F467158

General Info

Members Datasets Scaffolds Average Seq Length
592 273 592 96

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0004905|Ga0466959_0004905_2714_3007
Length 91
Sequence MPAYIIVETDITDPEQYERYKAASPGAIAAAGGRFLAVLEGDWHPSRLVVLEFEDLDAAKRFYESEEYAAARKLREGAARLSMVAVAGVEP

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
120 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
121 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
122 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
123 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
124 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
125 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
126 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
131 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
173 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
174 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 4.39
Rhizosphere 94.43
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10046131 3300003203 Bacteria 1495
2 rootH2_10070391 3300003320 Bacteria 1535
3 JGI25407J50210_10022749 3300003373 Bacteria 1629
4 Ga0070658_10009450 3300005327 Bacteria 7839
5 Ga0070658_10192754 3300005327 Bacteria 1718
6 Ga0070658_10212063 3300005327 Bacteria 1636
7 Ga0070658_10280594 3300005327 Bacteria 1418
8 Ga0070658_10423686 3300005327 Bacteria 1145
9 Ga0070658_10448519 3300005327 Bacteria 1111
10 Ga0070658_10572659 3300005327 Bacteria 978
11 Ga0070680_100217097 3300005336 Bacteria 1614
12 Ga0070680_100552767 3300005336 Bacteria 987
13 Ga0070680_101394368 3300005336 Unclassified 607
14 Ga0070682_100130681 3300005337 Bacteria 1699
15 Ga0070682_100605611 3300005337 Bacteria 866
16 Ga0070682_100726919 3300005337 Bacteria 799
17 Ga0070660_100006295 3300005339 Bacteria 8222
18 Ga0070660_100185104 3300005339 Bacteria 1686
19 Ga0070660_100522439 3300005339 Bacteria 989
20 Ga0070660_100901114 3300005339 Unclassified 746
21 Ga0070691_10169540 3300005341 Bacteria 1130
22 Ga0070661_100545945 3300005344 Bacteria 932
23 Ga0070668_100425936 3300005347 Bacteria 1137
24 Ga0070671_100202953 3300005355 Bacteria 1681
25 Ga0070671_101590387 3300005355 Bacteria 579
26 Ga0070659_100104588 3300005366 Bacteria 2281
27 Ga0070659_100419140 3300005366 Bacteria 1132
28 Ga0070709_10059036 3300005434 Bacteria 2435
29 Ga0070709_10132303 3300005434 Bacteria 1704
30 Ga0070709_10458383 3300005434 Unclassified 962
31 Ga0070714_100006800 3300005435 Bacteria 8864
32 Ga0070714_100050816 3300005435 Bacteria 3533
33 Ga0070714_100106907 3300005435 Bacteria 2472
34 Ga0070714_100172145 3300005435 Bacteria 1965
35 Ga0070714_100416896 3300005435 Bacteria 1271
36 Ga0070714_100933467 3300005435 Bacteria 843
37 Ga0070713_100029034 3300005436 Bacteria 4374
38 Ga0070713_100054419 3300005436 Bacteria 3320
39 Ga0070713_100114150 3300005436 Bacteria 2359
40 Ga0070713_101909018 3300005436 Unclassified 576
41 Ga0070710_10007726 3300005437 Bacteria 5214
42 Ga0070711_100031534 3300005439 Bacteria 3519
43 Ga0070711_101046150 3300005439 Unclassified 702
44 Ga0070711_101842963 3300005439 Bacteria 531
45 Ga0070705_100834774 3300005440 Bacteria 736
46 Ga0070700_100156540 3300005441 Bacteria 1564
47 Ga0070694_101103257 3300005444 Bacteria 662
48 Ga0070708_101234786 3300005445 Bacteria 699
49 Ga0070708_101807674 3300005445 Bacteria 567
50 Ga0070678_100662154 3300005456 Bacteria 937
51 Ga0070681_10043324 3300005458 Bacteria 4509
52 Ga0070681_10045322 3300005458 Bacteria 4400
53 Ga0070681_10141953 3300005458 Bacteria 2331
54 Ga0070681_10372808 3300005458 Bacteria 1338
55 Ga0070681_10935539 3300005458 Bacteria 786
56 Ga0070707_100846238 3300005468 Unclassified 879
57 Ga0070698_100152739 3300005471 Bacteria 2255
58 Ga0070698_100751000 3300005471 Unclassified 919
59 Ga0070699_100209676 3300005518 Bacteria 1734
60 Ga0070679_100185790 3300005530 Unclassified 2049
61 Ga0070679_100224029 3300005530 Bacteria 1841
62 Ga0070679_100224516 3300005530 Bacteria 1839
63 Ga0070679_100262111 3300005530 Unclassified 1683
64 Ga0070679_100421654 3300005530 Bacteria 1280
65 Ga0070679_100557141 3300005530 Bacteria 1090
66 Ga0070679_101925900 3300005530 Bacteria 540
67 Ga0070684_100213157 3300005535 Bacteria 1760
68 Ga0070684_100249127 3300005535 Bacteria 1623
69 Ga0068853_100658199 3300005539 Unclassified 997
70 Ga0070695_100000393 3300005545 Bacteria 22683
71 Ga0070695_100890657 3300005545 Bacteria 718
72 Ga0070693_100130382 3300005547 Bacteria 1571
73 Ga0070665_102647762 3300005548 Bacteria 502
74 Ga0068855_100218222 3300005563 Bacteria 2140
75 Ga0068855_100454303 3300005563 Bacteria 1397
76 Ga0068855_101612540 3300005563 Bacteria 664
77 Ga0068855_101637636 3300005563 Bacteria 658
78 Ga0070664_100116565 3300005564 Bacteria 2336
79 Ga0068857_100622715 3300005577 Bacteria 1021
80 Ga0068854_100364816 3300005578 Bacteria 1186
81 Ga0068856_100878027 3300005614 Bacteria 916
82 Ga0068856_101139016 3300005614 Bacteria 797
83 Ga0068856_101238604 3300005614 Bacteria 762
84 Ga0068856_102241033 3300005614 Unclassified 555
85 Ga0068852_100159024 3300005616 Bacteria 2108
86 Ga0068852_101002001 3300005616 Bacteria 854
87 Ga0068864_101111706 3300005618 Bacteria 787
88 Ga0068858_102536587 3300005842 Unclassified 506
89 Ga0068858_102546356 3300005842 Unclassified 505
90 Ga0081455_10037432 3300005937 Bacteria 4309
91 Ga0081538_10001113 3300005981 Bacteria 28482
92 Ga0081538_10011209 3300005981 Bacteria 7281
93 Ga0081539_10016103 3300005985 Bacteria 5370
94 Ga0070717_10028548 3300006028 Bacteria 4467
95 Ga0070717_10124547 3300006028 Bacteria 2211
96 Ga0070717_10400465 3300006028 Bacteria 1233
97 Ga0070716_100016476 3300006173 Bacteria 3815
98 Ga0070712_100122418 3300006175 Bacteria 1959
99 Ga0075427_10000590 3300006194 Bacteria 4242
100 Ga0075428_100029322 3300006844 Bacteria 6087
101 Ga0075428_100200463 3300006844 Bacteria 2157
102 Ga0075430_100007745 3300006846 Bacteria 9072
103 Ga0075431_100020961 3300006847 Bacteria 6679
104 Ga0075431_100335778 3300006847 Bacteria 1521
105 Ga0075433_10013824 3300006852 Bacteria 6580
106 Ga0075433_10013946 3300006852 Bacteria 6552
107 Ga0075434_100018664 3300006871 Bacteria 6702
108 Ga0075434_100183739 3300006871 Bacteria 2111
109 Ga0075429_100024384 3300006880 Bacteria 5248
110 Ga0075436_100919114 3300006914 Unclassified 655
111 Ga0075435_100583535 3300007076 Bacteria 969
112 Ga0075435_101229320 3300007076 Unclassified 656
113 Ga0075435_101254532 3300007076 Unclassified 649
114 Ga0105240_10024931 3300009093 Bacteria 7873
115 Ga0105240_10146420 3300009093 Bacteria 2818
116 Ga0105240_10200209 3300009093 Bacteria 2341
117 Ga0105240_10756032 3300009093 Bacteria 1056
118 Ga0105240_11104345 3300009093 Bacteria 844
119 Ga0111539_10028289 3300009094 Bacteria 6841
120 Ga0111539_10427798 3300009094 Bacteria 1542
121 Ga0105245_10212951 3300009098 Bacteria 1861
122 Ga0105245_10264112 3300009098 Bacteria 1676
123 Ga0114129_10012071 3300009147 Bacteria 12295
124 Ga0114129_10043881 3300009147 Bacteria 6291
125 Ga0105241_10923862 3300009174 Bacteria 812
126 Ga0105248_10655463 3300009177 Bacteria 1184
127 Ga0105237_10959375 3300009545 Bacteria 862
128 Ga0105237_11942488 3300009545 Unclassified 597
129 Ga0105237_12745622 3300009545 Bacteria 503
130 Ga0105238_10189611 3300009551 Bacteria 2032
131 Ga0105238_11367508 3300009551 Bacteria 735
132 Ga0105239_11743761 3300010375 Bacteria 721
133 Ga0105239_13473863 3300010375 Unclassified 512
134 Ga0157373_10524082 3300013100 Bacteria 858
135 Ga0157371_11217932 3300013102 Bacteria 580
136 Ga0157371_11537898 3300013102 Unclassified 520
137 Ga0157370_10016123 3300013104 Bacteria 7574
138 Ga0157370_10022411 3300013104 Bacteria 6284
139 Ga0157370_10041821 3300013104 Bacteria 4418
140 Ga0157370_11005617 3300013104 Bacteria 755
141 Ga0157370_11023825 3300013104 Unclassified 747
142 Ga0157369_10004660 3300013105 Bacteria 16119
143 Ga0157369_10255103 3300013105 Unclassified 1830
144 Ga0157369_10539709 3300013105 Bacteria 1206
145 Ga0157369_12213467 3300013105 Unclassified 557
146 Ga0157374_10030374 3300013296 Bacteria 4906
147 Ga0157372_10021043 3300013307 Bacteria 7044
148 Ga0157372_10276256 3300013307 Bacteria 1953
149 Ga0157372_11417669 3300013307 Bacteria 801
150 Ga0157372_11499639 3300013307 Unclassified 777
151 Ga0157372_11535550 3300013307 Bacteria 767
152 Ga0157372_11894864 3300013307 Unclassified 685
153 Ga0163163_12635275 3300014325 Bacteria 560
154 Ga0157380_10198918 3300014326 Bacteria 1776
155 Ga0182008_10022715 3300014497 Bacteria 3211
156 Ga0182008_10044103 3300014497 Bacteria 2218
157 Ga0182008_10159391 3300014497 Bacteria 1135
158 Ga0157377_10825116 3300014745 Bacteria 686
159 Ga0157379_11140813 3300014968 Unclassified 748
160 Ga0182006_1215840 3300015261 Bacteria 633
161 Ga0182007_10191617 3300015262 Bacteria 711
162 Ga0182005_1249758 3300015265 Bacteria 548
163 Ga0206356_11791757 3300020070 Bacteria 2442
164 Ga0206354_10534634 3300020081 Bacteria 1314
165 Ga0213875_10054897 3300021388 Bacteria 1865
166 Ga0207692_10769539 3300025898 Bacteria 628
167 Ga0207685_10415115 3300025905 Bacteria 693
168 Ga0207699_10049801 3300025906 Bacteria 2467
169 Ga0207699_10050976 3300025906 Bacteria 2444
170 Ga0207699_10213505 3300025906 Bacteria 1313
171 Ga0207699_10860877 3300025906 Bacteria 668
172 Ga0207705_10012826 3300025909 Bacteria 6052
173 Ga0207705_10164124 3300025909 Bacteria 1670
174 Ga0207705_10199224 3300025909 Bacteria 1517
175 Ga0207705_10282637 3300025909 Bacteria 1270
176 Ga0207705_10362974 3300025909 Bacteria 1117
177 Ga0207707_10033680 3300025912 Bacteria 4483
178 Ga0207707_10154079 3300025912 Bacteria 2009
179 Ga0207707_10657421 3300025912 Bacteria 883
180 Ga0207707_10928319 3300025912 Bacteria 718
181 Ga0207695_10177963 3300025913 Bacteria 2049
182 Ga0207695_10237900 3300025913 Bacteria 1723
183 Ga0207695_10446189 3300025913 Bacteria 1177
184 Ga0207671_10164564 3300025914 Bacteria 1719
185 Ga0207693_10000964 3300025915 Bacteria 25831
186 Ga0207663_10030999 3300025916 Bacteria 3159
187 Ga0207663_10743448 3300025916 Bacteria 779
188 Ga0207660_10120381 3300025917 Bacteria 1987
189 Ga0207660_10128139 3300025917 Bacteria 1929
190 Ga0207660_11185890 3300025917 Bacteria 621
191 Ga0207657_10013269 3300025919 Bacteria 8084
192 Ga0207657_10192349 3300025919 Bacteria 1645
193 Ga0207657_10274661 3300025919 Bacteria 1339
194 Ga0207657_10750019 3300025919 Unclassified 756
195 Ga0207649_10139689 3300025920 Bacteria 1656
196 Ga0207649_10353800 3300025920 Bacteria 1088
197 Ga0207652_10038728 3300025921 Bacteria 4043
198 Ga0207652_10154228 3300025921 Bacteria 2057
199 Ga0207652_10182420 3300025921 Bacteria 1887
200 Ga0207652_10660449 3300025921 Bacteria 934
201 Ga0207652_10941014 3300025921 Bacteria 762
202 Ga0207646_10424447 3300025922 Unclassified 1200
203 Ga0207694_10224550 3300025924 Bacteria 1533
204 Ga0207694_11229355 3300025924 Bacteria 634
205 Ga0207687_10186143 3300025927 Bacteria 1612
206 Ga0207687_11355093 3300025927 Bacteria 611
207 Ga0207700_10008053 3300025928 Bacteria 6499
208 Ga0207700_10047569 3300025928 Bacteria 3180
209 Ga0207700_11875538 3300025928 Bacteria 526
210 Ga0207664_10005790 3300025929 Bacteria 8451
211 Ga0207664_10077497 3300025929 Bacteria 2693
212 Ga0207664_10165711 3300025929 Bacteria 1888
213 Ga0207664_10211736 3300025929 Bacteria 1677
214 Ga0207664_10321852 3300025929 Bacteria 1365
215 Ga0207664_10365407 3300025929 Bacteria 1279
216 Ga0207664_10473922 3300025929 Bacteria 1119
217 Ga0207664_10487097 3300025929 Bacteria 1103
218 Ga0207664_10868285 3300025929 Bacteria 811
219 Ga0207664_11925129 3300025929 Unclassified 514
220 Ga0207644_10288647 3300025931 Bacteria 1319
221 Ga0207644_11008232 3300025931 Bacteria 699
222 Ga0207690_10029640 3300025932 Bacteria 3483
223 Ga0207690_10335033 3300025932 Bacteria 1193
224 Ga0207669_10135749 3300025937 Bacteria 1699
225 Ga0207704_10148872 3300025938 Bacteria 1649
226 Ga0207665_10013449 3300025939 Bacteria 5381
227 Ga0207691_10760564 3300025940 Unclassified 815
228 Ga0207711_10397713 3300025941 Bacteria 1280
229 Ga0207711_11341213 3300025941 Bacteria 658
230 Ga0207679_10092077 3300025945 Bacteria 2348
231 Ga0207667_10125374 3300025949 Bacteria 2645
232 Ga0207667_10223449 3300025949 Bacteria 1929
233 Ga0207667_11052084 3300025949 Bacteria 799
234 Ga0207703_12005476 3300026035 Unclassified 555
235 Ga0207639_10581606 3300026041 Unclassified 1031
236 Ga0207639_11469845 3300026041 Bacteria 640
237 Ga0207678_10274274 3300026067 Bacteria 1447
238 Ga0207708_10225274 3300026075 Bacteria 1504
239 Ga0207702_10391668 3300026078 Bacteria 1338
240 Ga0207702_10886400 3300026078 Bacteria 884
241 Ga0207702_12107708 3300026078 Unclassified 553
242 Ga0207702_12341002 3300026078 Unclassified 522
243 Ga0207676_11420523 3300026095 Bacteria 690
244 Ga0207674_10431926 3300026116 Bacteria 1273
245 Ga0207683_10634836 3300026121 Bacteria 989
246 Ga0207698_10067080 3300026142 Bacteria 2828
247 Ga0207698_10490712 3300026142 Bacteria 1193
248 Ga0207428_10001190 3300027907 Bacteria 28004
249 Ga0265337_1057367 3300028556 Bacteria 1084
250 Ga0265337_1063791 3300028556 Bacteria 1018
251 Ga0265337_1093821 3300028556 Bacteria 818
252 Ga0265326_10022511 3300028558 Bacteria 1805
253 Ga0265319_1002310 3300028563 Bacteria 10520
254 Ga0265319_1002945 3300028563 Bacteria 9062
255 Ga0265319_1054326 3300028563 Bacteria 1314
256 Ga0265334_10009809 3300028573 Bacteria 4048
257 Ga0265334_10158113 3300028573 Bacteria 797
258 Ga0265318_10002950 3300028577 Bacteria 8818
259 Ga0265318_10010568 3300028577 Bacteria 4012
260 Ga0265323_10146950 3300028653 Bacteria 756
261 Ga0265322_10009592 3300028654 Bacteria 2809
262 Ga0265322_10080691 3300028654 Bacteria 923
263 Ga0265336_10001570 3300028666 Bacteria 10254
264 Ga0265336_10022541 3300028666 Bacteria 2004
265 Ga0265336_10041327 3300028666 Bacteria 1410
266 Ga0265338_10004508 3300028800 Bacteria 18779
267 Ga0265338_10016515 3300028800 Bacteria 8024
268 Ga0265338_10016873 3300028800 Bacteria 7905
269 Ga0265338_10021437 3300028800 Bacteria 6737
270 Ga0265338_10021638 3300028800 Bacteria 6695
271 Ga0265338_10026870 3300028800 Bacteria 5791
272 Ga0265338_10045918 3300028800 Bacteria 4010
273 Ga0265338_10059124 3300028800 Bacteria 3378
274 Ga0265324_10011282 3300029957 Bacteria 3410
275 Ga0265324_10277865 3300029957 Unclassified 569
276 Ga0265330_10028516 3300031235 Bacteria 2515
277 Ga0265330_10029044 3300031235 Bacteria 2488
278 Ga0265332_10014621 3300031238 Bacteria 3471
279 Ga0265332_10018345 3300031238 Bacteria 3087
280 Ga0265332_10407797 3300031238 Bacteria 561
281 Ga0265332_10486575 3300031238 Unclassified 511
282 Ga0265328_10032438 3300031239 Bacteria 1938
283 Ga0265320_10026485 3300031240 Bacteria 3033
284 Ga0265320_10064391 3300031240 Bacteria 1741
285 Ga0265325_10000453 3300031241 Bacteria 29634
286 Ga0265329_10004254 3300031242 Bacteria 6011
287 Ga0265329_10104851 3300031242 Bacteria 901
288 Ga0265340_10003413 3300031247 Bacteria 8974
289 Ga0265340_10037720 3300031247 Bacteria 2393
290 Ga0265339_10005781 3300031249 Bacteria 8211
291 Ga0265339_10031744 3300031249 Bacteria 2983
292 Ga0265339_10036063 3300031249 Bacteria 2769
293 Ga0265339_10044507 3300031249 Bacteria 2448
294 Ga0265331_10012453 3300031250 Bacteria 4607
295 Ga0265331_10030466 3300031250 Bacteria 2686
296 Ga0265331_10045650 3300031250 Bacteria 2115
297 Ga0265327_10010269 3300031251 Bacteria 6602
298 Ga0265327_10012478 3300031251 Bacteria 5726
299 Ga0265327_10032624 3300031251 Bacteria 2912
300 Ga0265327_10121724 3300031251 Bacteria 1236
301 Ga0265316_10033792 3300031344 Bacteria 4160
302 Ga0265316_10052875 3300031344 Bacteria 3184
303 Ga0265316_10455245 3300031344 Bacteria 917
304 Ga0265313_10025257 3300031595 Bacteria 3153
305 Ga0265313_10043563 3300031595 Bacteria 2197
306 Ga0265313_10049938 3300031595 Bacteria 2010
307 Ga0265314_10002833 3300031711 Bacteria 17262
308 Ga0265314_10022158 3300031711 Bacteria 4869
309 Ga0265342_10002319 3300031712 Bacteria 16552
310 Ga0265342_10030763 3300031712 Bacteria 3323
311 Ga0307405_10020909 3300031731 Bacteria 3668
312 Ga0307413_10203025 3300031824 Bacteria 1433
313 Ga0307413_10302607 3300031824 Bacteria 1213
314 Ga0307410_10239301 3300031852 Unclassified 1406
315 Ga0307410_10736049 3300031852 Bacteria 834
316 Ga0307410_10751081 3300031852 Bacteria 826
317 Ga0307406_10057377 3300031901 Bacteria 2497
318 Ga0307406_10256491 3300031901 Bacteria 1320
319 Ga0307406_12000520 3300031901 Bacteria 518
320 Ga0307407_10011507 3300031903 Bacteria 4215
321 Ga0307407_10267836 3300031903 Bacteria 1178
322 Ga0307412_10209278 3300031911 Bacteria 1487
323 Ga0307409_100082779 3300031995 Bacteria 2599
324 Ga0307409_100376968 3300031995 Bacteria 1347
325 Ga0307416_100000306 3300032002 Bacteria 25268
326 Ga0307416_100065882 3300032002 Bacteria 2979
327 Ga0307416_100100885 3300032002 Bacteria 2512
328 Ga0307416_100844102 3300032002 Bacteria 1014
329 Ga0307416_102613189 3300032002 Bacteria 602
330 Ga0307414_10503769 3300032004 Bacteria 1072
331 Ga0307414_11347049 3300032004 Unclassified 663
332 Ga0307411_10030410 3300032005 Bacteria 3310
333 Ga0307415_100000930 3300032126 Bacteria 13418
334 Ga0307415_100062175 3300032126 Bacteria 2588
335 Ga0307415_100158116 3300032126 Bacteria 1753
336 Ga0307415_100513206 3300032126 Bacteria 1050
337 Ga0307415_100697687 3300032126 Bacteria 915
338 Ga0373934_0089974 3300035086 Unclassified 1237
339 Ga0373934_0226779 3300035086 Bacteria 771
340 Ga0373951_0035178 3300035091 Bacteria 1192
341 Ga0373939_0149791 3300035114 Bacteria 848
342 Ga0373954_0066752 3300035118 Bacteria 1704
343 Ga0373954_0255267 3300035118 Bacteria 863
344 Ga0373957_0361873 3300035120 Bacteria 621
345 Ga0373955_0148769 3300035172 Bacteria 1377
346 Ga0373924_0255472 3300035410 Bacteria 776
347 Ga0373933_0029412 3300035724 Bacteria 3177
348 Ga0373937_0184320 3300036401 Bacteria 1960
349 Ga0373937_0455363 3300036401 Bacteria 1215
350 Ga0395899_0040170 3300037312 Unclassified 3499
351 Ga0395899_0450104 3300037312 Bacteria 843
352 Ga0395900_0178615 3300037418 Bacteria 2158
353 Ga0395900_0276795 3300037418 Bacteria 1671
354 Ga0395900_0849191 3300037418 Bacteria 839
355 Ga0395900_0883116 3300037418 Bacteria 818
356 Ga0395900_1656174 3300037418 Bacteria 551
357 Ga0395900_1718069 3300037418 Unclassified 538
358 Ga0395898_0075428 3300037466 Bacteria 3257
359 Ga0395898_0153315 3300037466 Bacteria 2204
360 Ga0395898_0338849 3300037466 Bacteria 1434
361 Ga0395898_0351996 3300037466 Bacteria 1404
362 Ga0395898_1226098 3300037466 Bacteria 681
363 Ga0395898_1373564 3300037466 Bacteria 634
364 Ga0395905_0150706 3300037471 Bacteria 2188
365 Ga0395905_0344112 3300037471 Bacteria 1382
366 Ga0436364_0601973 3300037853 Bacteria 29284
367 Ga0395901_0252028 3300038443 Unclassified 1839
368 Ga0395901_0269636 3300038443 Bacteria 1771
369 Ga0395901_0590990 3300038443 Bacteria 1120
370 Ga0395901_0730722 3300038443 Bacteria 985
371 Ga0395901_1304902 3300038443 Bacteria 687
372 Ga0436363_0088266 3300039450 Bacteria 8561
373 Ga0436363_0839180 3300039450 Unclassified 1001
374 Ga0451839_1027749 3300041496 Bacteria 817
375 Ga0439448_0030869 3300042005 Bacteria 1701
376 Ga0450914_046087 3300042118 Unclassified 564
377 Ga0439458_0074899 3300042157 Bacteria 859
378 Ga0439440_0020634 3300042993 Bacteria 1479
379 Ga0439440_0104752 3300042993 Unclassified 773
380 Ga0439440_0153640 3300042993 Bacteria 660
381 Ga0466969_0041058 3300044656 Bacteria 2316
382 Ga0466972_0207411 3300044658 Bacteria 917
383 Ga0466966_0005166 3300044684 Bacteria 8579
384 Ga0466966_0036173 3300044684 Bacteria 3189
385 Ga0466961_0140424 3300044693 Unclassified 1512
386 Ga0466961_0177989 3300044693 Bacteria 1321
387 Ga0466963_0004956 3300044694 Bacteria 7763
388 Ga0466963_0008918 3300044694 Bacteria 6020
389 Ga0466963_0014973 3300044694 Bacteria 4792
390 Ga0466963_0064071 3300044694 Bacteria 2461
391 Ga0466963_0088074 3300044694 Bacteria 2111
392 Ga0466963_0169355 3300044694 Bacteria 1522
393 Ga0466963_0314891 3300044694 Bacteria 1101
394 Ga0466963_0749912 3300044694 Bacteria 689
395 Ga0466963_0874936 3300044694 Bacteria 633
396 Ga0466963_0919930 3300044694 Bacteria 616
397 Ga0466963_1337025 3300044694 Bacteria 503
398 Ga0466964_0001680 3300044706 Bacteria 7642
399 Ga0466964_0001976 3300044706 Bacteria 7194
400 Ga0466964_0069379 3300044706 Bacteria 1486
401 Ga0466964_0306683 3300044706 Unclassified 802
402 Ga0466971_0004164 3300044719 Bacteria 6233
403 Ga0466971_0063093 3300044719 Unclassified 1677
404 Ga0466971_0099539 3300044719 Bacteria 1335
405 Ga0466971_0127653 3300044719 Unclassified 1179
406 Ga0466971_0144444 3300044719 Bacteria 1109
407 Ga0466971_0204630 3300044719 Bacteria 932
408 Ga0466968_0001841 3300044735 Bacteria 7657
409 Ga0466968_0036892 3300044735 Bacteria 2049
410 Ga0466968_0061994 3300044735 Bacteria 1614
411 Ga0466968_0091241 3300044735 Bacteria 1350
412 Ga0466968_0353674 3300044735 Bacteria 714
413 Ga0466970_0055263 3300044765 Bacteria 2120
414 Ga0466970_0228513 3300044765 Bacteria 1039
415 Ga0466957_0000839 3300044842 Bacteria 15709
416 Ga0466957_0005602 3300044842 Bacteria 7057
417 Ga0466957_0011876 3300044842 Bacteria 5034
418 Ga0466957_0014602 3300044842 Bacteria 4576
419 Ga0466957_0055290 3300044842 Bacteria 2426
420 Ga0466957_0363862 3300044842 Bacteria 983
421 Ga0466957_0537836 3300044842 Bacteria 813
422 Ga0466957_0945702 3300044842 Bacteria 617
423 Ga0466959_0002503 3300045049 Bacteria 11770
424 Ga0466959_0004905 3300045049 Bacteria 9061
425 Ga0466959_0133999 3300045049 Bacteria 1755
426 Ga0466959_0260048 3300045049 Bacteria 1195
427 Ga0466959_0543850 3300045049 Bacteria 783
428 Ga0466958_0001766 3300045836 Bacteria 10466
429 Ga0466958_0004935 3300045836 Bacteria 7113
430 Ga0466958_0028945 3300045836 Bacteria 3286
431 Ga0466958_0165325 3300045836 Bacteria 1400
432 Ga0466958_0326668 3300045836 Bacteria 986
433 Ga0466958_0439240 3300045836 Bacteria 844
434 Ga0466967_0005346 3300045976 Bacteria 8876
435 Ga0466967_0006620 3300045976 Bacteria 8234
436 Ga0466967_0008127 3300045976 Bacteria 7657
437 Ga0466967_0009557 3300045976 Bacteria 7204
438 Ga0466967_0034363 3300045976 Bacteria 4302
439 Ga0466967_0074693 3300045976 Bacteria 3045
440 Ga0466967_0091170 3300045976 Bacteria 2769
441 Ga0466967_0112223 3300045976 Bacteria 2506
442 Ga0466967_0129314 3300045976 Bacteria 2343
443 Ga0466967_0173973 3300045976 Bacteria 2027
444 Ga0466967_0192421 3300045976 Bacteria 1928
445 Ga0466967_0197028 3300045976 Bacteria 1906
446 Ga0466967_0317509 3300045976 Bacteria 1502
447 Ga0466967_0406344 3300045976 Unclassified 1325
448 Ga0466967_1268203 3300045976 Bacteria 734
449 Ga0466967_1312219 3300045976 Unclassified 721
450 Ga0466967_1365879 3300045976 Unclassified 706
451 Ga0466967_2054956 3300045976 Unclassified 568
452 Ga0495592_0112615 3300046454 Bacteria 1923
453 Ga0495651_0121844 3300046462 Bacteria 1915
454 Ga0495653_0364669 3300046463 Unclassified 926
455 Ga0495582_0708626 3300046473 Bacteria 582
456 Ga0495608_0047598 3300046511 Bacteria 2850
457 Ga0495608_0929760 3300046511 Bacteria 508
458 Ga0495618_0045317 3300046514 Bacteria 2774
459 Ga0495618_0576770 3300046514 Bacteria 671
460 Ga0495628_0307212 3300046516 Bacteria 1173
461 Ga0495630_0167052 3300046517 Bacteria 1675
462 Ga0495630_0529115 3300046517 Bacteria 904
463 Ga0495630_0709201 3300046517 Bacteria 770
464 Ga0495640_0016020 3300046533 Bacteria 5621
465 Ga0495645_0451700 3300046543 Bacteria 810
466 Ga0495667_0306847 3300046559 Bacteria 1005
467 Ga0495634_0056266 3300046642 Bacteria 2628
468 Ga0495634_0201502 3300046642 Unclassified 1236
469 Ga0495635_0013904 3300046663 Bacteria 5631
470 Ga0495635_0062502 3300046663 Bacteria 2557
471 Ga0495635_0351977 3300046663 Bacteria 982
472 Ga0495657_0129175 3300046675 Unclassified 1584
473 Ga0495657_0549142 3300046675 Bacteria 671
474 Ga0495657_0892697 3300046675 Bacteria 505
475 Ga0495646_0301132 3300046680 Bacteria 848
476 Ga0495613_0394405 3300046689 Bacteria 945
477 Ga0495613_0750231 3300046689 Bacteria 640
478 Ga0495604_0169862 3300047317 Bacteria 1535
479 Ga0495636_0366278 3300047318 Bacteria 682
480 Ga0495674_0090385 3300047319 Bacteria 2616
481 Ga0495674_0770242 3300047319 Bacteria 750
482 Ga0495680_0839345 3300047322 Unclassified 598
483 Ga0495680_1060270 3300047322 Unclassified 514
484 Ga0495680_1083873 3300047322 Unclassified 507
485 Ga0495675_0306137 3300047444 Bacteria 943
486 Ga0495684_0097766 3300047471 Bacteria 2220
487 Ga0495684_0103387 3300047471 Bacteria 2153
488 Ga0495684_0285790 3300047471 Bacteria 1188
489 Ga0495602_0777455 3300048088 Bacteria 644
490 Ga0495602_1088199 3300048088 Unclassified 524
491 Ga0496100_0012368 3300048903 Bacteria 4890
492 Ga0496102_0032716 3300048905 Bacteria 4673
493 Ga0496102_0236273 3300048905 Bacteria 1723
494 Ga0496103_0019776 3300048906 Bacteria 4042
495 Ga0496103_0077535 3300048906 Bacteria 2086
496 Ga0496104_0497929 3300048907 Bacteria 1129
497 Ga0496105_0057053 3300048908 Bacteria 3224
498 Ga0496106_0030374 3300048909 Bacteria 4030
499 Ga0496107_0059855 3300048910 Bacteria 2756
500 Ga0496108_0031623 3300048911 Bacteria 4392
501 Ga0496109_0053696 3300048912 Bacteria 3675
502 Ga0496110_0038024 3300048913 Bacteria 4185
503 Ga0496110_0485280 3300048913 Bacteria 1126
504 Ga0496111_0021414 3300048914 Bacteria 4514
505 Ga0496111_0700314 3300048914 Bacteria 737
506 Ga0496112_0047465 3300048915 Bacteria 4213
507 Ga0496112_0068960 3300048915 Bacteria 3493
508 Ga0496112_0102958 3300048915 Bacteria 2824
509 Ga0496112_0472137 3300048915 Bacteria 1191
510 Ga0496112_0757643 3300048915 Bacteria 897
511 Ga0496113_0040740 3300048916 Bacteria 3424
512 Ga0496113_0304233 3300048916 Bacteria 1277
513 Ga0496113_0802609 3300048916 Bacteria 748
514 Ga0496113_0955262 3300048916 Unclassified 676
515 Ga0496114_0068218 3300048917 Bacteria 2985
516 Ga0496115_0096138 3300048918 Bacteria 2425
517 Ga0501031_0001219 3300049568 Bacteria 15732
518 Ga0501032_0136844 3300049569 Bacteria 1614
519 Ga0501033_0013698 3300049570 Bacteria 6170
520 Ga0501034_0004154 3300049571 Bacteria 16214
521 Ga0501034_1029845 3300049571 Bacteria 706
522 Ga0501036_0001012 3300049572 Bacteria 21208
523 Ga0501037_0118841 3300049573 Bacteria 1901
524 Ga0501038_0131989 3300049574 Bacteria 2049
525 Ga0501039_0000777 3300049575 Bacteria 22938
526 Ga0501040_0000970 3300049576 Bacteria 18153
527 Ga0501041_0000521 3300049577 Bacteria 19853
528 Ga0501042_0000384 3300049578 Bacteria 22447
529 Ga0501043_0005685 3300049579 Bacteria 10045
530 Ga0501046_0005314 3300049580 Bacteria 11518
531 Ga0501048_0000488 3300049582 Bacteria 27710
532 Ga0501067_0076281 3300049583 Unclassified 1857
533 Ga0501067_0106131 3300049583 Bacteria 1561
534 Ga0501067_0156485 3300049583 Bacteria 1270
535 Ga0501067_0841133 3300049583 Bacteria 517
536 Ga0501068_0081940 3300049584 Bacteria 1981
537 Ga0501069_0029782 3300049585 Bacteria 2997
538 Ga0501069_0314783 3300049585 Bacteria 919
539 Ga0501070_0005070 3300049586 Bacteria 11223
540 Ga0501070_0050585 3300049586 Bacteria 3449
541 Ga0501070_0507919 3300049586 Bacteria 968
542 Ga0501071_0001049 3300049587 Bacteria 15310
543 Ga0501072_0002834 3300049588 Bacteria 13015
544 Ga0501072_0015504 3300049588 Bacteria 5841
545 Ga0501073_0115410 3300049589 Bacteria 1861
546 Ga0501073_0242548 3300049589 Bacteria 1244
547 Ga0501074_0001561 3300049590 Bacteria 15492
548 Ga0501074_0010895 3300049590 Bacteria 6600
549 Ga0501074_0029258 3300049590 Bacteria 3990
550 Ga0501075_0007067 3300049591 Bacteria 7755
551 Ga0501076_0000670 3300049592 Bacteria 21958
552 Ga0501077_0000979 3300049593 Bacteria 17210
553 Ga0501079_0000766 3300049741 Bacteria 21943
554 Ga0501079_0094604 3300049741 Bacteria 2315
555 Ga0501080_0002096 3300049742 Bacteria 17315
556 Ga0501080_0004391 3300049742 Bacteria 12530
557 Ga0501080_0065727 3300049742 Bacteria 3373
558 Ga0501081_0000421 3300049743 Bacteria 23417
559 Ga0501083_0009464 3300049744 Bacteria 6883
560 Ga0501083_0032395 3300049744 Bacteria 3584
561 Ga0501035_0009537 3300049822 Bacteria 9026
562 Ga0501044_0174414 3300049823 Bacteria 2120
563 Ga0501044_0608092 3300049823 Bacteria 986
564 Ga0501045_0001105 3300049824 Bacteria 17822
565 nmdc:mga05p37_19132_c1 3300050507 Bacteria 8284
566 nmdc:mga05p37_56249_c1 3300050507 Bacteria 4843
567 nmdc:mga09592_32597_c1 3300050508 Bacteria 4344
568 nmdc:mga0qj67_6104_c1 3300050509 Bacteria 8830
569 nmdc:mga06r32_473678_c1 3300050510 Unclassified 1231
570 nmdc:mga06r32_571254_c1 3300050510 Bacteria 1103
571 nmdc:mga06r32_7228_c1 3300050510 Bacteria 10009
572 nmdc:mga08y16_493_c1 3300050511 Bacteria 36438
573 nmdc:mga0n895_13975_c1 3300050512 Bacteria 7271
574 nmdc:mga0n895_511440_c1 3300050512 Bacteria 1209
575 nmdc:mga0n895_89825_c1 3300050512 Bacteria 3073
576 nmdc:mga0rr50_100538_c1 3300050513 Bacteria 2271
577 nmdc:mga0rr50_1297854_c1 3300050513 Unclassified 617
578 nmdc:mga0a205_44534_c3 3300050515 Bacteria 1321
579 nmdc:mga0a205_6411_c1 3300050515 Bacteria 10633
580 Ga0495601_0159394 3300053077 Bacteria 1474
581 Ga0495601_0247133 3300053077 Bacteria 1165
582 Ga0495595_0364801 3300053084 Unclassified 730
583 Ga0495619_0089025 3300053085 Bacteria 2088
584 Ga0500566_0253153 3300053094 Bacteria 855
585 Ga0501084_0000718 3300054114 Bacteria 25255
586 Ga0501082_0004632 3300060353 Bacteria 12001
587 Ga0501082_0098702 3300060353 Bacteria 2525
588 Ga0466962_0110085 3300061719 Unclassified 1326
589 Ga0466962_0143216 3300061719 Bacteria 1158
590 Ga0466962_0178183 3300061719 Unclassified 1036
591 Ga0466962_0534266 3300061719 Bacteria 595
592 Ga0530510_0000732 3300061734 Bacteria 21330

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10423686 Ga0070658_104236862 89
2 3300005530 Ga0070679_100224516 Ga0070679_1002245164 89
3 3300005535 Ga0070684_100249127 Ga0070684_1002491272 89
4 3300025909 Ga0207705_10282637 Ga0207705_102826373 89
5 3300025921 Ga0207652_10038728 Ga0207652_100387285 89
6 3300025929 Ga0207664_10321852 Ga0207664_103218523 89
7 3300044684 Ga0466966_0005166 Ga0466966_0005166_8190_8483 89
8 3300045049 Ga0466959_0004905 Ga0466959_0004905_2714_3007 89
9 3300021388 Ga0213875_10054897 Ga0213875_100548972 90
10 3300037853 Ga0436364_0601973 Ga0436364_0601973_5591_5881 90
11 3300039450 Ga0436363_0088266 Ga0436363_0088266_6844_7134 90
12 3300005327 Ga0070658_10448519 Ga0070658_104485192 91
13 3300025929 Ga0207664_11925129 Ga0207664_119251291 91
14 3300041496 Ga0451839_1027749 Ga0451839_1027749_397_672 91
15 3300005327 Ga0070658_10212063 Ga0070658_102120632 94
16 3300005336 Ga0070680_101394368 Ga0070680_1013943682 94
17 3300005337 Ga0070682_100130681 Ga0070682_1001306812 94
18 3300005339 Ga0070660_100901114 Ga0070660_1009011142 94
19 3300005435 Ga0070714_100933467 Ga0070714_1009334672 94
20 3300005439 Ga0070711_101842963 Ga0070711_1018429631 94
21 3300005458 Ga0070681_10043324 Ga0070681_100433242 94
22 3300005458 Ga0070681_10045322 Ga0070681_100453222 94
23 3300005458 Ga0070681_10141953 Ga0070681_101419532 94
24 3300005530 Ga0070679_100185790 Ga0070679_1001857902 94
25 3300005530 Ga0070679_100224029 Ga0070679_1002240292 94
26 3300005539 Ga0068853_100658199 Ga0068853_1006581991 94
27 3300005545 Ga0070695_100890657 Ga0070695_1008906572 94
28 3300005563 Ga0068855_100218222 Ga0068855_1002182223 94
29 3300005614 Ga0068856_101139016 Ga0068856_1011390162 94
30 3300005614 Ga0068856_102241033 Ga0068856_1022410331 94
31 3300005616 Ga0068852_101002001 Ga0068852_1010020012 94
32 3300005842 Ga0068858_102536587 Ga0068858_1025365871 94
33 3300009093 Ga0105240_10146420 Ga0105240_101464202 94
34 3300009545 Ga0105237_11942488 Ga0105237_119424881 94
35 3300009551 Ga0105238_11367508 Ga0105238_113675081 94
36 3300010375 Ga0105239_11743761 Ga0105239_117437611 94
37 3300010375 Ga0105239_13473863 Ga0105239_134738631 94
38 3300013104 Ga0157370_10041821 Ga0157370_100418214 94
39 3300013105 Ga0157369_10004660 Ga0157369_1000466014 94
40 3300013105 Ga0157369_12213467 Ga0157369_122134671 94
41 3300013307 Ga0157372_11499639 Ga0157372_114996392 94
42 3300013307 Ga0157372_11894864 Ga0157372_118948642 94
43 3300014497 Ga0182008_10022715 Ga0182008_100227152 94
44 3300015262 Ga0182007_10191617 Ga0182007_101916172 94
45 3300025909 Ga0207705_10199224 Ga0207705_101992242 94
46 3300025912 Ga0207707_10033680 Ga0207707_100336802 94
47 3300025912 Ga0207707_10928319 Ga0207707_109283191 94
48 3300025913 Ga0207695_10446189 Ga0207695_104461892 94
49 3300025916 Ga0207663_10743448 Ga0207663_107434482 94
50 3300025917 Ga0207660_10120381 Ga0207660_101203812 94
51 3300025919 Ga0207657_10750019 Ga0207657_107500191 94
52 3300025921 Ga0207652_10182420 Ga0207652_101824202 94
53 3300025921 Ga0207652_10660449 Ga0207652_106604492 94
54 3300025924 Ga0207694_11229355 Ga0207694_112293551 94
55 3300025949 Ga0207667_10125374 Ga0207667_101253743 94
56 3300026035 Ga0207703_12005476 Ga0207703_120054761 94
57 3300026041 Ga0207639_10581606 Ga0207639_105816061 94
58 3300026078 Ga0207702_10886400 Ga0207702_108864002 94
59 3300026078 Ga0207702_12107708 Ga0207702_121077082 94
60 3300026142 Ga0207698_10490712 Ga0207698_104907122 94
61 3300035086 Ga0373934_0226779 Ga0373934_0226779_302_589 94
62 3300035118 Ga0373954_0255267 Ga0373954_0255267_191_478 94
63 3300035724 Ga0373933_0029412 Ga0373933_0029412_1405_1692 94
64 3300037418 Ga0395900_1718069 Ga0395900_1718069_69_356 94
65 3300003203 JGI25406J46586_10046131 JGI25406J46586_100461311 95
66 3300003320 rootH2_10070391 rootH2_100703913 95
67 3300003373 JGI25407J50210_10022749 JGI25407J50210_100227492 95
68 3300005327 Ga0070658_10009450 Ga0070658_100094505 95
69 3300005327 Ga0070658_10192754 Ga0070658_101927542 95
70 3300005327 Ga0070658_10280594 Ga0070658_102805942 95
71 3300005327 Ga0070658_10572659 Ga0070658_105726592 95
72 3300005336 Ga0070680_100217097 Ga0070680_1002170973 95
73 3300005336 Ga0070680_100552767 Ga0070680_1005527672 95
74 3300005337 Ga0070682_100605611 Ga0070682_1006056112 95
75 3300005337 Ga0070682_100726919 Ga0070682_1007269192 95
76 3300005339 Ga0070660_100006295 Ga0070660_10000629511 95
77 3300005339 Ga0070660_100185104 Ga0070660_1001851043 95
78 3300005339 Ga0070660_100522439 Ga0070660_1005224391 95
79 3300005341 Ga0070691_10169540 Ga0070691_101695402 95
80 3300005344 Ga0070661_100545945 Ga0070661_1005459452 95
81 3300005347 Ga0070668_100425936 Ga0070668_1004259362 95
82 3300005355 Ga0070671_100202953 Ga0070671_1002029532 95
83 3300005355 Ga0070671_101590387 Ga0070671_1015903872 95
84 3300005366 Ga0070659_100104588 Ga0070659_1001045883 95
85 3300005366 Ga0070659_100419140 Ga0070659_1004191401 95
86 3300005434 Ga0070709_10059036 Ga0070709_100590364 95
87 3300005434 Ga0070709_10132303 Ga0070709_101323031 95
88 3300005434 Ga0070709_10458383 Ga0070709_104583831 95
89 3300005435 Ga0070714_100006800 Ga0070714_1000068006 95
90 3300005435 Ga0070714_100050816 Ga0070714_1000508162 95
91 3300005435 Ga0070714_100106907 Ga0070714_1001069074 95
92 3300005435 Ga0070714_100172145 Ga0070714_1001721454 95
93 3300005435 Ga0070714_100416896 Ga0070714_1004168962 95
94 3300005436 Ga0070713_100029034 Ga0070713_1000290346 95
95 3300005436 Ga0070713_100054419 Ga0070713_1000544195 95
96 3300005436 Ga0070713_100114150 Ga0070713_1001141503 95
97 3300005436 Ga0070713_101909018 Ga0070713_1019090181 95
98 3300005437 Ga0070710_10007726 Ga0070710_100077266 95
99 3300005439 Ga0070711_100031534 Ga0070711_1000315345 95
100 3300005439 Ga0070711_101046150 Ga0070711_1010461502 95
101 3300005440 Ga0070705_100834774 Ga0070705_1008347741 95
102 3300005441 Ga0070700_100156540 Ga0070700_1001565402 95
103 3300005444 Ga0070694_101103257 Ga0070694_1011032572 95
104 3300005445 Ga0070708_101234786 Ga0070708_1012347862 95
105 3300005445 Ga0070708_101807674 Ga0070708_1018076741 95
106 3300005456 Ga0070678_100662154 Ga0070678_1006621542 95
107 3300005458 Ga0070681_10372808 Ga0070681_103728082 95
108 3300005458 Ga0070681_10935539 Ga0070681_109355392 95
109 3300005468 Ga0070707_100846238 Ga0070707_1008462382 95
110 3300005471 Ga0070698_100152739 Ga0070698_1001527394 95
111 3300005471 Ga0070698_100751000 Ga0070698_1007510002 95
112 3300005518 Ga0070699_100209676 Ga0070699_1002096762 95
113 3300005530 Ga0070679_100262111 Ga0070679_1002621114 95
114 3300005530 Ga0070679_100421654 Ga0070679_1004216541 95
115 3300005530 Ga0070679_100557141 Ga0070679_1005571413 95
116 3300005530 Ga0070679_101925900 Ga0070679_1019259002 95
117 3300005535 Ga0070684_100213157 Ga0070684_1002131573 95
118 3300005545 Ga0070695_100000393 Ga0070695_10000039311 95
119 3300005547 Ga0070693_100130382 Ga0070693_1001303821 95
120 3300005548 Ga0070665_102647762 Ga0070665_1026477622 95
121 3300005563 Ga0068855_100454303 Ga0068855_1004543033 95
122 3300005563 Ga0068855_101612540 Ga0068855_1016125402 95
123 3300005563 Ga0068855_101637636 Ga0068855_1016376362 95
124 3300005564 Ga0070664_100116565 Ga0070664_1001165653 95
125 3300005577 Ga0068857_100622715 Ga0068857_1006227152 95
126 3300005578 Ga0068854_100364816 Ga0068854_1003648162 95
127 3300005614 Ga0068856_100878027 Ga0068856_1008780272 95
128 3300005614 Ga0068856_101238604 Ga0068856_1012386042 95
129 3300005616 Ga0068852_100159024 Ga0068852_1001590244 95
130 3300005618 Ga0068864_101111706 Ga0068864_1011117062 95
131 3300005842 Ga0068858_102546356 Ga0068858_1025463561 95
132 3300005937 Ga0081455_10037432 Ga0081455_100374326 95
133 3300005981 Ga0081538_10001113 Ga0081538_1000111332 95
134 3300005981 Ga0081538_10011209 Ga0081538_100112096 95
135 3300005985 Ga0081539_10016103 Ga0081539_100161036 95
136 3300006028 Ga0070717_10028548 Ga0070717_100285484 95
137 3300006028 Ga0070717_10124547 Ga0070717_101245472 95
138 3300006028 Ga0070717_10400465 Ga0070717_104004653 95
139 3300006173 Ga0070716_100016476 Ga0070716_1000164761 95
140 3300006175 Ga0070712_100122418 Ga0070712_1001224185 95
141 3300006194 Ga0075427_10000590 Ga0075427_100005903 95
142 3300006844 Ga0075428_100029322 Ga0075428_1000293225 95
143 3300006844 Ga0075428_100200463 Ga0075428_1002004633 95
144 3300006846 Ga0075430_100007745 Ga0075430_1000077456 95
145 3300006847 Ga0075431_100020961 Ga0075431_1000209615 95
146 3300006847 Ga0075431_100335778 Ga0075431_1003357782 95
147 3300006852 Ga0075433_10013824 Ga0075433_100138249 95
148 3300006852 Ga0075433_10013946 Ga0075433_100139464 95
149 3300006871 Ga0075434_100018664 Ga0075434_1000186648 95
150 3300006871 Ga0075434_100183739 Ga0075434_1001837391 95
151 3300006880 Ga0075429_100024384 Ga0075429_1000243843 95
152 3300006914 Ga0075436_100919114 Ga0075436_1009191142 95
153 3300007076 Ga0075435_100583535 Ga0075435_1005835352 95
154 3300007076 Ga0075435_101229320 Ga0075435_1012293202 95
155 3300007076 Ga0075435_101254532 Ga0075435_1012545321 95
156 3300009093 Ga0105240_10024931 Ga0105240_100249315 95
157 3300009093 Ga0105240_10200209 Ga0105240_102002095 95
158 3300009093 Ga0105240_10756032 Ga0105240_107560322 95
159 3300009093 Ga0105240_11104345 Ga0105240_111043452 95
160 3300009094 Ga0111539_10028289 Ga0111539_100282894 95
161 3300009094 Ga0111539_10427798 Ga0111539_104277983 95
162 3300009098 Ga0105245_10212951 Ga0105245_102129513 95
163 3300009098 Ga0105245_10264112 Ga0105245_102641123 95
164 3300009147 Ga0114129_10012071 Ga0114129_1001207115 95
165 3300009147 Ga0114129_10043881 Ga0114129_100438812 95
166 3300009174 Ga0105241_10923862 Ga0105241_109238622 95
167 3300009177 Ga0105248_10655463 Ga0105248_106554632 95
168 3300009545 Ga0105237_10959375 Ga0105237_109593752 95
169 3300009545 Ga0105237_12745622 Ga0105237_127456222 95
170 3300009551 Ga0105238_10189611 Ga0105238_101896113 95
171 3300013100 Ga0157373_10524082 Ga0157373_105240822 95
172 3300013102 Ga0157371_11217932 Ga0157371_112179321 95
173 3300013102 Ga0157371_11537898 Ga0157371_115378982 95
174 3300013104 Ga0157370_10016123 Ga0157370_100161235 95
175 3300013104 Ga0157370_10022411 Ga0157370_100224116 95
176 3300013104 Ga0157370_11005617 Ga0157370_110056172 95
177 3300013104 Ga0157370_11023825 Ga0157370_110238252 95
178 3300013105 Ga0157369_10255103 Ga0157369_102551033 95
179 3300013105 Ga0157369_10539709 Ga0157369_105397093 95
180 3300013296 Ga0157374_10030374 Ga0157374_100303746 95
181 3300013307 Ga0157372_10021043 Ga0157372_100210435 95
182 3300013307 Ga0157372_10276256 Ga0157372_102762562 95
183 3300013307 Ga0157372_11417669 Ga0157372_114176692 95
184 3300013307 Ga0157372_11535550 Ga0157372_115355502 95
185 3300014325 Ga0163163_12635275 Ga0163163_126352751 95
186 3300014326 Ga0157380_10198918 Ga0157380_101989182 95
187 3300014497 Ga0182008_10044103 Ga0182008_100441033 95
188 3300014497 Ga0182008_10159391 Ga0182008_101593912 95
189 3300014745 Ga0157377_10825116 Ga0157377_108251162 95
190 3300014968 Ga0157379_11140813 Ga0157379_111408132 95
191 3300015261 Ga0182006_1215840 Ga0182006_12158402 95
192 3300015265 Ga0182005_1249758 Ga0182005_12497582 95
193 3300020070 Ga0206356_11791757 Ga0206356_117917573 95
194 3300020081 Ga0206354_10534634 Ga0206354_105346343 95
195 3300025898 Ga0207692_10769539 Ga0207692_107695392 95
196 3300025905 Ga0207685_10415115 Ga0207685_104151152 95
197 3300025906 Ga0207699_10049801 Ga0207699_100498012 95
198 3300025906 Ga0207699_10050976 Ga0207699_100509764 95
199 3300025906 Ga0207699_10213505 Ga0207699_102135052 95
200 3300025906 Ga0207699_10860877 Ga0207699_108608772 95
201 3300025909 Ga0207705_10012826 Ga0207705_1001282611 95
202 3300025909 Ga0207705_10164124 Ga0207705_101641242 95
203 3300025909 Ga0207705_10362974 Ga0207705_103629743 95
204 3300025912 Ga0207707_10154079 Ga0207707_101540791 95
205 3300025912 Ga0207707_10657421 Ga0207707_106574212 95
206 3300025913 Ga0207695_10177963 Ga0207695_101779632 95
207 3300025913 Ga0207695_10237900 Ga0207695_102379002 95
208 3300025914 Ga0207671_10164564 Ga0207671_101645644 95
209 3300025915 Ga0207693_10000964 Ga0207693_1000096414 95
210 3300025916 Ga0207663_10030999 Ga0207663_100309994 95
211 3300025917 Ga0207660_10128139 Ga0207660_101281393 95
212 3300025917 Ga0207660_11185890 Ga0207660_111858902 95
213 3300025919 Ga0207657_10013269 Ga0207657_100132699 95
214 3300025919 Ga0207657_10192349 Ga0207657_101923492 95
215 3300025919 Ga0207657_10274661 Ga0207657_102746613 95
216 3300025920 Ga0207649_10139689 Ga0207649_101396893 95
217 3300025920 Ga0207649_10353800 Ga0207649_103538002 95
218 3300025921 Ga0207652_10154228 Ga0207652_101542282 95
219 3300025921 Ga0207652_10941014 Ga0207652_109410142 95
220 3300025922 Ga0207646_10424447 Ga0207646_104244472 95
221 3300025924 Ga0207694_10224550 Ga0207694_102245503 95
222 3300025927 Ga0207687_10186143 Ga0207687_101861433 95
223 3300025927 Ga0207687_11355093 Ga0207687_113550932 95
224 3300025928 Ga0207700_10008053 Ga0207700_100080536 95
225 3300025928 Ga0207700_10047569 Ga0207700_100475696 95
226 3300025928 Ga0207700_11875538 Ga0207700_118755382 95
227 3300025929 Ga0207664_10005790 Ga0207664_100057906 95
228 3300025929 Ga0207664_10077497 Ga0207664_100774972 95
229 3300025929 Ga0207664_10165711 Ga0207664_101657112 95
230 3300025929 Ga0207664_10211736 Ga0207664_102117362 95
231 3300025929 Ga0207664_10365407 Ga0207664_103654072 95
232 3300025929 Ga0207664_10473922 Ga0207664_104739223 95
233 3300025929 Ga0207664_10487097 Ga0207664_104870972 95
234 3300025929 Ga0207664_10868285 Ga0207664_108682852 95
235 3300025931 Ga0207644_10288647 Ga0207644_102886471 95
236 3300025931 Ga0207644_11008232 Ga0207644_110082322 95
237 3300025932 Ga0207690_10029640 Ga0207690_100296404 95
238 3300025932 Ga0207690_10335033 Ga0207690_103350333 95
239 3300025937 Ga0207669_10135749 Ga0207669_101357492 95
240 3300025938 Ga0207704_10148872 Ga0207704_101488722 95
241 3300025939 Ga0207665_10013449 Ga0207665_100134496 95
242 3300025940 Ga0207691_10760564 Ga0207691_107605642 95
243 3300025941 Ga0207711_10397713 Ga0207711_103977131 95
244 3300025941 Ga0207711_11341213 Ga0207711_113412132 95
245 3300025945 Ga0207679_10092077 Ga0207679_100920772 95
246 3300025949 Ga0207667_10223449 Ga0207667_102234491 95
247 3300025949 Ga0207667_11052084 Ga0207667_110520842 95
248 3300026041 Ga0207639_11469845 Ga0207639_114698451 95
249 3300026067 Ga0207678_10274274 Ga0207678_102742742 95
250 3300026075 Ga0207708_10225274 Ga0207708_102252742 95
251 3300026078 Ga0207702_10391668 Ga0207702_103916682 95
252 3300026078 Ga0207702_12341002 Ga0207702_123410022 95
253 3300026095 Ga0207676_11420523 Ga0207676_114205232 95
254 3300026116 Ga0207674_10431926 Ga0207674_104319263 95
255 3300026121 Ga0207683_10634836 Ga0207683_106348362 95
256 3300026142 Ga0207698_10067080 Ga0207698_100670803 95
257 3300027907 Ga0207428_10001190 Ga0207428_1000119018 95
258 3300028556 Ga0265337_1057367 Ga0265337_10573673 95
259 3300028556 Ga0265337_1063791 Ga0265337_10637912 95
260 3300028556 Ga0265337_1093821 Ga0265337_10938212 95
261 3300028558 Ga0265326_10022511 Ga0265326_100225111 95
262 3300028563 Ga0265319_1002310 Ga0265319_10023106 95
263 3300028563 Ga0265319_1002945 Ga0265319_10029457 95
264 3300028563 Ga0265319_1054326 Ga0265319_10543263 95
265 3300028573 Ga0265334_10009809 Ga0265334_100098095 95
266 3300028573 Ga0265334_10158113 Ga0265334_101581132 95
267 3300028577 Ga0265318_10002950 Ga0265318_100029505 95
268 3300028577 Ga0265318_10010568 Ga0265318_100105685 95
269 3300028653 Ga0265323_10146950 Ga0265323_101469502 95
270 3300028654 Ga0265322_10009592 Ga0265322_100095923 95
271 3300028654 Ga0265322_10080691 Ga0265322_100806913 95
272 3300028666 Ga0265336_10001570 Ga0265336_1000157011 95
273 3300028666 Ga0265336_10022541 Ga0265336_100225412 95
274 3300028666 Ga0265336_10041327 Ga0265336_100413272 95
275 3300028800 Ga0265338_10004508 Ga0265338_1000450819 95
276 3300028800 Ga0265338_10016515 Ga0265338_1001651512 95
277 3300028800 Ga0265338_10016873 Ga0265338_1001687310 95
278 3300028800 Ga0265338_10021437 Ga0265338_100214377 95
279 3300028800 Ga0265338_10021638 Ga0265338_100216383 95
280 3300028800 Ga0265338_10026870 Ga0265338_100268706 95
281 3300028800 Ga0265338_10045918 Ga0265338_100459186 95
282 3300028800 Ga0265338_10059124 Ga0265338_100591243 95
283 3300029957 Ga0265324_10011282 Ga0265324_100112824 95
284 3300029957 Ga0265324_10277865 Ga0265324_102778652 95
285 3300031235 Ga0265330_10028516 Ga0265330_100285162 95
286 3300031235 Ga0265330_10029044 Ga0265330_100290443 95
287 3300031238 Ga0265332_10014621 Ga0265332_100146212 95
288 3300031238 Ga0265332_10018345 Ga0265332_100183453 95
289 3300031238 Ga0265332_10407797 Ga0265332_104077972 95
290 3300031238 Ga0265332_10486575 Ga0265332_104865751 95
291 3300031239 Ga0265328_10032438 Ga0265328_100324382 95
292 3300031240 Ga0265320_10026485 Ga0265320_100264853 95
293 3300031240 Ga0265320_10064391 Ga0265320_100643913 95
294 3300031241 Ga0265325_10000453 Ga0265325_1000045326 95
295 3300031242 Ga0265329_10004254 Ga0265329_100042547 95
296 3300031242 Ga0265329_10104851 Ga0265329_101048513 95
297 3300031247 Ga0265340_10003413 Ga0265340_1000341310 95
298 3300031247 Ga0265340_10037720 Ga0265340_100377202 95
299 3300031249 Ga0265339_10005781 Ga0265339_100057815 95
300 3300031249 Ga0265339_10031744 Ga0265339_100317444 95
301 3300031249 Ga0265339_10036063 Ga0265339_100360633 95
302 3300031249 Ga0265339_10044507 Ga0265339_100445074 95
303 3300031250 Ga0265331_10012453 Ga0265331_100124533 95
304 3300031250 Ga0265331_10030466 Ga0265331_100304664 95
305 3300031250 Ga0265331_10045650 Ga0265331_100456502 95
306 3300031251 Ga0265327_10010269 Ga0265327_100102697 95
307 3300031251 Ga0265327_10012478 Ga0265327_100124787 95
308 3300031251 Ga0265327_10032624 Ga0265327_100326244 95
309 3300031251 Ga0265327_10121724 Ga0265327_101217242 95
310 3300031344 Ga0265316_10033792 Ga0265316_100337922 95
311 3300031344 Ga0265316_10052875 Ga0265316_100528755 95
312 3300031344 Ga0265316_10455245 Ga0265316_104552452 95
313 3300031595 Ga0265313_10025257 Ga0265313_100252575 95
314 3300031595 Ga0265313_10043563 Ga0265313_100435632 95
315 3300031595 Ga0265313_10049938 Ga0265313_100499382 95
316 3300031711 Ga0265314_10002833 Ga0265314_100028332 95
317 3300031711 Ga0265314_10022158 Ga0265314_100221584 95
318 3300031712 Ga0265342_10002319 Ga0265342_100023194 95
319 3300031712 Ga0265342_10030763 Ga0265342_100307636 95
320 3300031731 Ga0307405_10020909 Ga0307405_100209095 95
321 3300031824 Ga0307413_10203025 Ga0307413_102030251 95
322 3300031824 Ga0307413_10302607 Ga0307413_103026072 95
323 3300031852 Ga0307410_10239301 Ga0307410_102393012 95
324 3300031852 Ga0307410_10736049 Ga0307410_107360492 95
325 3300031852 Ga0307410_10751081 Ga0307410_107510812 95
326 3300031901 Ga0307406_10057377 Ga0307406_100573773 95
327 3300031901 Ga0307406_10256491 Ga0307406_102564912 95
328 3300031901 Ga0307406_12000520 Ga0307406_120005201 95
329 3300031903 Ga0307407_10011507 Ga0307407_100115072 95
330 3300031903 Ga0307407_10267836 Ga0307407_102678362 95
331 3300031911 Ga0307412_10209278 Ga0307412_102092782 95
332 3300031995 Ga0307409_100082779 Ga0307409_1000827792 95
333 3300031995 Ga0307409_100376968 Ga0307409_1003769682 95
334 3300032002 Ga0307416_100000306 Ga0307416_1000003063 95
335 3300032002 Ga0307416_100065882 Ga0307416_1000658824 95
336 3300032002 Ga0307416_100100885 Ga0307416_1001008851 95
337 3300032002 Ga0307416_100844102 Ga0307416_1008441022 95
338 3300032002 Ga0307416_102613189 Ga0307416_1026131891 95
339 3300032004 Ga0307414_10503769 Ga0307414_105037692 95
340 3300032004 Ga0307414_11347049 Ga0307414_113470492 95
341 3300032005 Ga0307411_10030410 Ga0307411_100304102 95
342 3300032126 Ga0307415_100000930 Ga0307415_10000093015 95
343 3300032126 Ga0307415_100062175 Ga0307415_1000621754 95
344 3300032126 Ga0307415_100158116 Ga0307415_1001581162 95
345 3300032126 Ga0307415_100513206 Ga0307415_1005132063 95
346 3300032126 Ga0307415_100697687 Ga0307415_1006976872 95
347 3300035086 Ga0373934_0089974 Ga0373934_0089974_848_1135 95
348 3300035091 Ga0373951_0035178 Ga0373951_0035178_217_504 95
349 3300035114 Ga0373939_0149791 Ga0373939_0149791_144_431 95
350 3300035118 Ga0373954_0066752 Ga0373954_0066752_648_935 95
351 3300035120 Ga0373957_0361873 Ga0373957_0361873_54_341 95
352 3300035172 Ga0373955_0148769 Ga0373955_0148769_593_880 95
353 3300035410 Ga0373924_0255472 Ga0373924_0255472_162_449 95
354 3300036401 Ga0373937_0184320 Ga0373937_0184320_41_328 95
355 3300036401 Ga0373937_0455363 Ga0373937_0455363_339_626 95
356 3300037312 Ga0395899_0040170 Ga0395899_0040170_1575_1862 95
357 3300037312 Ga0395899_0450104 Ga0395899_0450104_526_816 95
358 3300037418 Ga0395900_0178615 Ga0395900_0178615_358_645 95
359 3300037418 Ga0395900_0276795 Ga0395900_0276795_183_473 95
360 3300037418 Ga0395900_0849191 Ga0395900_0849191_220_516 95
361 3300037418 Ga0395900_0883116 Ga0395900_0883116_295_585 95
362 3300037418 Ga0395900_1656174 Ga0395900_1656174_114_404 95
363 3300037466 Ga0395898_0075428 Ga0395898_0075428_154_462 95
364 3300037466 Ga0395898_0153315 Ga0395898_0153315_1282_1572 95
365 3300037466 Ga0395898_0338849 Ga0395898_0338849_27_317 95
366 3300037466 Ga0395898_0351996 Ga0395898_0351996_556_843 95
367 3300037466 Ga0395898_1226098 Ga0395898_1226098_46_342 95
368 3300037466 Ga0395898_1373564 Ga0395898_1373564_319_609 95
369 3300037471 Ga0395905_0150706 Ga0395905_0150706_583_870 95
370 3300037471 Ga0395905_0344112 Ga0395905_0344112_234_542 95
371 3300038443 Ga0395901_0252028 Ga0395901_0252028_1174_1464 95
372 3300038443 Ga0395901_0269636 Ga0395901_0269636_952_1242 95
373 3300038443 Ga0395901_0590990 Ga0395901_0590990_192_482 95
374 3300038443 Ga0395901_0730722 Ga0395901_0730722_273_569 95
375 3300038443 Ga0395901_1304902 Ga0395901_1304902_369_656 95
376 3300039450 Ga0436363_0839180 Ga0436363_0839180_262_549 95
377 3300042005 Ga0439448_0030869 Ga0439448_0030869_1190_1492 95
378 3300042118 Ga0450914_046087 Ga0450914_046087_175_477 95
379 3300042157 Ga0439458_0074899 Ga0439458_0074899_364_654 95
380 3300042993 Ga0439440_0020634 Ga0439440_0020634_831_1133 95
381 3300042993 Ga0439440_0104752 Ga0439440_0104752_396_686 95
382 3300042993 Ga0439440_0153640 Ga0439440_0153640_221_511 95
383 3300044656 Ga0466969_0041058 Ga0466969_0041058_480_779 95
384 3300044658 Ga0466972_0207411 Ga0466972_0207411_455_754 95
385 3300044684 Ga0466966_0036173 Ga0466966_0036173_1306_1605 95
386 3300044693 Ga0466961_0140424 Ga0466961_0140424_111_410 95
387 3300044693 Ga0466961_0177989 Ga0466961_0177989_592_891 95
388 3300044694 Ga0466963_0004956 Ga0466963_0004956_2166_2465 95
389 3300044694 Ga0466963_0008918 Ga0466963_0008918_3390_3689 95
390 3300044694 Ga0466963_0014973 Ga0466963_0014973_173_472 95
391 3300044694 Ga0466963_0064071 Ga0466963_0064071_1726_2025 95
392 3300044694 Ga0466963_0088074 Ga0466963_0088074_1774_2073 95
393 3300044694 Ga0466963_0169355 Ga0466963_0169355_662_961 95
394 3300044694 Ga0466963_0314891 Ga0466963_0314891_753_1043 95
395 3300044694 Ga0466963_0749912 Ga0466963_0749912_311_598 95
396 3300044694 Ga0466963_0874936 Ga0466963_0874936_162_452 95
397 3300044694 Ga0466963_0919930 Ga0466963_0919930_159_449 95
398 3300044694 Ga0466963_1337025 Ga0466963_1337025_52_342 95
399 3300044706 Ga0466964_0001680 Ga0466964_0001680_6254_6553 95
400 3300044706 Ga0466964_0001976 Ga0466964_0001976_4677_4976 95
401 3300044706 Ga0466964_0069379 Ga0466964_0069379_18_317 95
402 3300044706 Ga0466964_0306683 Ga0466964_0306683_368_667 95
403 3300044719 Ga0466971_0004164 Ga0466971_0004164_3094_3393 95
404 3300044719 Ga0466971_0063093 Ga0466971_0063093_1104_1403 95
405 3300044719 Ga0466971_0099539 Ga0466971_0099539_486_785 95
406 3300044719 Ga0466971_0127653 Ga0466971_0127653_92_382 95
407 3300044719 Ga0466971_0144444 Ga0466971_0144444_789_1076 95
408 3300044719 Ga0466971_0204630 Ga0466971_0204630_131_430 95
409 3300044735 Ga0466968_0001841 Ga0466968_0001841_5164_5463 95
410 3300044735 Ga0466968_0036892 Ga0466968_0036892_746_1045 95
411 3300044735 Ga0466968_0061994 Ga0466968_0061994_720_1019 95
412 3300044735 Ga0466968_0091241 Ga0466968_0091241_319_609 95
413 3300044735 Ga0466968_0353674 Ga0466968_0353674_121_411 95
414 3300044765 Ga0466970_0055263 Ga0466970_0055263_172_471 95
415 3300044765 Ga0466970_0228513 Ga0466970_0228513_447_746 95
416 3300044842 Ga0466957_0000839 Ga0466957_0000839_1727_2026 95
417 3300044842 Ga0466957_0005602 Ga0466957_0005602_66_365 95
418 3300044842 Ga0466957_0011876 Ga0466957_0011876_4698_4997 95
419 3300044842 Ga0466957_0014602 Ga0466957_0014602_4238_4537 95
420 3300044842 Ga0466957_0055290 Ga0466957_0055290_1975_2262 95
421 3300044842 Ga0466957_0363862 Ga0466957_0363862_249_548 95
422 3300044842 Ga0466957_0537836 Ga0466957_0537836_54_395 95
423 3300044842 Ga0466957_0945702 Ga0466957_0945702_75_365 95
424 3300045049 Ga0466959_0002503 Ga0466959_0002503_8850_9149 95
425 3300045049 Ga0466959_0133999 Ga0466959_0133999_1001_1300 95
426 3300045049 Ga0466959_0260048 Ga0466959_0260048_535_825 95
427 3300045049 Ga0466959_0543850 Ga0466959_0543850_105_404 95
428 3300045836 Ga0466958_0001766 Ga0466958_0001766_8652_8951 95
429 3300045836 Ga0466958_0004935 Ga0466958_0004935_2621_2920 95
430 3300045836 Ga0466958_0028945 Ga0466958_0028945_945_1244 95
431 3300045836 Ga0466958_0165325 Ga0466958_0165325_261_560 95
432 3300045836 Ga0466958_0326668 Ga0466958_0326668_31_321 95
433 3300045836 Ga0466958_0439240 Ga0466958_0439240_134_421 95
434 3300045976 Ga0466967_0005346 Ga0466967_0005346_6909_7208 95
435 3300045976 Ga0466967_0006620 Ga0466967_0006620_4152_4451 95
436 3300045976 Ga0466967_0008127 Ga0466967_0008127_62_361 95
437 3300045976 Ga0466967_0009557 Ga0466967_0009557_2576_2863 95
438 3300045976 Ga0466967_0034363 Ga0466967_0034363_2984_3325 95
439 3300045976 Ga0466967_0074693 Ga0466967_0074693_1527_1826 95
440 3300045976 Ga0466967_0091170 Ga0466967_0091170_2305_2604 95
441 3300045976 Ga0466967_0112223 Ga0466967_0112223_1788_2075 95
442 3300045976 Ga0466967_0129314 Ga0466967_0129314_1282_1572 95
443 3300045976 Ga0466967_0173973 Ga0466967_0173973_1504_1794 95
444 3300045976 Ga0466967_0192421 Ga0466967_0192421_678_968 95
445 3300045976 Ga0466967_0197028 Ga0466967_0197028_1028_1315 95
446 3300045976 Ga0466967_0317509 Ga0466967_0317509_194_484 95
447 3300045976 Ga0466967_0406344 Ga0466967_0406344_736_1035 95
448 3300045976 Ga0466967_1268203 Ga0466967_1268203_98_388 95
449 3300045976 Ga0466967_1312219 Ga0466967_1312219_299_589 95
450 3300045976 Ga0466967_1365879 Ga0466967_1365879_252_545 95
451 3300045976 Ga0466967_2054956 Ga0466967_2054956_108_395 95
452 3300046454 Ga0495592_0112615 Ga0495592_0112615_186_485 95
453 3300046462 Ga0495651_0121844 Ga0495651_0121844_1356_1643 95
454 3300046463 Ga0495653_0364669 Ga0495653_0364669_500_787 95
455 3300046473 Ga0495582_0708626 Ga0495582_0708626_92_391 95
456 3300046511 Ga0495608_0047598 Ga0495608_0047598_515_802 95
457 3300046511 Ga0495608_0929760 Ga0495608_0929760_102_389 95
458 3300046514 Ga0495618_0045317 Ga0495618_0045317_1626_1937 95
459 3300046514 Ga0495618_0576770 Ga0495618_0576770_166_453 95
460 3300046516 Ga0495628_0307212 Ga0495628_0307212_501_788 95
461 3300046517 Ga0495630_0167052 Ga0495630_0167052_925_1224 95
462 3300046517 Ga0495630_0529115 Ga0495630_0529115_298_585 95
463 3300046517 Ga0495630_0709201 Ga0495630_0709201_37_324 95
464 3300046533 Ga0495640_0016020 Ga0495640_0016020_3476_3787 95
465 3300046543 Ga0495645_0451700 Ga0495645_0451700_458_745 95
466 3300046559 Ga0495667_0306847 Ga0495667_0306847_255_542 95
467 3300046642 Ga0495634_0056266 Ga0495634_0056266_695_1006 95
468 3300046642 Ga0495634_0201502 Ga0495634_0201502_119_406 95
469 3300046663 Ga0495635_0013904 Ga0495635_0013904_4604_4915 95
470 3300046663 Ga0495635_0062502 Ga0495635_0062502_134_421 95
471 3300046663 Ga0495635_0351977 Ga0495635_0351977_361_648 95
472 3300046675 Ga0495657_0129175 Ga0495657_0129175_1015_1302 95
473 3300046675 Ga0495657_0549142 Ga0495657_0549142_278_577 95
474 3300046675 Ga0495657_0892697 Ga0495657_0892697_207_494 95
475 3300046680 Ga0495646_0301132 Ga0495646_0301132_367_678 95
476 3300046689 Ga0495613_0394405 Ga0495613_0394405_223_510 95
477 3300046689 Ga0495613_0750231 Ga0495613_0750231_318_605 95
478 3300047317 Ga0495604_0169862 Ga0495604_0169862_1028_1315 95
479 3300047318 Ga0495636_0366278 Ga0495636_0366278_181_468 95
480 3300047319 Ga0495674_0090385 Ga0495674_0090385_1985_2296 95
481 3300047319 Ga0495674_0770242 Ga0495674_0770242_207_518 95
482 3300047322 Ga0495680_0839345 Ga0495680_0839345_27_314 95
483 3300047322 Ga0495680_1060270 Ga0495680_1060270_146_433 95
484 3300047322 Ga0495680_1083873 Ga0495680_1083873_165_452 95
485 3300047444 Ga0495675_0306137 Ga0495675_0306137_600_887 95
486 3300047471 Ga0495684_0097766 Ga0495684_0097766_1798_2097 95
487 3300047471 Ga0495684_0103387 Ga0495684_0103387_799_1086 95
488 3300047471 Ga0495684_0285790 Ga0495684_0285790_164_475 95
489 3300048088 Ga0495602_0777455 Ga0495602_0777455_230_529 95
490 3300048088 Ga0495602_1088199 Ga0495602_1088199_54_341 95
491 3300048903 Ga0496100_0012368 Ga0496100_0012368_1238_1525 95
492 3300048905 Ga0496102_0032716 Ga0496102_0032716_2207_2494 95
493 3300048905 Ga0496102_0236273 Ga0496102_0236273_845_1144 95
494 3300048906 Ga0496103_0019776 Ga0496103_0019776_1740_2039 95
495 3300048906 Ga0496103_0077535 Ga0496103_0077535_220_507 95
496 3300048907 Ga0496104_0497929 Ga0496104_0497929_736_1023 95
497 3300048908 Ga0496105_0057053 Ga0496105_0057053_146_433 95
498 3300048909 Ga0496106_0030374 Ga0496106_0030374_2285_2572 95
499 3300048910 Ga0496107_0059855 Ga0496107_0059855_1459_1746 95
500 3300048911 Ga0496108_0031623 Ga0496108_0031623_2786_3073 95
501 3300048912 Ga0496109_0053696 Ga0496109_0053696_1232_1519 95
502 3300048913 Ga0496110_0038024 Ga0496110_0038024_2543_2830 95
503 3300048913 Ga0496110_0485280 Ga0496110_0485280_337_636 95
504 3300048914 Ga0496111_0021414 Ga0496111_0021414_2199_2486 95
505 3300048914 Ga0496111_0700314 Ga0496111_0700314_14_301 95
506 3300048915 Ga0496112_0047465 Ga0496112_0047465_205_492 95
507 3300048915 Ga0496112_0068960 Ga0496112_0068960_601_900 95
508 3300048915 Ga0496112_0102958 Ga0496112_0102958_1221_1520 95
509 3300048915 Ga0496112_0472137 Ga0496112_0472137_18_305 95
510 3300048915 Ga0496112_0757643 Ga0496112_0757643_486_773 95
511 3300048916 Ga0496113_0040740 Ga0496113_0040740_2003_2290 95
512 3300048916 Ga0496113_0304233 Ga0496113_0304233_417_710 95
513 3300048916 Ga0496113_0802609 Ga0496113_0802609_22_321 95
514 3300048916 Ga0496113_0955262 Ga0496113_0955262_127_426 95
515 3300048917 Ga0496114_0068218 Ga0496114_0068218_130_417 95
516 3300048918 Ga0496115_0096138 Ga0496115_0096138_1071_1370 95
517 3300049568 Ga0501031_0001219 Ga0501031_0001219_4178_4477 95
518 3300049569 Ga0501032_0136844 Ga0501032_0136844_1009_1308 95
519 3300049570 Ga0501033_0013698 Ga0501033_0013698_1825_2124 95
520 3300049571 Ga0501034_0004154 Ga0501034_0004154_3931_4218 95
521 3300049571 Ga0501034_1029845 Ga0501034_1029845_337_636 95
522 3300049572 Ga0501036_0001012 Ga0501036_0001012_4179_4478 95
523 3300049573 Ga0501037_0118841 Ga0501037_0118841_1102_1401 95
524 3300049574 Ga0501038_0131989 Ga0501038_0131989_403_702 95
525 3300049575 Ga0501039_0000777 Ga0501039_0000777_11253_11552 95
526 3300049576 Ga0501040_0000970 Ga0501040_0000970_1889_2188 95
527 3300049577 Ga0501041_0000521 Ga0501041_0000521_8168_8467 95
528 3300049578 Ga0501042_0000384 Ga0501042_0000384_12480_12779 95
529 3300049579 Ga0501043_0005685 Ga0501043_0005685_2952_3251 95
530 3300049580 Ga0501046_0005314 Ga0501046_0005314_9674_9973 95
531 3300049582 Ga0501048_0000488 Ga0501048_0000488_15997_16296 95
532 3300049583 Ga0501067_0076281 Ga0501067_0076281_880_1167 95
533 3300049583 Ga0501067_0106131 Ga0501067_0106131_348_635 95
534 3300049583 Ga0501067_0156485 Ga0501067_0156485_79_378 95
535 3300049583 Ga0501067_0841133 Ga0501067_0841133_67_357 95
536 3300049584 Ga0501068_0081940 Ga0501068_0081940_1085_1384 95
537 3300049585 Ga0501069_0029782 Ga0501069_0029782_1746_2033 95
538 3300049585 Ga0501069_0314783 Ga0501069_0314783_213_500 95
539 3300049586 Ga0501070_0005070 Ga0501070_0005070_10799_11086 95
540 3300049586 Ga0501070_0050585 Ga0501070_0050585_606_896 95
541 3300049586 Ga0501070_0507919 Ga0501070_0507919_89_388 95
542 3300049587 Ga0501071_0001049 Ga0501071_0001049_4636_4935 95
543 3300049588 Ga0501072_0002834 Ga0501072_0002834_10420_10719 95
544 3300049588 Ga0501072_0015504 Ga0501072_0015504_1039_1329 95
545 3300049589 Ga0501073_0115410 Ga0501073_0115410_1001_1300 95
546 3300049589 Ga0501073_0242548 Ga0501073_0242548_602_892 95
547 3300049590 Ga0501074_0001561 Ga0501074_0001561_11345_11644 95
548 3300049590 Ga0501074_0010895 Ga0501074_0010895_740_1027 95
549 3300049590 Ga0501074_0029258 Ga0501074_0029258_1070_1360 95
550 3300049591 Ga0501075_0007067 Ga0501075_0007067_1927_2226 95
551 3300049592 Ga0501076_0000670 Ga0501076_0000670_11403_11702 95
552 3300049593 Ga0501077_0000979 Ga0501077_0000979_7249_7548 95
553 3300049741 Ga0501079_0000766 Ga0501079_0000766_10375_10674 95
554 3300049741 Ga0501079_0094604 Ga0501079_0094604_1865_2155 95
555 3300049742 Ga0501080_0002096 Ga0501080_0002096_8428_8715 95
556 3300049742 Ga0501080_0004391 Ga0501080_0004391_10318_10617 95
557 3300049742 Ga0501080_0065727 Ga0501080_0065727_26_316 95
558 3300049743 Ga0501081_0000421 Ga0501081_0000421_9865_10164 95
559 3300049744 Ga0501083_0009464 Ga0501083_0009464_3226_3516 95
560 3300049744 Ga0501083_0032395 Ga0501083_0032395_2076_2375 95
561 3300049822 Ga0501035_0009537 Ga0501035_0009537_7059_7358 95
562 3300049823 Ga0501044_0174414 Ga0501044_0174414_845_1144 95
563 3300049823 Ga0501044_0608092 Ga0501044_0608092_526_813 95
564 3300049824 Ga0501045_0001105 Ga0501045_0001105_15664_15963 95
565 3300050507 nmdc:mga05p37_19132_c1 nmdc:mga05p37_19132_c1_6559_6849 95
566 3300050507 nmdc:mga05p37_56249_c1 nmdc:mga05p37_56249_c1_1724_2014 95
567 3300050508 nmdc:mga09592_32597_c1 nmdc:mga09592_32597_c1_749_1039 95
568 3300050509 nmdc:mga0qj67_6104_c1 nmdc:mga0qj67_6104_c1_6945_7235 95
569 3300050510 nmdc:mga06r32_473678_c1 nmdc:mga06r32_473678_c1_804_1091 95
570 3300050510 nmdc:mga06r32_571254_c1 nmdc:mga06r32_571254_c1_621_911 95
571 3300050510 nmdc:mga06r32_7228_c1 nmdc:mga06r32_7228_c1_6324_6614 95
572 3300050511 nmdc:mga08y16_493_c1 nmdc:mga08y16_493_c1_2889_3179 95
573 3300050512 nmdc:mga0n895_13975_c1 nmdc:mga0n895_13975_c1_1875_2165 95
574 3300050512 nmdc:mga0n895_511440_c1 nmdc:mga0n895_511440_c1_814_1119 95
575 3300050512 nmdc:mga0n895_89825_c1 nmdc:mga0n895_89825_c1_2018_2308 95
576 3300050513 nmdc:mga0rr50_100538_c1 nmdc:mga0rr50_100538_c1_1654_1944 95
577 3300050513 nmdc:mga0rr50_1297854_c1 nmdc:mga0rr50_1297854_c1_281_571 95
578 3300050515 nmdc:mga0a205_44534_c3 nmdc:mga0a205_44534_c3_278_568 95
579 3300050515 nmdc:mga0a205_6411_c1 nmdc:mga0a205_6411_c1_6884_7174 95
580 3300053077 Ga0495601_0159394 Ga0495601_0159394_716_1027 95
581 3300053077 Ga0495601_0247133 Ga0495601_0247133_670_969 95
582 3300053084 Ga0495595_0364801 Ga0495595_0364801_105_392 95
583 3300053085 Ga0495619_0089025 Ga0495619_0089025_1401_1688 95
584 3300053094 Ga0500566_0253153 Ga0500566_0253153_236_535 95
585 3300054114 Ga0501084_0000718 Ga0501084_0000718_9674_9973 95
586 3300060353 Ga0501082_0004632 Ga0501082_0004632_9616_9915 95
587 3300060353 Ga0501082_0098702 Ga0501082_0098702_1450_1740 95
588 3300061719 Ga0466962_0110085 Ga0466962_0110085_356_655 95
589 3300061719 Ga0466962_0143216 Ga0466962_0143216_30_329 95
590 3300061719 Ga0466962_0178183 Ga0466962_0178183_471_770 95
591 3300061719 Ga0466962_0534266 Ga0466962_0534266_65_364 95
592 3300061734 Ga0530510_0000732 Ga0530510_0000732_9633_9932 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07045

DUF1330

Domain of unknown function (DUF1330)

2

89

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.9344 2 95
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.9318 2 93
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.9068 2 95
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.8946 2 93
3dca-assembly2.cif.gz_D crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target 0.7795 2 95
ID Description Score Start End Superfamily
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8934 1 94 3.30.70.100
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8845 1 94 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8626 1 90 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8286 1 90 3.30.70.100
1si9C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.728 2 92 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2U9SCK0-F1-model_v4 DUF1330 domain-containing protein 0.9963 1 95
AF-A0A2S2CR32-F1-model_v4 DUF1330 domain-containing protein 0.9947 1 95
AF-A0A1A3SNH3-F1-model_v4 DUF1330 domain-containing protein 0.9931 2 95
AF-A0A1J5S512-F1-model_v4 DUF1330 domain-containing protein 0.9919 1 95
AF-A0A258TXZ2-F1-model_v4 deleted 0.9919 2 95

Feature Viewer

pLDDT pTM Quality
95.59 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map