3300031824 | Bacteria | 1433 |
| 313 | Ga0307413_10302607 | 3300031824 | Bacteria | 1213 |
| 314 | Ga0307410_10239301 | 3300031852 | Unclassified | 1406 |
| 315 | Ga0307410_10736049 | 3300031852 | Bacteria | 834 |
| 316 | Ga0307410_10751081 | 3300031852 | Bacteria | 826 |
| 317 | Ga0307406_10057377 | 3300031901 | Bacteria | 2497 |
| 318 | Ga0307406_10256491 | 3300031901 | Bacteria | 1320 |
| 319 | Ga0307406_12000520 | 3300031901 | Bacteria | 518 |
| 320 | Ga0307407_10011507 | 3300031903 | Bacteria | 4215 |
| 321 | Ga0307407_10267836 | 3300031903 | Bacteria | 1178 |
| 322 | Ga0307412_10209278 | 3300031911 | Bacteria | 1487 |
| 323 | Ga0307409_100082779 | 3300031995 | Bacteria | 2599 |
| 324 | Ga0307409_100376968 | 3300031995 | Bacteria | 1347 |
| 325 | Ga0307416_100000306 | 3300032002 | Bacteria | 25268 |
| 326 | Ga0307416_100065882 | 3300032002 | Bacteria | 2979 |
| 327 | Ga0307416_100100885 | 3300032002 | Bacteria | 2512 |
| 328 | Ga0307416_100844102 | 3300032002 | Bacteria | 1014 |
| 329 | Ga0307416_102613189 | 3300032002 | Bacteria | 602 |
| 330 | Ga0307414_10503769 | 3300032004 | Bacteria | 1072 |
| 331 | Ga0307414_11347049 | 3300032004 | Unclassified | 663 |
| 332 | Ga0307411_10030410 | 3300032005 | Bacteria | 3310 |
| 333 | Ga0307415_100000930 | 3300032126 | Bacteria | 13418 |
| 334 | Ga0307415_100062175 | 3300032126 | Bacteria | 2588 |
| 335 | Ga0307415_100158116 | 3300032126 | Bacteria | 1753 |
| 336 | Ga0307415_100513206 | 3300032126 | Bacteria | 1050 |
| 337 | Ga0307415_100697687 | 3300032126 | Bacteria | 915 |
| 338 | Ga0373934_0089974 | 3300035086 | Unclassified | 1237 |
| 339 | Ga0373934_0226779 | 3300035086 | Bacteria | 771 |
| 340 | Ga0373951_0035178 | 3300035091 | Bacteria | 1192 |
| 341 | Ga0373939_0149791 | 3300035114 | Bacteria | 848 |
| 342 | Ga0373954_0066752 | 3300035118 | Bacteria | 1704 |
| 343 | Ga0373954_0255267 | 3300035118 | Bacteria | 863 |
| 344 | Ga0373957_0361873 | 3300035120 | Bacteria | 621 |
| 345 | Ga0373955_0148769 | 3300035172 | Bacteria | 1377 |
| 346 | Ga0373924_0255472 | 3300035410 | Bacteria | 776 |
| 347 | Ga0373933_0029412 | 3300035724 | Bacteria | 3177 |
| 348 | Ga0373937_0184320 | 3300036401 | Bacteria | 1960 |
| 349 | Ga0373937_0455363 | 3300036401 | Bacteria | 1215 |
| 350 | Ga0395899_0040170 | 3300037312 | Unclassified | 3499 |
| 351 | Ga0395899_0450104 | 3300037312 | Bacteria | 843 |
| 352 | Ga0395900_0178615 | 3300037418 | Bacteria | 2158 |
| 353 | Ga0395900_0276795 | 3300037418 | Bacteria | 1671 |
| 354 | Ga0395900_0849191 | 3300037418 | Bacteria | 839 |
| 355 | Ga0395900_0883116 | 3300037418 | Bacteria | 818 |
| 356 | Ga0395900_1656174 | 3300037418 | Bacteria | 551 |
| 357 | Ga0395900_1718069 | 3300037418 | Unclassified | 538 |
| 358 | Ga0395898_0075428 | 3300037466 | Bacteria | 3257 |
| 359 | Ga0395898_0153315 | 3300037466 | Bacteria | 2204 |
| 360 | Ga0395898_0338849 | 3300037466 | Bacteria | 1434 |
| 361 | Ga0395898_0351996 | 3300037466 | Bacteria | 1404 |
| 362 | Ga0395898_1226098 | 3300037466 | Bacteria | 681 |
| 363 | Ga0395898_1373564 | 3300037466 | Bacteria | 634 |
| 364 | Ga0395905_0150706 | 3300037471 | Bacteria | 2188 |
| 365 | Ga0395905_0344112 | 3300037471 | Bacteria | 1382 |
| 366 | Ga0436364_0601973 | 3300037853 | Bacteria | 29284 |
| 367 | Ga0395901_0252028 | 3300038443 | Unclassified | 1839 |
| 368 | Ga0395901_0269636 | 3300038443 | Bacteria | 1771 |
| 369 | Ga0395901_0590990 | 3300038443 | Bacteria | 1120 |
| 370 | Ga0395901_0730722 | 3300038443 | Bacteria | 985 |
| 371 | Ga0395901_1304902 | 3300038443 | Bacteria | 687 |
| 372 | Ga0436363_0088266 | 3300039450 | Bacteria | 8561 |
| 373 | Ga0436363_0839180 | 3300039450 | Unclassified | 1001 |
| 374 | Ga0451839_1027749 | 3300041496 | Bacteria | 817 |
| 375 | Ga0439448_0030869 | 3300042005 | Bacteria | 1701 |
| 376 | Ga0450914_046087 | 3300042118 | Unclassified | 564 |
| 377 | Ga0439458_0074899 | 3300042157 | Bacteria | 859 |
| 378 | Ga0439440_0020634 | 3300042993 | Bacteria | 1479 |
| 379 | Ga0439440_0104752 | 3300042993 | Unclassified | 773 |
| 380 | Ga0439440_0153640 | 3300042993 | Bacteria | 660 |
| 381 | Ga0466969_0041058 | 3300044656 | Bacteria | 2316 |
| 382 | Ga0466972_0207411 | 3300044658 | Bacteria | 917 |
| 383 | Ga0466966_0005166 | 3300044684 | Bacteria | 8579 |
| 384 | Ga0466966_0036173 | 3300044684 | Bacteria | 3189 |
| 385 | Ga0466961_0140424 | 3300044693 | Unclassified | 1512 |
| 386 | Ga0466961_0177989 | 3300044693 | Bacteria | 1321 |
| 387 | Ga0466963_0004956 | 3300044694 | Bacteria | 7763 |
| 388 | Ga0466963_0008918 | 3300044694 | Bacteria | 6020 |
| 389 | Ga0466963_0014973 | 3300044694 | Bacteria | 4792 |
| 390 | Ga0466963_0064071 | 3300044694 | Bacteria | 2461 |
| 391 | Ga0466963_0088074 | 3300044694 | Bacteria | 2111 |
| 392 | Ga0466963_0169355 | 3300044694 | Bacteria | 1522 |
| 393 | Ga0466963_0314891 | 3300044694 | Bacteria | 1101 |
| 394 | Ga0466963_0749912 | 3300044694 | Bacteria | 689 |
| 395 | Ga0466963_0874936 | 3300044694 | Bacteria | 633 |
| 396 | Ga0466963_0919930 | 3300044694 | Bacteria | 616 |
| 397 | Ga0466963_1337025 | 3300044694 | Bacteria | 503 |
| 398 | Ga0466964_0001680 | 3300044706 | Bacteria | 7642 |
| 399 | Ga0466964_0001976 | 3300044706 | Bacteria | 7194 |
| 400 | Ga0466964_0069379 | 3300044706 | Bacteria | 1486 |
| 401 | Ga0466964_0306683 | 3300044706 | Unclassified | 802 |
| 402 | Ga0466971_0004164 | 3300044719 | Bacteria | 6233 |
| 403 | Ga0466971_0063093 | 3300044719 | Unclassified | 1677 |
| 404 | Ga0466971_0099539 | 3300044719 | Bacteria | 1335 |
| 405 | Ga0466971_0127653 | 3300044719 | Unclassified | 1179 |
| 406 | Ga0466971_0144444 | 3300044719 | Bacteria | 1109 |
| 407 | Ga0466971_0204630 | 3300044719 | Bacteria | 932 |
| 408 | Ga0466968_0001841 | 3300044735 | Bacteria | 7657 |
| 409 | Ga0466968_0036892 | 3300044735 | Bacteria | 2049 |
| 410 | Ga0466968_0061994 | 3300044735 | Bacteria | 1614 |
| 411 | Ga0466968_0091241 | 3300044735 | Bacteria | 1350 |
| 412 | Ga0466968_0353674 | 3300044735 | Bacteria | 714 |
| 413 | Ga0466970_0055263 | 3300044765 | Bacteria | 2120 |
| 414 | Ga0466970_0228513 | 3300044765 | Bacteria | 1039 |
| 415 | Ga0466957_0000839 | 3300044842 | Bacteria | 15709 |
| 416 | Ga0466957_0005602 | 3300044842 | Bacteria | 7057 |
| 417 | Ga0466957_0011876 | 3300044842 | Bacteria | 5034 |
| 418 | Ga0466957_0014602 | 3300044842 | Bacteria | 4576 |
| 419 | Ga0466957_0055290 | 3300044842 | Bacteria | 2426 |
| 420 | Ga0466957_0363862 | 3300044842 | Bacteria | 983 |
| 421 | Ga0466957_0537836 | 3300044842 | Bacteria | 813 |
| 422 | Ga0466957_0945702 | 3300044842 | Bacteria | 617 |
| 423 | Ga0466959_0002503 | 3300045049 | Bacteria | 11770 |
| 424 | Ga0466959_0004905 | 3300045049 | Bacteria | 9061 |
| 425 | Ga0466959_0133999 | 3300045049 | Bacteria | 1755 |
| 426 | Ga0466959_0260048 | 3300045049 | Bacteria | 1195 |
| 427 | Ga0466959_0543850 | 3300045049 | Bacteria | 783 |
| 428 | Ga0466958_0001766 | 3300045836 | Bacteria | 10466 |
| 429 | Ga0466958_0004935 | 3300045836 | Bacteria | 7113 |
| 430 | Ga0466958_0028945 | 3300045836 | Bacteria | 3286 |
| 431 | Ga0466958_0165325 | 3300045836 | Bacteria | 1400 |
| 432 | Ga0466958_0326668 | 3300045836 | Bacteria | 986 |
| 433 | Ga0466958_0439240 | 3300045836 | Bacteria | 844 |
| 434 | Ga0466967_0005346 | 3300045976 | Bacteria | 8876 |
| 435 | Ga0466967_0006620 | 3300045976 | Bacteria | 8234 |
| 436 | Ga0466967_0008127 | 3300045976 | Bacteria | 7657 |
| 437 | Ga0466967_0009557 | 3300045976 | Bacteria | 7204 |
| 438 | Ga0466967_0034363 | 3300045976 | Bacteria | 4302 |
| 439 | Ga0466967_0074693 | 3300045976 | Bacteria | 3045 |
| 440 | Ga0466967_0091170 | 3300045976 | Bacteria | 2769 |
| 441 | Ga0466967_0112223 | 3300045976 | Bacteria | 2506 |
| 442 | Ga0466967_0129314 | 3300045976 | Bacteria | 2343 |
| 443 | Ga0466967_0173973 | 3300045976 | Bacteria | 2027 |
| 444 | Ga0466967_0192421 | 3300045976 | Bacteria | 1928 |
| 445 | Ga0466967_0197028 | 3300045976 | Bacteria | 1906 |
| 446 | Ga0466967_0317509 | 3300045976 | Bacteria | 1502 |
| 447 | Ga0466967_0406344 | 3300045976 | Unclassified | 1325 |
| 448 | Ga0466967_1268203 | 3300045976 | Bacteria | 734 |
| 449 | Ga0466967_1312219 | 3300045976 | Unclassified | 721 |
| 450 | Ga0466967_1365879 | 3300045976 | Unclassified | 706 |
| 451 | Ga0466967_2054956 | 3300045976 | Unclassified | 568 |
| 452 | Ga0495592_0112615 | 3300046454 | Bacteria | 1923 |
| 453 | Ga0495651_0121844 | 3300046462 | Bacteria | 1915 |
| 454 | Ga0495653_0364669 | 3300046463 | Unclassified | 926 |
| 455 | Ga0495582_0708626 | 3300046473 | Bacteria | 582 |
| 456 | Ga0495608_0047598 | 3300046511 | Bacteria | 2850 |
| 457 | Ga0495608_0929760 | 3300046511 | Bacteria | 508 |
| 458 | Ga0495618_0045317 | 3300046514 | Bacteria | 2774 |
| 459 | Ga0495618_0576770 | 3300046514 | Bacteria | 671 |
| 460 | Ga0495628_0307212 | 3300046516 | Bacteria | 1173 |
| 461 | Ga0495630_0167052 | 3300046517 | Bacteria | 1675 |
| 462 | Ga0495630_0529115 | 3300046517 | Bacteria | 904 |
| 463 | Ga0495630_0709201 | 3300046517 | Bacteria | 770 |
| 464 | Ga0495640_0016020 | 3300046533 | Bacteria | 5621 |
| 465 | Ga0495645_0451700 | 3300046543 | Bacteria | 810 |
| 466 | Ga0495667_0306847 | 3300046559 | Bacteria | 1005 |
| 467 | Ga0495634_0056266 | 3300046642 | Bacteria | 2628 |
| 468 | Ga0495634_0201502 | 3300046642 | Unclassified | 1236 |
| 469 | Ga0495635_0013904 | 3300046663 | Bacteria | 5631 |
| 470 | Ga0495635_0062502 | 3300046663 | Bacteria | 2557 |
| 471 | Ga0495635_0351977 | 3300046663 | Bacteria | 982 |
| 472 | Ga0495657_0129175 | 3300046675 | Unclassified | 1584 |
| 473 | Ga0495657_0549142 | 3300046675 | Bacteria | 671 |
| 474 | Ga0495657_0892697 | 3300046675 | Bacteria | 505 |
| 475 | Ga0495646_0301132 | 3300046680 | Bacteria | 848 |
| 476 | Ga0495613_0394405 | 3300046689 | Bacteria | 945 |
| 477 | Ga0495613_0750231 | 3300046689 | Bacteria | 640 |
| 478 | Ga0495604_0169862 | 3300047317 | Bacteria | 1535 |
| 479 | Ga0495636_0366278 | 3300047318 | Bacteria | 682 |
| 480 | Ga0495674_0090385 | 3300047319 | Bacteria | 2616 |
| 481 | Ga0495674_0770242 | 3300047319 | Bacteria | 750 |
| 482 | Ga0495680_0839345 | 3300047322 | Unclassified | 598 |
| 483 | Ga0495680_1060270 | 3300047322 | Unclassified | 514 |
| 484 | Ga0495680_1083873 | 3300047322 | Unclassified | 507 |
| 485 | Ga0495675_0306137 | 3300047444 | Bacteria | 943 |
| 486 | Ga0495684_0097766 | 3300047471 | Bacteria | 2220 |
| 487 | Ga0495684_0103387 | 3300047471 | Bacteria | 2153 |
| 488 | Ga0495684_0285790 | 3300047471 | Bacteria | 1188 |
| 489 | Ga0495602_0777455 | 3300048088 | Bacteria | 644 |
| 490 | Ga0495602_1088199 | 3300048088 | Unclassified | 524 |
| 491 | Ga0496100_0012368 | 3300048903 | Bacteria | 4890 |
| 492 | Ga0496102_0032716 | 3300048905 | Bacteria | 4673 |
| 493 | Ga0496102_0236273 | 3300048905 | Bacteria | 1723 |
| 494 | Ga0496103_0019776 | 3300048906 | Bacteria | 4042 |
| 495 | Ga0496103_0077535 | 3300048906 | Bacteria | 2086 |
| 496 | Ga0496104_0497929 | 3300048907 | Bacteria | 1129 |
| 497 | Ga0496105_0057053 | 3300048908 | Bacteria | 3224 |
| 498 | Ga0496106_0030374 | 3300048909 | Bacteria | 4030 |
| 499 | Ga0496107_0059855 | 3300048910 | Bacteria | 2756 |
| 500 | Ga0496108_0031623 | 3300048911 | Bacteria | 4392 |
| 501 | Ga0496109_0053696 | 3300048912 | Bacteria | 3675 |
| 502 | Ga0496110_0038024 | 3300048913 | Bacteria | 4185 |
| 503 | Ga0496110_0485280 | 3300048913 | Bacteria | 1126 |
| 504 | Ga0496111_0021414 | 3300048914 | Bacteria | 4514 |
| 505 | Ga0496111_0700314 | 3300048914 | Bacteria | 737 |
| 506 | Ga0496112_0047465 | 3300048915 | Bacteria | 4213 |
| 507 | Ga0496112_0068960 | 3300048915 | Bacteria | 3493 |
| 508 | Ga0496112_0102958 | 3300048915 | Bacteria | 2824 |
| 509 | Ga0496112_0472137 | 3300048915 | Bacteria | 1191 |
| 510 | Ga0496112_0757643 | 3300048915 | Bacteria | 897 |
| 511 | Ga0496113_0040740 | 3300048916 | Bacteria | 3424 |
| 512 | Ga0496113_0304233 | 3300048916 | Bacteria | 1277 |
| 513 | Ga0496113_0802609 | 3300048916 | Bacteria | 748 |
| 514 | Ga0496113_0955262 | 3300048916 | Unclassified | 676 |
| 515 | Ga0496114_0068218 | 3300048917 | Bacteria | 2985 |
| 516 | Ga0496115_0096138 | 3300048918 | Bacteria | 2425 |
| 517 | Ga0501031_0001219 | 3300049568 | Bacteria | 15732 |
| 518 | Ga0501032_0136844 | 3300049569 | Bacteria | 1614 |
| 519 | Ga0501033_0013698 | 3300049570 | Bacteria | 6170 |
| 520 | Ga0501034_0004154 | 3300049571 | Bacteria | 16214 |
| 521 | Ga0501034_1029845 | 3300049571 | Bacteria | 706 |
| 522 | Ga0501036_0001012 | 3300049572 | Bacteria | 21208 |
| 523 | Ga0501037_0118841 | 3300049573 | Bacteria | 1901 |
| 524 | Ga0501038_0131989 | 3300049574 | Bacteria | 2049 |
| 525 | Ga0501039_0000777 | 3300049575 | Bacteria | 22938 |
| 526 | Ga0501040_0000970 | 3300049576 | Bacteria | 18153 |
| 527 | Ga0501041_0000521 | 3300049577 | Bacteria | 19853 |
| 528 | Ga0501042_0000384 | 3300049578 | Bacteria | 22447 |
| 529 | Ga0501043_0005685 | 3300049579 | Bacteria | 10045 |
| 530 | Ga0501046_0005314 | 3300049580 | Bacteria | 11518 |
| 531 | Ga0501048_0000488 | 3300049582 | Bacteria | 27710 |
| 532 | Ga0501067_0076281 | 3300049583 | Unclassified | 1857 |
| 533 | Ga0501067_0106131 | 3300049583 | Bacteria | 1561 |
| 534 | Ga0501067_0156485 | 3300049583 | Bacteria | 1270 |
| 535 | Ga0501067_0841133 | 3300049583 | Bacteria | 517 |
| 536 | Ga0501068_0081940 | 3300049584 | Bacteria | 1981 |
| 537 | Ga0501069_0029782 | 3300049585 | Bacteria | 2997 |
| 538 | Ga0501069_0314783 | 3300049585 | Bacteria | 919 |
| 539 | Ga0501070_0005070 | 3300049586 | Bacteria | 11223 |
| 540 | Ga0501070_0050585 | 3300049586 | Bacteria | 3449 |
| 541 | Ga0501070_0507919 | 3300049586 | Bacteria | 968 |
| 542 | Ga0501071_0001049 | 3300049587 | Bacteria | 15310 |
| 543 | Ga0501072_0002834 | 3300049588 | Bacteria | 13015 |
| 544 | Ga0501072_0015504 | 3300049588 | Bacteria | 5841 |
| 545 | Ga0501073_0115410 | 3300049589 | Bacteria | 1861 |
| 546 | Ga0501073_0242548 | 3300049589 | Bacteria | 1244 |
| 547 | Ga0501074_0001561 | 3300049590 | Bacteria | 15492 |
| 548 | Ga0501074_0010895 | 3300049590 | Bacteria | 6600 |
| 549 | Ga0501074_0029258 | 3300049590 | Bacteria | 3990 |
| 550 | Ga0501075_0007067 | 3300049591 | Bacteria | 7755 |
| 551 | Ga0501076_0000670 | 3300049592 | Bacteria | 21958 |
| 552 | Ga0501077_0000979 | 3300049593 | Bacteria | 17210 |
| 553 | Ga0501079_0000766 | 3300049741 | Bacteria | 21943 |
| 554 | Ga0501079_0094604 | 3300049741 | Bacteria | 2315 |
| 555 | Ga0501080_0002096 | 3300049742 | Bacteria | 17315 |
| 556 | Ga0501080_0004391 | 3300049742 | Bacteria | 12530 |
| 557 | Ga0501080_0065727 | 3300049742 | Bacteria | 3373 |
| 558 | Ga0501081_0000421 | 3300049743 | Bacteria | 23417 |
| 559 | Ga0501083_0009464 | 3300049744 | Bacteria | 6883 |
| 560 | Ga0501083_0032395 | 3300049744 | Bacteria | 3584 |
| 561 | Ga0501035_0009537 | 3300049822 | Bacteria | 9026 |
| 562 | Ga0501044_0174414 | 3300049823 | Bacteria | 2120 |
| 563 | Ga0501044_0608092 | 3300049823 | Bacteria | 986 |
| 564 | Ga0501045_0001105 | 3300049824 | Bacteria | 17822 |
| 565 | nmdc:mga05p37_19132_c1 | 3300050507 | Bacteria | 8284 |
| 566 | nmdc:mga05p37_56249_c1 | 3300050507 | Bacteria | 4843 |
| 567 | nmdc:mga09592_32597_c1 | 3300050508 | Bacteria | 4344 |
| 568 | nmdc:mga0qj67_6104_c1 | 3300050509 | Bacteria | 8830 |
| 569 | nmdc:mga06r32_473678_c1 | 3300050510 | Unclassified | 1231 |
| 570 | nmdc:mga06r32_571254_c1 | 3300050510 | Bacteria | 1103 |
| 571 | nmdc:mga06r32_7228_c1 | 3300050510 | Bacteria | 10009 |
| 572 | nmdc:mga08y16_493_c1 | 3300050511 | Bacteria | 36438 |
| 573 | nmdc:mga0n895_13975_c1 | 3300050512 | Bacteria | 7271 |
| 574 | nmdc:mga0n895_511440_c1 | 3300050512 | Bacteria | 1209 |
| 575 | nmdc:mga0n895_89825_c1 | 3300050512 | Bacteria | 3073 |
| 576 | nmdc:mga0rr50_100538_c1 | 3300050513 | Bacteria | 2271 |
| 577 | nmdc:mga0rr50_1297854_c1 | 3300050513 | Unclassified | 617 |
| 578 | nmdc:mga0a205_44534_c3 | 3300050515 | Bacteria | 1321 |
| 579 | nmdc:mga0a205_6411_c1 | 3300050515 | Bacteria | 10633 |
| 580 | Ga0495601_0159394 | 3300053077 | Bacteria | 1474 |
| 581 | Ga0495601_0247133 | 3300053077 | Bacteria | 1165 |
| 582 | Ga0495595_0364801 | 3300053084 | Unclassified | 730 |
| 583 | Ga0495619_0089025 | 3300053085 | Bacteria | 2088 |
| 584 | Ga0500566_0253153 | 3300053094 | Bacteria | 855 |
| 585 | Ga0501084_0000718 | 3300054114 | Bacteria | 25255 |
| 586 | Ga0501082_0004632 | 3300060353 | Bacteria | 12001 |
| 587 | Ga0501082_0098702 | 3300060353 | Bacteria | 2525 |
| 588 | Ga0466962_0110085 | 3300061719 | Unclassified | 1326 |
| 589 | Ga0466962_0143216 | 3300061719 | Bacteria | 1158 |
| 590 | Ga0466962_0178183 | 3300061719 | Unclassified | 1036 |
| 591 | Ga0466962_0534266 | 3300061719 | Bacteria | 595 |
| 592 | Ga0530510_0000732 | 3300061734 | Bacteria | 21330 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10423686 | Ga0070658_104236862 | 89 |
| 2 | 3300005530 | Ga0070679_100224516 | Ga0070679_1002245164 | 89 |
| 3 | 3300005535 | Ga0070684_100249127 | Ga0070684_1002491272 | 89 |
| 4 | 3300025909 | Ga0207705_10282637 | Ga0207705_102826373 | 89 |
| 5 | 3300025921 | Ga0207652_10038728 | Ga0207652_100387285 | 89 |
| 6 | 3300025929 | Ga0207664_10321852 | Ga0207664_103218523 | 89 |
| 7 | 3300044684 | Ga0466966_0005166 | Ga0466966_0005166_8190_8483 | 89 |
| 8 | 3300045049 | Ga0466959_0004905 | Ga0466959_0004905_2714_3007 | 89 |
| 9 | 3300021388 | Ga0213875_10054897 | Ga0213875_100548972 | 90 |
| 10 | 3300037853 | Ga0436364_0601973 | Ga0436364_0601973_5591_5881 | 90 |
| 11 | 3300039450 | Ga0436363_0088266 | Ga0436363_0088266_6844_7134 | 90 |
| 12 | 3300005327 | Ga0070658_10448519 | Ga0070658_104485192 | 91 |
| 13 | 3300025929 | Ga0207664_11925129 | Ga0207664_119251291 | 91 |
| 14 | 3300041496 | Ga0451839_1027749 | Ga0451839_1027749_397_672 | 91 |
| 15 | 3300005327 | Ga0070658_10212063 | Ga0070658_102120632 | 94 |
| 16 | 3300005336 | Ga0070680_101394368 | Ga0070680_1013943682 | 94 |
| 17 | 3300005337 | Ga0070682_100130681 | Ga0070682_1001306812 | 94 |
| 18 | 3300005339 | Ga0070660_100901114 | Ga0070660_1009011142 | 94 |
| 19 | 3300005435 | Ga0070714_100933467 | Ga0070714_1009334672 | 94 |
| 20 | 3300005439 | Ga0070711_101842963 | Ga0070711_1018429631 | 94 |
| 21 | 3300005458 | Ga0070681_10043324 | Ga0070681_100433242 | 94 |
| 22 | 3300005458 | Ga0070681_10045322 | Ga0070681_100453222 | 94 |
| 23 | 3300005458 | Ga0070681_10141953 | Ga0070681_101419532 | 94 |
| 24 | 3300005530 | Ga0070679_100185790 | Ga0070679_1001857902 | 94 |
| 25 | 3300005530 | Ga0070679_100224029 | Ga0070679_1002240292 | 94 |
| 26 | 3300005539 | Ga0068853_100658199 | Ga0068853_1006581991 | 94 |
| 27 | 3300005545 | Ga0070695_100890657 | Ga0070695_1008906572 | 94 |
| 28 | 3300005563 | Ga0068855_100218222 | Ga0068855_1002182223 | 94 |
| 29 | 3300005614 | Ga0068856_101139016 | Ga0068856_1011390162 | 94 |
| 30 | 3300005614 | Ga0068856_102241033 | Ga0068856_1022410331 | 94 |
| 31 | 3300005616 | Ga0068852_101002001 | Ga0068852_1010020012 | 94 |
| 32 | 3300005842 | Ga0068858_102536587 | Ga0068858_1025365871 | 94 |
| 33 | 3300009093 | Ga0105240_10146420 | Ga0105240_101464202 | 94 |
| 34 | 3300009545 | Ga0105237_11942488 | Ga0105237_119424881 | 94 |
| 35 | 3300009551 | Ga0105238_11367508 | Ga0105238_113675081 | 94 |
| 36 | 3300010375 | Ga0105239_11743761 | Ga0105239_117437611 | 94 |
| 37 | 3300010375 | Ga0105239_13473863 | Ga0105239_134738631 | 94 |
| 38 | 3300013104 | Ga0157370_10041821 | Ga0157370_100418214 | 94 |
| 39 | 3300013105 | Ga0157369_10004660 | Ga0157369_1000466014 | 94 |
| 40 | 3300013105 | Ga0157369_12213467 | Ga0157369_122134671 | 94 |
| 41 | 3300013307 | Ga0157372_11499639 | Ga0157372_114996392 | 94 |
| 42 | 3300013307 | Ga0157372_11894864 | Ga0157372_118948642 | 94 |
| 43 | 3300014497 | Ga0182008_10022715 | Ga0182008_100227152 | 94 |
| 44 | 3300015262 | Ga0182007_10191617 | Ga0182007_101916172 | 94 |
| 45 | 3300025909 | Ga0207705_10199224 | Ga0207705_101992242 | 94 |
| 46 | 3300025912 | Ga0207707_10033680 | Ga0207707_100336802 | 94 |
| 47 | 3300025912 | Ga0207707_10928319 | Ga0207707_109283191 | 94 |
| 48 | 3300025913 | Ga0207695_10446189 | Ga0207695_104461892 | 94 |
| 49 | 3300025916 | Ga0207663_10743448 | Ga0207663_107434482 | 94 |
| 50 | 3300025917 | Ga0207660_10120381 | Ga0207660_101203812 | 94 |
| 51 | 3300025919 | Ga0207657_10750019 | Ga0207657_107500191 | 94 |
| 52 | 3300025921 | Ga0207652_10182420 | Ga0207652_101824202 | 94 |
| 53 | 3300025921 | Ga0207652_10660449 | Ga0207652_106604492 | 94 |
| 54 | 3300025924 | Ga0207694_11229355 | Ga0207694_112293551 | 94 |
| 55 | 3300025949 | Ga0207667_10125374 | Ga0207667_101253743 | 94 |
| 56 | 3300026035 | Ga0207703_12005476 | Ga0207703_120054761 | 94 |
| 57 | 3300026041 | Ga0207639_10581606 | Ga0207639_105816061 | 94 |
| 58 | 3300026078 | Ga0207702_10886400 | Ga0207702_108864002 | 94 |
| 59 | 3300026078 | Ga0207702_12107708 | Ga0207702_121077082 | 94 |
| 60 | 3300026142 | Ga0207698_10490712 | Ga0207698_104907122 | 94 |
| 61 | 3300035086 | Ga0373934_0226779 | Ga0373934_0226779_302_589 | 94 |
| 62 | 3300035118 | Ga0373954_0255267 | Ga0373954_0255267_191_478 | 94 |
| 63 | 3300035724 | Ga0373933_0029412 | Ga0373933_0029412_1405_1692 | 94 |
| 64 | 3300037418 | Ga0395900_1718069 | Ga0395900_1718069_69_356 | 94 |
| 65 | 3300003203 | JGI25406J46586_10046131 | JGI25406J46586_100461311 | 95 |
| 66 | 3300003320 | rootH2_10070391 | rootH2_100703913 | 95 |
| 67 | 3300003373 | JGI25407J50210_10022749 | JGI25407J50210_100227492 | 95 |
| 68 | 3300005327 | Ga0070658_10009450 | Ga0070658_100094505 | 95 |
| 69 | 3300005327 | Ga0070658_10192754 | Ga0070658_101927542 | 95 |
| 70 | 3300005327 | Ga0070658_10280594 | Ga0070658_102805942 | 95 |
| 71 | 3300005327 | Ga0070658_10572659 | Ga0070658_105726592 | 95 |
| 72 | 3300005336 | Ga0070680_100217097 | Ga0070680_1002170973 | 95 |
| 73 | 3300005336 | Ga0070680_100552767 | Ga0070680_1005527672 | 95 |
| 74 | 3300005337 | Ga0070682_100605611 | Ga0070682_1006056112 | 95 |
| 75 | 3300005337 | Ga0070682_100726919 | Ga0070682_1007269192 | 95 |
| 76 | 3300005339 | Ga0070660_100006295 | Ga0070660_10000629511 | 95 |
| 77 | 3300005339 | Ga0070660_100185104 | Ga0070660_1001851043 | 95 |
| 78 | 3300005339 | Ga0070660_100522439 | Ga0070660_1005224391 | 95 |
| 79 | 3300005341 | Ga0070691_10169540 | Ga0070691_101695402 | 95 |
| 80 | 3300005344 | Ga0070661_100545945 | Ga0070661_1005459452 | 95 |
| 81 | 3300005347 | Ga0070668_100425936 | Ga0070668_1004259362 | 95 |
| 82 | 3300005355 | Ga0070671_100202953 | Ga0070671_1002029532 | 95 |
| 83 | 3300005355 | Ga0070671_101590387 | Ga0070671_1015903872 | 95 |
| 84 | 3300005366 | Ga0070659_100104588 | Ga0070659_1001045883 | 95 |
| 85 | 3300005366 | Ga0070659_100419140 | Ga0070659_1004191401 | 95 |
| 86 | 3300005434 | Ga0070709_10059036 | Ga0070709_100590364 | 95 |
| 87 | 3300005434 | Ga0070709_10132303 | Ga0070709_101323031 | 95 |
| 88 | 3300005434 | Ga0070709_10458383 | Ga0070709_104583831 | 95 |
| 89 | 3300005435 | Ga0070714_100006800 | Ga0070714_1000068006 | 95 |
| 90 | 3300005435 | Ga0070714_100050816 | Ga0070714_1000508162 | 95 |
| 91 | 3300005435 | Ga0070714_100106907 | Ga0070714_1001069074 | 95 |
| 92 | 3300005435 | Ga0070714_100172145 | Ga0070714_1001721454 | 95 |
| 93 | 3300005435 | Ga0070714_100416896 | Ga0070714_1004168962 | 95 |
| 94 | 3300005436 | Ga0070713_100029034 | Ga0070713_1000290346 | 95 |
| 95 | 3300005436 | Ga0070713_100054419 | Ga0070713_1000544195 | 95 |
| 96 | 3300005436 | Ga0070713_100114150 | Ga0070713_1001141503 | 95 |
| 97 | 3300005436 | Ga0070713_101909018 | Ga0070713_1019090181 | 95 |
| 98 | 3300005437 | Ga0070710_10007726 | Ga0070710_100077266 | 95 |
| 99 | 3300005439 | Ga0070711_100031534 | Ga0070711_1000315345 | 95 |
| 100 | 3300005439 | Ga0070711_101046150 | Ga0070711_1010461502 | 95 |
| 101 | 3300005440 | Ga0070705_100834774 | Ga0070705_1008347741 | 95 |
| 102 | 3300005441 | Ga0070700_100156540 | Ga0070700_1001565402 | 95 |
| 103 | 3300005444 | Ga0070694_101103257 | Ga0070694_1011032572 | 95 |
| 104 | 3300005445 | Ga0070708_101234786 | Ga0070708_1012347862 | 95 |
| 105 | 3300005445 | Ga0070708_101807674 | Ga0070708_1018076741 | 95 |
| 106 | 3300005456 | Ga0070678_100662154 | Ga0070678_1006621542 | 95 |
| 107 | 3300005458 | Ga0070681_10372808 | Ga0070681_103728082 | 95 |
| 108 | 3300005458 | Ga0070681_10935539 | Ga0070681_109355392 | 95 |
| 109 | 3300005468 | Ga0070707_100846238 | Ga0070707_1008462382 | 95 |
| 110 | 3300005471 | Ga0070698_100152739 | Ga0070698_1001527394 | 95 |
| 111 | 3300005471 | Ga0070698_100751000 | Ga0070698_1007510002 | 95 |
| 112 | 3300005518 | Ga0070699_100209676 | Ga0070699_1002096762 | 95 |
| 113 | 3300005530 | Ga0070679_100262111 | Ga0070679_1002621114 | 95 |
| 114 | 3300005530 | Ga0070679_100421654 | Ga0070679_1004216541 | 95 |
| 115 | 3300005530 | Ga0070679_100557141 | Ga0070679_1005571413 | 95 |
| 116 | 3300005530 | Ga0070679_101925900 | Ga0070679_1019259002 | 95 |
| 117 | 3300005535 | Ga0070684_100213157 | Ga0070684_1002131573 | 95 |
| 118 | 3300005545 | Ga0070695_100000393 | Ga0070695_10000039311 | 95 |
| 119 | 3300005547 | Ga0070693_100130382 | Ga0070693_1001303821 | 95 |
| 120 | 3300005548 | Ga0070665_102647762 | Ga0070665_1026477622 | 95 |
| 121 | 3300005563 | Ga0068855_100454303 | Ga0068855_1004543033 | 95 |
| 122 | 3300005563 | Ga0068855_101612540 | Ga0068855_1016125402 | 95 |
| 123 | 3300005563 | Ga0068855_101637636 | Ga0068855_1016376362 | 95 |
| 124 | 3300005564 | Ga0070664_100116565 | Ga0070664_1001165653 | 95 |
| 125 | 3300005577 | Ga0068857_100622715 | Ga0068857_1006227152 | 95 |
| 126 | 3300005578 | Ga0068854_100364816 | Ga0068854_1003648162 | 95 |
| 127 | 3300005614 | Ga0068856_100878027 | Ga0068856_1008780272 | 95 |
| 128 | 3300005614 | Ga0068856_101238604 | Ga0068856_1012386042 | 95 |
| 129 | 3300005616 | Ga0068852_100159024 | Ga0068852_1001590244 | 95 |
| 130 | 3300005618 | Ga0068864_101111706 | Ga0068864_1011117062 | 95 |
| 131 | 3300005842 | Ga0068858_102546356 | Ga0068858_1025463561 | 95 |
| 132 | 3300005937 | Ga0081455_10037432 | Ga0081455_100374326 | 95 |
| 133 | 3300005981 | Ga0081538_10001113 | Ga0081538_1000111332 | 95 |
| 134 | 3300005981 | Ga0081538_10011209 | Ga0081538_100112096 | 95 |
| 135 | 3300005985 | Ga0081539_10016103 | Ga0081539_100161036 | 95 |
| 136 | 3300006028 | Ga0070717_10028548 | Ga0070717_100285484 | 95 |
| 137 | 3300006028 | Ga0070717_10124547 | Ga0070717_101245472 | 95 |
| 138 | 3300006028 | Ga0070717_10400465 | Ga0070717_104004653 | 95 |
| 139 | 3300006173 | Ga0070716_100016476 | Ga0070716_1000164761 | 95 |
| 140 | 3300006175 | Ga0070712_100122418 | Ga0070712_1001224185 | 95 |
| 141 | 3300006194 | Ga0075427_10000590 | Ga0075427_100005903 | 95 |
| 142 | 3300006844 | Ga0075428_100029322 | Ga0075428_1000293225 | 95 |
| 143 | 3300006844 | Ga0075428_100200463 | Ga0075428_1002004633 | 95 |
| 144 | 3300006846 | Ga0075430_100007745 | Ga0075430_1000077456 | 95 |
| 145 | 3300006847 | Ga0075431_100020961 | Ga0075431_1000209615 | 95 |
| 146 | 3300006847 | Ga0075431_100335778 | Ga0075431_1003357782 | 95 |
| 147 | 3300006852 | Ga0075433_10013824 | Ga0075433_100138249 | 95 |
| 148 | 3300006852 | Ga0075433_10013946 | Ga0075433_100139464 | 95 |
| 149 | 3300006871 | Ga0075434_100018664 | Ga0075434_1000186648 | 95 |
| 150 | 3300006871 | Ga0075434_100183739 | Ga0075434_1001837391 | 95 |
| 151 | 3300006880 | Ga0075429_100024384 | Ga0075429_1000243843 | 95 |
| 152 | 3300006914 | Ga0075436_100919114 | Ga0075436_1009191142 | 95 |
| 153 | 3300007076 | Ga0075435_100583535 | Ga0075435_1005835352 | 95 |
| 154 | 3300007076 | Ga0075435_101229320 | Ga0075435_1012293202 | 95 |
| 155 | 3300007076 | Ga0075435_101254532 | Ga0075435_1012545321 | 95 |
| 156 | 3300009093 | Ga0105240_10024931 | Ga0105240_100249315 | 95 |
| 157 | 3300009093 | Ga0105240_10200209 | Ga0105240_102002095 | 95 |
| 158 | 3300009093 | Ga0105240_10756032 | Ga0105240_107560322 | 95 |
| 159 | 3300009093 | Ga0105240_11104345 | Ga0105240_111043452 | 95 |
| 160 | 3300009094 | Ga0111539_10028289 | Ga0111539_100282894 | 95 |
| 161 | 3300009094 | Ga0111539_10427798 | Ga0111539_104277983 | 95 |
| 162 | 3300009098 | Ga0105245_10212951 | Ga0105245_102129513 | 95 |
| 163 | 3300009098 | Ga0105245_10264112 | Ga0105245_102641123 | 95 |
| 164 | 3300009147 | Ga0114129_10012071 | Ga0114129_1001207115 | 95 |
| 165 | 3300009147 | Ga0114129_10043881 | Ga0114129_100438812 | 95 |
| 166 | 3300009174 | Ga0105241_10923862 | Ga0105241_109238622 | 95 |
| 167 | 3300009177 | Ga0105248_10655463 | Ga0105248_106554632 | 95 |
| 168 | 3300009545 | Ga0105237_10959375 | Ga0105237_109593752 | 95 |
| 169 | 3300009545 | Ga0105237_12745622 | Ga0105237_127456222 | 95 |
| 170 | 3300009551 | Ga0105238_10189611 | Ga0105238_101896113 | 95 |
| 171 | 3300013100 | Ga0157373_10524082 | Ga0157373_105240822 | 95 |
| 172 | 3300013102 | Ga0157371_11217932 | Ga0157371_112179321 | 95 |
| 173 | 3300013102 | Ga0157371_11537898 | Ga0157371_115378982 | 95 |
| 174 | 3300013104 | Ga0157370_10016123 | Ga0157370_100161235 | 95 |
| 175 | 3300013104 | Ga0157370_10022411 | Ga0157370_100224116 | 95 |
| 176 | 3300013104 | Ga0157370_11005617 | Ga0157370_110056172 | 95 |
| 177 | 3300013104 | Ga0157370_11023825 | Ga0157370_110238252 | 95 |
| 178 | 3300013105 | Ga0157369_10255103 | Ga0157369_102551033 | 95 |
| 179 | 3300013105 | Ga0157369_10539709 | Ga0157369_105397093 | 95 |
| 180 | 3300013296 | Ga0157374_10030374 | Ga0157374_100303746 | 95 |
| 181 | 3300013307 | Ga0157372_10021043 | Ga0157372_100210435 | 95 |
| 182 | 3300013307 | Ga0157372_10276256 | Ga0157372_102762562 | 95 |
| 183 | 3300013307 | Ga0157372_11417669 | Ga0157372_114176692 | 95 |
| 184 | 3300013307 | Ga0157372_11535550 | Ga0157372_115355502 | 95 |
| 185 | 3300014325 | Ga0163163_12635275 | Ga0163163_126352751 | 95 |
| 186 | 3300014326 | Ga0157380_10198918 | Ga0157380_101989182 | 95 |
| 187 | 3300014497 | Ga0182008_10044103 | Ga0182008_100441033 | 95 |
| 188 | 3300014497 | Ga0182008_10159391 | Ga0182008_101593912 | 95 |
| 189 | 3300014745 | Ga0157377_10825116 | Ga0157377_108251162 | 95 |
| 190 | 3300014968 | Ga0157379_11140813 | Ga0157379_111408132 | 95 |
| 191 | 3300015261 | Ga0182006_1215840 | Ga0182006_12158402 | 95 |
| 192 | 3300015265 | Ga0182005_1249758 | Ga0182005_12497582 | 95 |
| 193 | 3300020070 | Ga0206356_11791757 | Ga0206356_117917573 | 95 |
| 194 | 3300020081 | Ga0206354_10534634 | Ga0206354_105346343 | 95 |
| 195 | 3300025898 | Ga0207692_10769539 | Ga0207692_107695392 | 95 |
| 196 | 3300025905 | Ga0207685_10415115 | Ga0207685_104151152 | 95 |
| 197 | 3300025906 | Ga0207699_10049801 | Ga0207699_100498012 | 95 |
| 198 | 3300025906 | Ga0207699_10050976 | Ga0207699_100509764 | 95 |
| 199 | 3300025906 | Ga0207699_10213505 | Ga0207699_102135052 | 95 |
| 200 | 3300025906 | Ga0207699_10860877 | Ga0207699_108608772 | 95 |
| 201 | 3300025909 | Ga0207705_10012826 | Ga0207705_1001282611 | 95 |
| 202 | 3300025909 | Ga0207705_10164124 | Ga0207705_101641242 | 95 |
| 203 | 3300025909 | Ga0207705_10362974 | Ga0207705_103629743 | 95 |
| 204 | 3300025912 | Ga0207707_10154079 | Ga0207707_101540791 | 95 |
| 205 | 3300025912 | Ga0207707_10657421 | Ga0207707_106574212 | 95 |
| 206 | 3300025913 | Ga0207695_10177963 | Ga0207695_101779632 | 95 |
| 207 | 3300025913 | Ga0207695_10237900 | Ga0207695_102379002 | 95 |
| 208 | 3300025914 | Ga0207671_10164564 | Ga0207671_101645644 | 95 |
| 209 | 3300025915 | Ga0207693_10000964 | Ga0207693_1000096414 | 95 |
| 210 | 3300025916 | Ga0207663_10030999 | Ga0207663_100309994 | 95 |
| 211 | 3300025917 | Ga0207660_10128139 | Ga0207660_101281393 | 95 |
| 212 | 3300025917 | Ga0207660_11185890 | Ga0207660_111858902 | 95 |
| 213 | 3300025919 | Ga0207657_10013269 | Ga0207657_100132699 | 95 |
| 214 | 3300025919 | Ga0207657_10192349 | Ga0207657_101923492 | 95 |
| 215 | 3300025919 | Ga0207657_10274661 | Ga0207657_102746613 | 95 |
| 216 | 3300025920 | Ga0207649_10139689 | Ga0207649_101396893 | 95 |
| 217 | 3300025920 | Ga0207649_10353800 | Ga0207649_103538002 | 95 |
| 218 | 3300025921 | Ga0207652_10154228 | Ga0207652_101542282 | 95 |
| 219 | 3300025921 | Ga0207652_10941014 | Ga0207652_109410142 | 95 |
| 220 | 3300025922 | Ga0207646_10424447 | Ga0207646_104244472 | 95 |
| 221 | 3300025924 | Ga0207694_10224550 | Ga0207694_102245503 | 95 |
| 222 | 3300025927 | Ga0207687_10186143 | Ga0207687_101861433 | 95 |
| 223 | 3300025927 | Ga0207687_11355093 | Ga0207687_113550932 | 95 |
| 224 | 3300025928 | Ga0207700_10008053 | Ga0207700_100080536 | 95 |
| 225 | 3300025928 | Ga0207700_10047569 | Ga0207700_100475696 | 95 |
| 226 | 3300025928 | Ga0207700_11875538 | Ga0207700_118755382 | 95 |
| 227 | 3300025929 | Ga0207664_10005790 | Ga0207664_100057906 | 95 |
| 228 | 3300025929 | Ga0207664_10077497 | Ga0207664_100774972 | 95 |
| 229 | 3300025929 | Ga0207664_10165711 | Ga0207664_101657112 | 95 |
| 230 | 3300025929 | Ga0207664_10211736 | Ga0207664_102117362 | 95 |
| 231 | 3300025929 | Ga0207664_10365407 | Ga0207664_103654072 | 95 |
| 232 | 3300025929 | Ga0207664_10473922 | Ga0207664_104739223 | 95 |
| 233 | 3300025929 | Ga0207664_10487097 | Ga0207664_104870972 | 95 |
| 234 | 3300025929 | Ga0207664_10868285 | Ga0207664_108682852 | 95 |
| 235 | 3300025931 | Ga0207644_10288647 | Ga0207644_102886471 | 95 |
| 236 | 3300025931 | Ga0207644_11008232 | Ga0207644_110082322 | 95 |
| 237 | 3300025932 | Ga0207690_10029640 | Ga0207690_100296404 | 95 |
| 238 | 3300025932 | Ga0207690_10335033 | Ga0207690_103350333 | 95 |
| 239 | 3300025937 | Ga0207669_10135749 | Ga0207669_101357492 | 95 |
| 240 | 3300025938 | Ga0207704_10148872 | Ga0207704_101488722 | 95 |
| 241 | 3300025939 | Ga0207665_10013449 | Ga0207665_100134496 | 95 |
| 242 | 3300025940 | Ga0207691_10760564 | Ga0207691_107605642 | 95 |
| 243 | 3300025941 | Ga0207711_10397713 | Ga0207711_103977131 | 95 |
| 244 | 3300025941 | Ga0207711_11341213 | Ga0207711_113412132 | 95 |
| 245 | 3300025945 | Ga0207679_10092077 | Ga0207679_100920772 | 95 |
| 246 | 3300025949 | Ga0207667_10223449 | Ga0207667_102234491 | 95 |
| 247 | 3300025949 | Ga0207667_11052084 | Ga0207667_110520842 | 95 |
| 248 | 3300026041 | Ga0207639_11469845 | Ga0207639_114698451 | 95 |
| 249 | 3300026067 | Ga0207678_10274274 | Ga0207678_102742742 | 95 |
| 250 | 3300026075 | Ga0207708_10225274 | Ga0207708_102252742 | 95 |
| 251 | 3300026078 | Ga0207702_10391668 | Ga0207702_103916682 | 95 |
| 252 | 3300026078 | Ga0207702_12341002 | Ga0207702_123410022 | 95 |
| 253 | 3300026095 | Ga0207676_11420523 | Ga0207676_114205232 | 95 |
| 254 | 3300026116 | Ga0207674_10431926 | Ga0207674_104319263 | 95 |
| 255 | 3300026121 | Ga0207683_10634836 | Ga0207683_106348362 | 95 |
| 256 | 3300026142 | Ga0207698_10067080 | Ga0207698_100670803 | 95 |
| 257 | 3300027907 | Ga0207428_10001190 | Ga0207428_1000119018 | 95 |
| 258 | 3300028556 | Ga0265337_1057367 | Ga0265337_10573673 | 95 |
| 259 | 3300028556 | Ga0265337_1063791 | Ga0265337_10637912 | 95 |
| 260 | 3300028556 | Ga0265337_1093821 | Ga0265337_10938212 | 95 |
| 261 | 3300028558 | Ga0265326_10022511 | Ga0265326_100225111 | 95 |
| 262 | 3300028563 | Ga0265319_1002310 | Ga0265319_10023106 | 95 |
| 263 | 3300028563 | Ga0265319_1002945 | Ga0265319_10029457 | 95 |
| 264 | 3300028563 | Ga0265319_1054326 | Ga0265319_10543263 | 95 |
| 265 | 3300028573 | Ga0265334_10009809 | Ga0265334_100098095 | 95 |
| 266 | 3300028573 | Ga0265334_10158113 | Ga0265334_101581132 | 95 |
| 267 | 3300028577 | Ga0265318_10002950 | Ga0265318_100029505 | 95 |
| 268 | 3300028577 | Ga0265318_10010568 | Ga0265318_100105685 | 95 |
| 269 | 3300028653 | Ga0265323_10146950 | Ga0265323_101469502 | 95 |
| 270 | 3300028654 | Ga0265322_10009592 | Ga0265322_100095923 | 95 |
| 271 | 3300028654 | Ga0265322_10080691 | Ga0265322_100806913 | 95 |
| 272 | 3300028666 | Ga0265336_10001570 | Ga0265336_1000157011 | 95 |
| 273 | 3300028666 | Ga0265336_10022541 | Ga0265336_100225412 | 95 |
| 274 | 3300028666 | Ga0265336_10041327 | Ga0265336_100413272 | 95 |
| 275 | 3300028800 | Ga0265338_10004508 | Ga0265338_1000450819 | 95 |
| 276 | 3300028800 | Ga0265338_10016515 | Ga0265338_1001651512 | 95 |
| 277 | 3300028800 | Ga0265338_10016873 | Ga0265338_1001687310 | 95 |
| 278 | 3300028800 | Ga0265338_10021437 | Ga0265338_100214377 | 95 |
| 279 | 3300028800 | Ga0265338_10021638 | Ga0265338_100216383 | 95 |
| 280 | 3300028800 | Ga0265338_10026870 | Ga0265338_100268706 | 95 |
| 281 | 3300028800 | Ga0265338_10045918 | Ga0265338_100459186 | 95 |
| 282 | 3300028800 | Ga0265338_10059124 | Ga0265338_100591243 | 95 |
| 283 | 3300029957 | Ga0265324_10011282 | Ga0265324_100112824 | 95 |
| 284 | 3300029957 | Ga0265324_10277865 | Ga0265324_102778652 | 95 |
| 285 | 3300031235 | Ga0265330_10028516 | Ga0265330_100285162 | 95 |
| 286 | 3300031235 | Ga0265330_10029044 | Ga0265330_100290443 | 95 |
| 287 | 3300031238 | Ga0265332_10014621 | Ga0265332_100146212 | 95 |
| 288 | 3300031238 | Ga0265332_10018345 | Ga0265332_100183453 | 95 |
| 289 | 3300031238 | Ga0265332_10407797 | Ga0265332_104077972 | 95 |
| 290 | 3300031238 | Ga0265332_10486575 | Ga0265332_104865751 | 95 |
| 291 | 3300031239 | Ga0265328_10032438 | Ga0265328_100324382 | 95 |
| 292 | 3300031240 | Ga0265320_10026485 | Ga0265320_100264853 | 95 |
| 293 | 3300031240 | Ga0265320_10064391 | Ga0265320_100643913 | 95 |
| 294 | 3300031241 | Ga0265325_10000453 | Ga0265325_1000045326 | 95 |
| 295 | 3300031242 | Ga0265329_10004254 | Ga0265329_100042547 | 95 |
| 296 | 3300031242 | Ga0265329_10104851 | Ga0265329_101048513 | 95 |
| 297 | 3300031247 | Ga0265340_10003413 | Ga0265340_1000341310 | 95 |
| 298 | 3300031247 | Ga0265340_10037720 | Ga0265340_100377202 | 95 |
| 299 | 3300031249 | Ga0265339_10005781 | Ga0265339_100057815 | 95 |
| 300 | 3300031249 | Ga0265339_10031744 | Ga0265339_100317444 | 95 |
| 301 | 3300031249 | Ga0265339_10036063 | Ga0265339_100360633 | 95 |
| 302 | 3300031249 | Ga0265339_10044507 | Ga0265339_100445074 | 95 |
| 303 | 3300031250 | Ga0265331_10012453 | Ga0265331_100124533 | 95 |
| 304 | 3300031250 | Ga0265331_10030466 | Ga0265331_100304664 | 95 |
| 305 | 3300031250 | Ga0265331_10045650 | Ga0265331_100456502 | 95 |
| 306 | 3300031251 | Ga0265327_10010269 | Ga0265327_100102697 | 95 |
| 307 | 3300031251 | Ga0265327_10012478 | Ga0265327_100124787 | 95 |
| 308 | 3300031251 | Ga0265327_10032624 | Ga0265327_100326244 | 95 |
| 309 | 3300031251 | Ga0265327_10121724 | Ga0265327_101217242 | 95 |
| 310 | 3300031344 | Ga0265316_10033792 | Ga0265316_100337922 | 95 |
| 311 | 3300031344 | Ga0265316_10052875 | Ga0265316_100528755 | 95 |
| 312 | 3300031344 | Ga0265316_10455245 | Ga0265316_104552452 | 95 |
| 313 | 3300031595 | Ga0265313_10025257 | Ga0265313_100252575 | 95 |
| 314 | 3300031595 | Ga0265313_10043563 | Ga0265313_100435632 | 95 |
| 315 | 3300031595 | Ga0265313_10049938 | Ga0265313_100499382 | 95 |
| 316 | 3300031711 | Ga0265314_10002833 | Ga0265314_100028332 | 95 |
| 317 | 3300031711 | Ga0265314_10022158 | Ga0265314_100221584 | 95 |
| 318 | 3300031712 | Ga0265342_10002319 | Ga0265342_100023194 | 95 |
| 319 | 3300031712 | Ga0265342_10030763 | Ga0265342_100307636 | 95 |
| 320 | 3300031731 | Ga0307405_10020909 | Ga0307405_100209095 | 95 |
| 321 | 3300031824 | Ga0307413_10203025 | Ga0307413_102030251 | 95 |
| 322 | 3300031824 | Ga0307413_10302607 | Ga0307413_103026072 | 95 |
| 323 | 3300031852 | Ga0307410_10239301 | Ga0307410_102393012 | 95 |
| 324 | 3300031852 | Ga0307410_10736049 | Ga0307410_107360492 | 95 |
| 325 | 3300031852 | Ga0307410_10751081 | Ga0307410_107510812 | 95 |
| 326 | 3300031901 | Ga0307406_10057377 | Ga0307406_100573773 | 95 |
| 327 | 3300031901 | Ga0307406_10256491 | Ga0307406_102564912 | 95 |
| 328 | 3300031901 | Ga0307406_12000520 | Ga0307406_120005201 | 95 |
| 329 | 3300031903 | Ga0307407_10011507 | Ga0307407_100115072 | 95 |
| 330 | 3300031903 | Ga0307407_10267836 | Ga0307407_102678362 | 95 |
| 331 | 3300031911 | Ga0307412_10209278 | Ga0307412_102092782 | 95 |
| 332 | 3300031995 | Ga0307409_100082779 | Ga0307409_1000827792 | 95 |
| 333 | 3300031995 | Ga0307409_100376968 | Ga0307409_1003769682 | 95 |
| 334 | 3300032002 | Ga0307416_100000306 | Ga0307416_1000003063 | 95 |
| 335 | 3300032002 | Ga0307416_100065882 | Ga0307416_1000658824 | 95 |
| 336 | 3300032002 | Ga0307416_100100885 | Ga0307416_1001008851 | 95 |
| 337 | 3300032002 | Ga0307416_100844102 | Ga0307416_1008441022 | 95 |
| 338 | 3300032002 | Ga0307416_102613189 | Ga0307416_1026131891 | 95 |
| 339 | 3300032004 | Ga0307414_10503769 | Ga0307414_105037692 | 95 |
| 340 | 3300032004 | Ga0307414_11347049 | Ga0307414_113470492 | 95 |
| 341 | 3300032005 | Ga0307411_10030410 | Ga0307411_100304102 | 95 |
| 342 | 3300032126 | Ga0307415_100000930 | Ga0307415_10000093015 | 95 |
| 343 | 3300032126 | Ga0307415_100062175 | Ga0307415_1000621754 | 95 |
| 344 | 3300032126 | Ga0307415_100158116 | Ga0307415_1001581162 | 95 |
| 345 | 3300032126 | Ga0307415_100513206 | Ga0307415_1005132063 | 95 |
| 346 | 3300032126 | Ga0307415_100697687 | Ga0307415_1006976872 | 95 |
| 347 | 3300035086 | Ga0373934_0089974 | Ga0373934_0089974_848_1135 | 95 |
| 348 | 3300035091 | Ga0373951_0035178 | Ga0373951_0035178_217_504 | 95 |
| 349 | 3300035114 | Ga0373939_0149791 | Ga0373939_0149791_144_431 | 95 |
| 350 | 3300035118 | Ga0373954_0066752 | Ga0373954_0066752_648_935 | 95 |
| 351 | 3300035120 | Ga0373957_0361873 | Ga0373957_0361873_54_341 | 95 |
| 352 | 3300035172 | Ga0373955_0148769 | Ga0373955_0148769_593_880 | 95 |
| 353 | 3300035410 | Ga0373924_0255472 | Ga0373924_0255472_162_449 | 95 |
| 354 | 3300036401 | Ga0373937_0184320 | Ga0373937_0184320_41_328 | 95 |
| 355 | 3300036401 | Ga0373937_0455363 | Ga0373937_0455363_339_626 | 95 |
| 356 | 3300037312 | Ga0395899_0040170 | Ga0395899_0040170_1575_1862 | 95 |
| 357 | 3300037312 | Ga0395899_0450104 | Ga0395899_0450104_526_816 | 95 |
| 358 | 3300037418 | Ga0395900_0178615 | Ga0395900_0178615_358_645 | 95 |
| 359 | 3300037418 | Ga0395900_0276795 | Ga0395900_0276795_183_473 | 95 |
| 360 | 3300037418 | Ga0395900_0849191 | Ga0395900_0849191_220_516 | 95 |
| 361 | 3300037418 | Ga0395900_0883116 | Ga0395900_0883116_295_585 | 95 |
| 362 | 3300037418 | Ga0395900_1656174 | Ga0395900_1656174_114_404 | 95 |
| 363 | 3300037466 | Ga0395898_0075428 | Ga0395898_0075428_154_462 | 95 |
| 364 | 3300037466 | Ga0395898_0153315 | Ga0395898_0153315_1282_1572 | 95 |
| 365 | 3300037466 | Ga0395898_0338849 | Ga0395898_0338849_27_317 | 95 |
| 366 | 3300037466 | Ga0395898_0351996 | Ga0395898_0351996_556_843 | 95 |
| 367 | 3300037466 | Ga0395898_1226098 | Ga0395898_1226098_46_342 | 95 |
| 368 | 3300037466 | Ga0395898_1373564 | Ga0395898_1373564_319_609 | 95 |
| 369 | 3300037471 | Ga0395905_0150706 | Ga0395905_0150706_583_870 | 95 |
| 370 | 3300037471 | Ga0395905_0344112 | Ga0395905_0344112_234_542 | 95 |
| 371 | 3300038443 | Ga0395901_0252028 | Ga0395901_0252028_1174_1464 | 95 |
| 372 | 3300038443 | Ga0395901_0269636 | Ga0395901_0269636_952_1242 | 95 |
| 373 | 3300038443 | Ga0395901_0590990 | Ga0395901_0590990_192_482 | 95 |
| 374 | 3300038443 | Ga0395901_0730722 | Ga0395901_0730722_273_569 | 95 |
| 375 | 3300038443 | Ga0395901_1304902 | Ga0395901_1304902_369_656 | 95 |
| 376 | 3300039450 | Ga0436363_0839180 | Ga0436363_0839180_262_549 | 95 |
| 377 | 3300042005 | Ga0439448_0030869 | Ga0439448_0030869_1190_1492 | 95 |
| 378 | 3300042118 | Ga0450914_046087 | Ga0450914_046087_175_477 | 95 |
| 379 | 3300042157 | Ga0439458_0074899 | Ga0439458_0074899_364_654 | 95 |
| 380 | 3300042993 | Ga0439440_0020634 | Ga0439440_0020634_831_1133 | 95 |
| 381 | 3300042993 | Ga0439440_0104752 | Ga0439440_0104752_396_686 | 95 |
| 382 | 3300042993 | Ga0439440_0153640 | Ga0439440_0153640_221_511 | 95 |
| 383 | 3300044656 | Ga0466969_0041058 | Ga0466969_0041058_480_779 | 95 |
| 384 | 3300044658 | Ga0466972_0207411 | Ga0466972_0207411_455_754 | 95 |
| 385 | 3300044684 | Ga0466966_0036173 | Ga0466966_0036173_1306_1605 | 95 |
| 386 | 3300044693 | Ga0466961_0140424 | Ga0466961_0140424_111_410 | 95 |
| 387 | 3300044693 | Ga0466961_0177989 | Ga0466961_0177989_592_891 | 95 |
| 388 | 3300044694 | Ga0466963_0004956 | Ga0466963_0004956_2166_2465 | 95 |
| 389 | 3300044694 | Ga0466963_0008918 | Ga0466963_0008918_3390_3689 | 95 |
| 390 | 3300044694 | Ga0466963_0014973 | Ga0466963_0014973_173_472 | 95 |
| 391 | 3300044694 | Ga0466963_0064071 | Ga0466963_0064071_1726_2025 | 95 |
| 392 | 3300044694 | Ga0466963_0088074 | Ga0466963_0088074_1774_2073 | 95 |
| 393 | 3300044694 | Ga0466963_0169355 | Ga0466963_0169355_662_961 | 95 |
| 394 | 3300044694 | Ga0466963_0314891 | Ga0466963_0314891_753_1043 | 95 |
| 395 | 3300044694 | Ga0466963_0749912 | Ga0466963_0749912_311_598 | 95 |
| 396 | 3300044694 | Ga0466963_0874936 | Ga0466963_0874936_162_452 | 95 |
| 397 | 3300044694 | Ga0466963_0919930 | Ga0466963_0919930_159_449 | 95 |
| 398 | 3300044694 | Ga0466963_1337025 | Ga0466963_1337025_52_342 | 95 |
| 399 | 3300044706 | Ga0466964_0001680 | Ga0466964_0001680_6254_6553 | 95 |
| 400 | 3300044706 | Ga0466964_0001976 | Ga0466964_0001976_4677_4976 | 95 |
| 401 | 3300044706 | Ga0466964_0069379 | Ga0466964_0069379_18_317 | 95 |
| 402 | 3300044706 | Ga0466964_0306683 | Ga0466964_0306683_368_667 | 95 |
| 403 | 3300044719 | Ga0466971_0004164 | Ga0466971_0004164_3094_3393 | 95 |
| 404 | 3300044719 | Ga0466971_0063093 | Ga0466971_0063093_1104_1403 | 95 |
| 405 | 3300044719 | Ga0466971_0099539 | Ga0466971_0099539_486_785 | 95 |
| 406 | 3300044719 | Ga0466971_0127653 | Ga0466971_0127653_92_382 | 95 |
| 407 | 3300044719 | Ga0466971_0144444 | Ga0466971_0144444_789_1076 | 95 |
| 408 | 3300044719 | Ga0466971_0204630 | Ga0466971_0204630_131_430 | 95 |
| 409 | 3300044735 | Ga0466968_0001841 | Ga0466968_0001841_5164_5463 | 95 |
| 410 | 3300044735 | Ga0466968_0036892 | Ga0466968_0036892_746_1045 | 95 |
| 411 | 3300044735 | Ga0466968_0061994 | Ga0466968_0061994_720_1019 | 95 |
| 412 | 3300044735 | Ga0466968_0091241 | Ga0466968_0091241_319_609 | 95 |
| 413 | 3300044735 | Ga0466968_0353674 | Ga0466968_0353674_121_411 | 95 |
| 414 | 3300044765 | Ga0466970_0055263 | Ga0466970_0055263_172_471 | 95 |
| 415 | 3300044765 | Ga0466970_0228513 | Ga0466970_0228513_447_746 | 95 |
| 416 | 3300044842 | Ga0466957_0000839 | Ga0466957_0000839_1727_2026 | 95 |
| 417 | 3300044842 | Ga0466957_0005602 | Ga0466957_0005602_66_365 | 95 |
| 418 | 3300044842 | Ga0466957_0011876 | Ga0466957_0011876_4698_4997 | 95 |
| 419 | 3300044842 | Ga0466957_0014602 | Ga0466957_0014602_4238_4537 | 95 |
| 420 | 3300044842 | Ga0466957_0055290 | Ga0466957_0055290_1975_2262 | 95 |
| 421 | 3300044842 | Ga0466957_0363862 | Ga0466957_0363862_249_548 | 95 |
| 422 | 3300044842 | Ga0466957_0537836 | Ga0466957_0537836_54_395 | 95 |
| 423 | 3300044842 | Ga0466957_0945702 | Ga0466957_0945702_75_365 | 95 |
| 424 | 3300045049 | Ga0466959_0002503 | Ga0466959_0002503_8850_9149 | 95 |
| 425 | 3300045049 | Ga0466959_0133999 | Ga0466959_0133999_1001_1300 | 95 |
| 426 | 3300045049 | Ga0466959_0260048 | Ga0466959_0260048_535_825 | 95 |
| 427 | 3300045049 | Ga0466959_0543850 | Ga0466959_0543850_105_404 | 95 |
| 428 | 3300045836 | Ga0466958_0001766 | Ga0466958_0001766_8652_8951 | 95 |
| 429 | 3300045836 | Ga0466958_0004935 | Ga0466958_0004935_2621_2920 | 95 |
| 430 | 3300045836 | Ga0466958_0028945 | Ga0466958_0028945_945_1244 | 95 |
| 431 | 3300045836 | Ga0466958_0165325 | Ga0466958_0165325_261_560 | 95 |
| 432 | 3300045836 | Ga0466958_0326668 | Ga0466958_0326668_31_321 | 95 |
| 433 | 3300045836 | Ga0466958_0439240 | Ga0466958_0439240_134_421 | 95 |
| 434 | 3300045976 | Ga0466967_0005346 | Ga0466967_0005346_6909_7208 | 95 |
| 435 | 3300045976 | Ga0466967_0006620 | Ga0466967_0006620_4152_4451 | 95 |
| 436 | 3300045976 | Ga0466967_0008127 | Ga0466967_0008127_62_361 | 95 |
| 437 | 3300045976 | Ga0466967_0009557 | Ga0466967_0009557_2576_2863 | 95 |
| 438 | 3300045976 | Ga0466967_0034363 | Ga0466967_0034363_2984_3325 | 95 |
| 439 | 3300045976 | Ga0466967_0074693 | Ga0466967_0074693_1527_1826 | 95 |
| 440 | 3300045976 | Ga0466967_0091170 | Ga0466967_0091170_2305_2604 | 95 |
| 441 | 3300045976 | Ga0466967_0112223 | Ga0466967_0112223_1788_2075 | 95 |
| 442 | 3300045976 | Ga0466967_0129314 | Ga0466967_0129314_1282_1572 | 95 |
| 443 | 3300045976 | Ga0466967_0173973 | Ga0466967_0173973_1504_1794 | 95 |
| 444 | 3300045976 | Ga0466967_0192421 | Ga0466967_0192421_678_968 | 95 |
| 445 | 3300045976 | Ga0466967_0197028 | Ga0466967_0197028_1028_1315 | 95 |
| 446 | 3300045976 | Ga0466967_0317509 | Ga0466967_0317509_194_484 | 95 |
| 447 | 3300045976 | Ga0466967_0406344 | Ga0466967_0406344_736_1035 | 95 |
| 448 | 3300045976 | Ga0466967_1268203 | Ga0466967_1268203_98_388 | 95 |
| 449 | 3300045976 | Ga0466967_1312219 | Ga0466967_1312219_299_589 | 95 |
| 450 | 3300045976 | Ga0466967_1365879 | Ga0466967_1365879_252_545 | 95 |
| 451 | 3300045976 | Ga0466967_2054956 | Ga0466967_2054956_108_395 | 95 |
| 452 | 3300046454 | Ga0495592_0112615 | Ga0495592_0112615_186_485 | 95 |
| 453 | 3300046462 | Ga0495651_0121844 | Ga0495651_0121844_1356_1643 | 95 |
| 454 | 3300046463 | Ga0495653_0364669 | Ga0495653_0364669_500_787 | 95 |
| 455 | 3300046473 | Ga0495582_0708626 | Ga0495582_0708626_92_391 | 95 |
| 456 | 3300046511 | Ga0495608_0047598 | Ga0495608_0047598_515_802 | 95 |
| 457 | 3300046511 | Ga0495608_0929760 | Ga0495608_0929760_102_389 | 95 |
| 458 | 3300046514 | Ga0495618_0045317 | Ga0495618_0045317_1626_1937 | 95 |
| 459 | 3300046514 | Ga0495618_0576770 | Ga0495618_0576770_166_453 | 95 |
| 460 | 3300046516 | Ga0495628_0307212 | Ga0495628_0307212_501_788 | 95 |
| 461 | 3300046517 | Ga0495630_0167052 | Ga0495630_0167052_925_1224 | 95 |
| 462 | 3300046517 | Ga0495630_0529115 | Ga0495630_0529115_298_585 | 95 |
| 463 | 3300046517 | Ga0495630_0709201 | Ga0495630_0709201_37_324 | 95 |
| 464 | 3300046533 | Ga0495640_0016020 | Ga0495640_0016020_3476_3787 | 95 |
| 465 | 3300046543 | Ga0495645_0451700 | Ga0495645_0451700_458_745 | 95 |
| 466 | 3300046559 | Ga0495667_0306847 | Ga0495667_0306847_255_542 | 95 |
| 467 | 3300046642 | Ga0495634_0056266 | Ga0495634_0056266_695_1006 | 95 |
| 468 | 3300046642 | Ga0495634_0201502 | Ga0495634_0201502_119_406 | 95 |
| 469 | 3300046663 | Ga0495635_0013904 | Ga0495635_0013904_4604_4915 | 95 |
| 470 | 3300046663 | Ga0495635_0062502 | Ga0495635_0062502_134_421 | 95 |
| 471 | 3300046663 | Ga0495635_0351977 | Ga0495635_0351977_361_648 | 95 |
| 472 | 3300046675 | Ga0495657_0129175 | Ga0495657_0129175_1015_1302 | 95 |
| 473 | 3300046675 | Ga0495657_0549142 | Ga0495657_0549142_278_577 | 95 |
| 474 | 3300046675 | Ga0495657_0892697 | Ga0495657_0892697_207_494 | 95 |
| 475 | 3300046680 | Ga0495646_0301132 | Ga0495646_0301132_367_678 | 95 |
| 476 | 3300046689 | Ga0495613_0394405 | Ga0495613_0394405_223_510 | 95 |
| 477 | 3300046689 | Ga0495613_0750231 | Ga0495613_0750231_318_605 | 95 |
| 478 | 3300047317 | Ga0495604_0169862 | Ga0495604_0169862_1028_1315 | 95 |
| 479 | 3300047318 | Ga0495636_0366278 | Ga0495636_0366278_181_468 | 95 |
| 480 | 3300047319 | Ga0495674_0090385 | Ga0495674_0090385_1985_2296 | 95 |
| 481 | 3300047319 | Ga0495674_0770242 | Ga0495674_0770242_207_518 | 95 |
| 482 | 3300047322 | Ga0495680_0839345 | Ga0495680_0839345_27_314 | 95 |
| 483 | 3300047322 | Ga0495680_1060270 | Ga0495680_1060270_146_433 | 95 |
| 484 | 3300047322 | Ga0495680_1083873 | Ga0495680_1083873_165_452 | 95 |
| 485 | 3300047444 | Ga0495675_0306137 | Ga0495675_0306137_600_887 | 95 |
| 486 | 3300047471 | Ga0495684_0097766 | Ga0495684_0097766_1798_2097 | 95 |
| 487 | 3300047471 | Ga0495684_0103387 | Ga0495684_0103387_799_1086 | 95 |
| 488 | 3300047471 | Ga0495684_0285790 | Ga0495684_0285790_164_475 | 95 |
| 489 | 3300048088 | Ga0495602_0777455 | Ga0495602_0777455_230_529 | 95 |
| 490 | 3300048088 | Ga0495602_1088199 | Ga0495602_1088199_54_341 | 95 |
| 491 | 3300048903 | Ga0496100_0012368 | Ga0496100_0012368_1238_1525 | 95 |
| 492 | 3300048905 | Ga0496102_0032716 | Ga0496102_0032716_2207_2494 | 95 |
| 493 | 3300048905 | Ga0496102_0236273 | Ga0496102_0236273_845_1144 | 95 |
| 494 | 3300048906 | Ga0496103_0019776 | Ga0496103_0019776_1740_2039 | 95 |
| 495 | 3300048906 | Ga0496103_0077535 | Ga0496103_0077535_220_507 | 95 |
| 496 | 3300048907 | Ga0496104_0497929 | Ga0496104_0497929_736_1023 | 95 |
| 497 | 3300048908 | Ga0496105_0057053 | Ga0496105_0057053_146_433 | 95 |
| 498 | 3300048909 | Ga0496106_0030374 | Ga0496106_0030374_2285_2572 | 95 |
| 499 | 3300048910 | Ga0496107_0059855 | Ga0496107_0059855_1459_1746 | 95 |
| 500 | 3300048911 | Ga0496108_0031623 | Ga0496108_0031623_2786_3073 | 95 |
| 501 | 3300048912 | Ga0496109_0053696 | Ga0496109_0053696_1232_1519 | 95 |
| 502 | 3300048913 | Ga0496110_0038024 | Ga0496110_0038024_2543_2830 | 95 |
| 503 | 3300048913 | Ga0496110_0485280 | Ga0496110_0485280_337_636 | 95 |
| 504 | 3300048914 | Ga0496111_0021414 | Ga0496111_0021414_2199_2486 | 95 |
| 505 | 3300048914 | Ga0496111_0700314 | Ga0496111_0700314_14_301 | 95 |
| 506 | 3300048915 | Ga0496112_0047465 | Ga0496112_0047465_205_492 | 95 |
| 507 | 3300048915 | Ga0496112_0068960 | Ga0496112_0068960_601_900 | 95 |
| 508 | 3300048915 | Ga0496112_0102958 | Ga0496112_0102958_1221_1520 | 95 |
| 509 | 3300048915 | Ga0496112_0472137 | Ga0496112_0472137_18_305 | 95 |
| 510 | 3300048915 | Ga0496112_0757643 | Ga0496112_0757643_486_773 | 95 |
| 511 | 3300048916 | Ga0496113_0040740 | Ga0496113_0040740_2003_2290 | 95 |
| 512 | 3300048916 | Ga0496113_0304233 | Ga0496113_0304233_417_710 | 95 |
| 513 | 3300048916 | Ga0496113_0802609 | Ga0496113_0802609_22_321 | 95 |
| 514 | 3300048916 | Ga0496113_0955262 | Ga0496113_0955262_127_426 | 95 |
| 515 | 3300048917 | Ga0496114_0068218 | Ga0496114_0068218_130_417 | 95 |
| 516 | 3300048918 | Ga0496115_0096138 | Ga0496115_0096138_1071_1370 | 95 |
| 517 | 3300049568 | Ga0501031_0001219 | Ga0501031_0001219_4178_4477 | 95 |
| 518 | 3300049569 | Ga0501032_0136844 | Ga0501032_0136844_1009_1308 | 95 |
| 519 | 3300049570 | Ga0501033_0013698 | Ga0501033_0013698_1825_2124 | 95 |
| 520 | 3300049571 | Ga0501034_0004154 | Ga0501034_0004154_3931_4218 | 95 |
| 521 | 3300049571 | Ga0501034_1029845 | Ga0501034_1029845_337_636 | 95 |
| 522 | 3300049572 | Ga0501036_0001012 | Ga0501036_0001012_4179_4478 | 95 |
| 523 | 3300049573 | Ga0501037_0118841 | Ga0501037_0118841_1102_1401 | 95 |
| 524 | 3300049574 | Ga0501038_0131989 | Ga0501038_0131989_403_702 | 95 |
| 525 | 3300049575 | Ga0501039_0000777 | Ga0501039_0000777_11253_11552 | 95 |
| 526 | 3300049576 | Ga0501040_0000970 | Ga0501040_0000970_1889_2188 | 95 |
| 527 | 3300049577 | Ga0501041_0000521 | Ga0501041_0000521_8168_8467 | 95 |
| 528 | 3300049578 | Ga0501042_0000384 | Ga0501042_0000384_12480_12779 | 95 |
| 529 | 3300049579 | Ga0501043_0005685 | Ga0501043_0005685_2952_3251 | 95 |
| 530 | 3300049580 | Ga0501046_0005314 | Ga0501046_0005314_9674_9973 | 95 |
| 531 | 3300049582 | Ga0501048_0000488 | Ga0501048_0000488_15997_16296 | 95 |
| 532 | 3300049583 | Ga0501067_0076281 | Ga0501067_0076281_880_1167 | 95 |
| 533 | 3300049583 | Ga0501067_0106131 | Ga0501067_0106131_348_635 | 95 |
| 534 | 3300049583 | Ga0501067_0156485 | Ga0501067_0156485_79_378 | 95 |
| 535 | 3300049583 | Ga0501067_0841133 | Ga0501067_0841133_67_357 | 95 |
| 536 | 3300049584 | Ga0501068_0081940 | Ga0501068_0081940_1085_1384 | 95 |
| 537 | 3300049585 | Ga0501069_0029782 | Ga0501069_0029782_1746_2033 | 95 |
| 538 | 3300049585 | Ga0501069_0314783 | Ga0501069_0314783_213_500 | 95 |
| 539 | 3300049586 | Ga0501070_0005070 | Ga0501070_0005070_10799_11086 | 95 |
| 540 | 3300049586 | Ga0501070_0050585 | Ga0501070_0050585_606_896 | 95 |
| 541 | 3300049586 | Ga0501070_0507919 | Ga0501070_0507919_89_388 | 95 |
| 542 | 3300049587 | Ga0501071_0001049 | Ga0501071_0001049_4636_4935 | 95 |
| 543 | 3300049588 | Ga0501072_0002834 | Ga0501072_0002834_10420_10719 | 95 |
| 544 | 3300049588 | Ga0501072_0015504 | Ga0501072_0015504_1039_1329 | 95 |
| 545 | 3300049589 | Ga0501073_0115410 | Ga0501073_0115410_1001_1300 | 95 |
| 546 | 3300049589 | Ga0501073_0242548 | Ga0501073_0242548_602_892 | 95 |
| 547 | 3300049590 | Ga0501074_0001561 | Ga0501074_0001561_11345_11644 | 95 |
| 548 | 3300049590 | Ga0501074_0010895 | Ga0501074_0010895_740_1027 | 95 |
| 549 | 3300049590 | Ga0501074_0029258 | Ga0501074_0029258_1070_1360 | 95 |
| 550 | 3300049591 | Ga0501075_0007067 | Ga0501075_0007067_1927_2226 | 95 |
| 551 | 3300049592 | Ga0501076_0000670 | Ga0501076_0000670_11403_11702 | 95 |
| 552 | 3300049593 | Ga0501077_0000979 | Ga0501077_0000979_7249_7548 | 95 |
| 553 | 3300049741 | Ga0501079_0000766 | Ga0501079_0000766_10375_10674 | 95 |
| 554 | 3300049741 | Ga0501079_0094604 | Ga0501079_0094604_1865_2155 | 95 |
| 555 | 3300049742 | Ga0501080_0002096 | Ga0501080_0002096_8428_8715 | 95 |
| 556 | 3300049742 | Ga0501080_0004391 | Ga0501080_0004391_10318_10617 | 95 |
| 557 | 3300049742 | Ga0501080_0065727 | Ga0501080_0065727_26_316 | 95 |
| 558 | 3300049743 | Ga0501081_0000421 | Ga0501081_0000421_9865_10164 | 95 |
| 559 | 3300049744 | Ga0501083_0009464 | Ga0501083_0009464_3226_3516 | 95 |
| 560 | 3300049744 | Ga0501083_0032395 | Ga0501083_0032395_2076_2375 | 95 |
| 561 | 3300049822 | Ga0501035_0009537 | Ga0501035_0009537_7059_7358 | 95 |
| 562 | 3300049823 | Ga0501044_0174414 | Ga0501044_0174414_845_1144 | 95 |
| 563 | 3300049823 | Ga0501044_0608092 | Ga0501044_0608092_526_813 | 95 |
| 564 | 3300049824 | Ga0501045_0001105 | Ga0501045_0001105_15664_15963 | 95 |
| 565 | 3300050507 | nmdc:mga05p37_19132_c1 | nmdc:mga05p37_19132_c1_6559_6849 | 95 |
| 566 | 3300050507 | nmdc:mga05p37_56249_c1 | nmdc:mga05p37_56249_c1_1724_2014 | 95 |
| 567 | 3300050508 | nmdc:mga09592_32597_c1 | nmdc:mga09592_32597_c1_749_1039 | 95 |
| 568 | 3300050509 | nmdc:mga0qj67_6104_c1 | nmdc:mga0qj67_6104_c1_6945_7235 | 95 |
| 569 | 3300050510 | nmdc:mga06r32_473678_c1 | nmdc:mga06r32_473678_c1_804_1091 | 95 |
| 570 | 3300050510 | nmdc:mga06r32_571254_c1 | nmdc:mga06r32_571254_c1_621_911 | 95 |
| 571 | 3300050510 | nmdc:mga06r32_7228_c1 | nmdc:mga06r32_7228_c1_6324_6614 | 95 |
| 572 | 3300050511 | nmdc:mga08y16_493_c1 | nmdc:mga08y16_493_c1_2889_3179 | 95 |
| 573 | 3300050512 | nmdc:mga0n895_13975_c1 | nmdc:mga0n895_13975_c1_1875_2165 | 95 |
| 574 | 3300050512 | nmdc:mga0n895_511440_c1 | nmdc:mga0n895_511440_c1_814_1119 | 95 |
| 575 | 3300050512 | nmdc:mga0n895_89825_c1 | nmdc:mga0n895_89825_c1_2018_2308 | 95 |
| 576 | 3300050513 | nmdc:mga0rr50_100538_c1 | nmdc:mga0rr50_100538_c1_1654_1944 | 95 |
| 577 | 3300050513 | nmdc:mga0rr50_1297854_c1 | nmdc:mga0rr50_1297854_c1_281_571 | 95 |
| 578 | 3300050515 | nmdc:mga0a205_44534_c3 | nmdc:mga0a205_44534_c3_278_568 | 95 |
| 579 | 3300050515 | nmdc:mga0a205_6411_c1 | nmdc:mga0a205_6411_c1_6884_7174 | 95 |
| 580 | 3300053077 | Ga0495601_0159394 | Ga0495601_0159394_716_1027 | 95 |
| 581 | 3300053077 | Ga0495601_0247133 | Ga0495601_0247133_670_969 | 95 |
| 582 | 3300053084 | Ga0495595_0364801 | Ga0495595_0364801_105_392 | 95 |
| 583 | 3300053085 | Ga0495619_0089025 | Ga0495619_0089025_1401_1688 | 95 |
| 584 | 3300053094 | Ga0500566_0253153 | Ga0500566_0253153_236_535 | 95 |
| 585 | 3300054114 | Ga0501084_0000718 | Ga0501084_0000718_9674_9973 | 95 |
| 586 | 3300060353 | Ga0501082_0004632 | Ga0501082_0004632_9616_9915 | 95 |
| 587 | 3300060353 | Ga0501082_0098702 | Ga0501082_0098702_1450_1740 | 95 |
| 588 | 3300061719 | Ga0466962_0110085 | Ga0466962_0110085_356_655 | 95 |
| 589 | 3300061719 | Ga0466962_0143216 | Ga0466962_0143216_30_329 | 95 |
| 590 | 3300061719 | Ga0466962_0178183 | Ga0466962_0178183_471_770 | 95 |
| 591 | 3300061719 | Ga0466962_0534266 | Ga0466962_0534266_65_364 | 95 |
| 592 | 3300061734 | Ga0530510_0000732 | Ga0530510_0000732_9633_9932 | 95 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fiu-assembly1.cif.gz_B | crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens | 0.9344 | 2 | 95 |
| 3lo3-assembly2.cif.gz_C | the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. | 0.9318 | 2 | 93 |
| 2fiu-assembly1.cif.gz_B | crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens | 0.9068 | 2 | 95 |
| 3lo3-assembly2.cif.gz_C | the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. | 0.8946 | 2 | 93 |
| 3dca-assembly2.cif.gz_D | crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target | 0.7795 | 2 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fiuB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8934 | 1 | 94 | 3.30.70.100 |
| 2fiuB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8845 | 1 | 94 | 3.30.70.100 |
| 3lo3U00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8626 | 1 | 90 | 3.30.70.100 |
| 3lo3U00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8286 | 1 | 90 | 3.30.70.100 |
| 1si9C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.728 | 2 | 92 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U9SCK0-F1-model_v4 | DUF1330 domain-containing protein | 0.9963 | 1 | 95 |
|
| AF-A0A2S2CR32-F1-model_v4 | DUF1330 domain-containing protein | 0.9947 | 1 | 95 |
|
| AF-A0A1A3SNH3-F1-model_v4 | DUF1330 domain-containing protein | 0.9931 | 2 | 95 |
|
| AF-A0A1J5S512-F1-model_v4 | DUF1330 domain-containing protein | 0.9919 | 1 | 95 |
|
| AF-A0A258TXZ2-F1-model_v4 | deleted | 0.9919 | 2 | 95 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar