F467159

General Info

Members Datasets Scaffolds Average Seq Length
592 297 1184 158

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0197744|Ga0451576_0197744_654_1172
Length 172
Sequence MGYPYPFLLPGDDIMKGNEKVIAALQEALREELLAINQYFLHAEMCENWHYDKLGSFIKKQSIDEMKHAEEIIERILFLDATPNLTKPMKLSIGKNVRAQLEADLALEISAVKLYNDAVETSREAGDNASRELFERLLKDEEQHVDWLEAQLHQIEEIGYERYLSQQIREEK

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
4 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
203 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
209 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
210 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
211 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
212 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
213 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
214 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
215 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
222 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
223 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
224 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
225 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
226 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
227 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
228 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
235 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
236 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
237 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
238 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
239 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
240 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
241 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
242 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
294 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.51
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.38
Nodule 0
Rhizoplane 0.68
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0197744 3300045051 Bacteria 2100
2 rootH1_10152555 3300003323 Bacteria 1739
3 JGI26143J51219_1006521 3300003502 Bacteria 597
4 JGI26141J51220_1001086 3300003503 Bacteria 1621
5 JGI25405J52794_10043149 3300003911 Bacteria 957
6 Ga0065712_10207024 3300005290 Bacteria 1086
7 Ga0065715_10213587 3300005293 Bacteria 1303
8 Ga0065707_10096390 3300005295 Bacteria 3274
9 Ga0070658_10021790 3300005327 Bacteria 5136
10 Ga0070658_10384940 3300005327 Bacteria 1204
11 Ga0070676_10000185 3300005328 Bacteria 25817
12 Ga0070683_100199468 3300005329 Bacteria 1900
13 Ga0070690_101443248 3300005330 Bacteria 555
14 Ga0070670_100002439 3300005331 Bacteria 15334
15 Ga0070670_100645577 3300005331 Bacteria 949
16 Ga0070677_10026231 3300005333 Bacteria 2183
17 Ga0068869_100000142 3300005334 Bacteria 35247
18 Ga0068869_100003995 3300005334 Bacteria 9121
19 Ga0068869_100033417 3300005334 Bacteria 3631
20 Ga0068869_100128869 3300005334 Bacteria 1943
21 Ga0068869_100373821 3300005334 Bacteria 1167
22 Ga0070680_100011252 3300005336 Bacteria 6918
23 Ga0070680_100124671 3300005336 Bacteria 2152
24 Ga0070682_100000035 3300005337 Bacteria 150016
25 Ga0070682_100000146 3300005337 Bacteria 56419
26 Ga0068868_100001085 3300005338 Bacteria 18627
27 Ga0068868_100348336 3300005338 Bacteria 1268
28 Ga0070660_100826075 3300005339 Bacteria 780
29 Ga0070689_100002053 3300005340 Bacteria 13072
30 Ga0070689_100018382 3300005340 Bacteria 5147
31 Ga0070689_100058857 3300005340 Bacteria 2985
32 Ga0070689_101120911 3300005340 Bacteria 704
33 Ga0070691_10006682 3300005341 Bacteria 5279
34 Ga0070691_10011592 3300005341 Bacteria 4027
35 Ga0070691_10228695 3300005341 Bacteria 989
36 Ga0070687_100012090 3300005343 Bacteria 3799
37 Ga0070687_100052672 3300005343 Bacteria 2113
38 Ga0070661_100000358 3300005344 Bacteria 36016
39 Ga0070661_100710925 3300005344 Bacteria 819
40 Ga0070692_10006276 3300005345 Bacteria 5151
41 Ga0070692_10168656 3300005345 Bacteria 1260
42 Ga0070668_100090229 3300005347 Bacteria 2414
43 Ga0070669_100012038 3300005353 Bacteria 6138
44 Ga0070669_100188676 3300005353 Bacteria 1616
45 Ga0070675_100010352 3300005354 Bacteria 7283
46 Ga0070675_100109877 3300005354 Bacteria 2331
47 Ga0070671_100328645 3300005355 Bacteria 1303
48 Ga0070673_100045697 3300005364 Bacteria 3398
49 Ga0070673_100319120 3300005364 Bacteria 1372
50 Ga0070673_100646681 3300005364 Bacteria 968
51 Ga0070659_100000581 3300005366 Bacteria 26710
52 Ga0070667_100160770 3300005367 Bacteria 1978
53 Ga0070703_10006636 3300005406 Bacteria 3240
54 Ga0070709_10192278 3300005434 Bacteria 1440
55 Ga0070713_100005708 3300005436 Bacteria 8544
56 Ga0070713_100098456 3300005436 Bacteria 2529
57 Ga0070710_10156889 3300005437 Bacteria 1408
58 Ga0070710_10667884 3300005437 Bacteria 730
59 Ga0070701_10008235 3300005438 Bacteria 4497
60 Ga0070701_10060889 3300005438 Bacteria 1989
61 Ga0070711_100584221 3300005439 Bacteria 930
62 Ga0070705_100008834 3300005440 Bacteria 4993
63 Ga0070705_100256376 3300005440 Bacteria 1231
64 Ga0070705_100811824 3300005440 Bacteria 745
65 Ga0070700_101129288 3300005441 Bacteria 651
66 Ga0070694_100000293 3300005444 Bacteria 26864
67 Ga0070694_100283953 3300005444 Bacteria 1263
68 Ga0070663_100002077 3300005455 Bacteria 11190
69 Ga0070663_100061234 3300005455 Bacteria 2710
70 Ga0070663_100780186 3300005455 Bacteria 818
71 Ga0070678_100049337 3300005456 Bacteria 3037
72 Ga0070662_100014404 3300005457 Bacteria 5283
73 Ga0070662_100041160 3300005457 Bacteria 3294
74 Ga0070662_100086824 3300005457 Bacteria 2341
75 Ga0070681_10090947 3300005458 Bacteria 3002
76 Ga0068867_100000681 3300005459 Bacteria 22527
77 Ga0068867_100020571 3300005459 Bacteria 4703
78 Ga0068867_100641262 3300005459 Bacteria 931
79 Ga0070685_10018403 3300005466 Bacteria 3756
80 Ga0070685_10727919 3300005466 Bacteria 725
81 Ga0070706_100795948 3300005467 Bacteria 875
82 Ga0070707_100005363 3300005468 Bacteria 11994
83 Ga0070698_100102292 3300005471 Bacteria 2836
84 Ga0070698_100416271 3300005471 Bacteria 1278
85 Ga0070698_100592168 3300005471 Bacteria 1049
86 Ga0070699_100049217 3300005518 Bacteria 3648
87 Ga0070699_101311804 3300005518 Bacteria 664
88 Ga0070679_100000114 3300005530 Bacteria 63464
89 Ga0070684_100061863 3300005535 Bacteria 3278
90 Ga0068853_100016816 3300005539 Bacteria 6027
91 Ga0068853_100054492 3300005539 Bacteria 3446
92 Ga0068853_100135974 3300005539 Bacteria 2204
93 Ga0070672_100000302 3300005543 Bacteria 27913
94 Ga0070672_100004303 3300005543 Bacteria 9313
95 Ga0070672_100023316 3300005543 Bacteria 4560
96 Ga0070672_100026148 3300005543 Bacteria 4338
97 Ga0070686_100015179 3300005544 Bacteria 4454
98 Ga0070686_100069721 3300005544 Bacteria 2297
99 Ga0070686_100409634 3300005544 Bacteria 1033
100 Ga0070695_100015626 3300005545 Bacteria 4584
101 Ga0070695_100025237 3300005545 Bacteria 3669
102 Ga0070695_100399062 3300005545 Bacteria 1042
103 Ga0070696_100000472 3300005546 Bacteria 25250
104 Ga0070696_100012242 3300005546 Bacteria 5749
105 Ga0070693_100000023 3300005547 Bacteria 59138
106 Ga0070693_100041623 3300005547 Bacteria 2585
107 Ga0070693_101106627 3300005547 Bacteria 604
108 Ga0070665_100195929 3300005548 Bacteria 2021
109 Ga0070704_100000398 3300005549 Bacteria 19988
110 Ga0070704_100102211 3300005549 Bacteria 2162
111 Ga0070704_100956004 3300005549 Bacteria 773
112 Ga0070704_100969583 3300005549 Bacteria 768
113 Ga0068855_100000607 3300005563 Bacteria 43932
114 Ga0070664_100122061 3300005564 Bacteria 2282
115 Ga0068857_100025824 3300005577 Bacteria 5172
116 Ga0068857_100076834 3300005577 Bacteria 2978
117 Ga0068854_100001032 3300005578 Bacteria 16709
118 Ga0068854_100126481 3300005578 Bacteria 1947
119 Ga0068856_100001021 3300005614 Bacteria 29787
120 Ga0070702_100013514 3300005615 Bacteria 4122
121 Ga0070702_100082213 3300005615 Bacteria 1932
122 Ga0070702_100519511 3300005615 Bacteria 878
123 Ga0070702_100587153 3300005615 Bacteria 833
124 Ga0068859_100007901 3300005617 Bacteria 10793
125 Ga0068859_100072549 3300005617 Bacteria 3479
126 Ga0068859_100165262 3300005617 Bacteria 2293
127 Ga0068859_100775489 3300005617 Bacteria 1047
128 Ga0068859_100895972 3300005617 Bacteria 972
129 Ga0068864_100000007 3300005618 Bacteria 392187
130 Ga0068864_100005193 3300005618 Bacteria 10666
131 Ga0068864_100192971 3300005618 Bacteria 1868
132 Ga0068866_10026091 3300005718 Bacteria 2755
133 Ga0068866_10121360 3300005718 Bacteria 1473
134 Ga0068861_100037285 3300005719 Bacteria 3614
135 Ga0068861_100390369 3300005719 Bacteria 1232
136 Ga0068870_10000571 3300005840 Bacteria 13972
137 Ga0068870_10021831 3300005840 Bacteria 3138
138 Ga0068870_10023512 3300005840 Bacteria 3041
139 Ga0068870_10465415 3300005840 Bacteria 836
140 Ga0068863_100015700 3300005841 Bacteria 7270
141 Ga0068863_100163921 3300005841 Bacteria 2131
142 Ga0068863_100476942 3300005841 Bacteria 1226
143 Ga0068858_100008154 3300005842 Bacteria 10069
144 Ga0068858_100068824 3300005842 Bacteria 3281
145 Ga0068858_100083268 3300005842 Bacteria 2975
146 Ga0068858_100098157 3300005842 Bacteria 2731
147 Ga0068860_100001939 3300005843 Bacteria 21890
148 Ga0068860_100030025 3300005843 Bacteria 5228
149 Ga0068860_100030755 3300005843 Bacteria 5162
150 Ga0068860_101333018 3300005843 Bacteria 739
151 Ga0068862_100003055 3300005844 Bacteria 14581
152 Ga0068862_100020250 3300005844 Bacteria 5556
153 Ga0068862_100634776 3300005844 Bacteria 1029
154 Ga0068862_100917407 3300005844 Bacteria 862
155 Ga0081455_10002202 3300005937 Bacteria 23200
156 Ga0070717_10000068 3300006028 Bacteria 86088
157 Ga0070717_10033957 3300006028 Bacteria 4119
158 Ga0075365_10018561 3300006038 Bacteria 4278
159 Ga0075368_10004988 3300006042 Bacteria 4537
160 Ga0075368_10123777 3300006042 Bacteria 1072
161 Ga0075363_100159777 3300006048 Bacteria 1275
162 Ga0070716_100087027 3300006173 Bacteria 1881
163 Ga0070712_100192169 3300006175 Bacteria 1598
164 Ga0075362_10027407 3300006177 Bacteria 2439
165 Ga0075367_10025608 3300006178 Bacteria 3338
166 Ga0075366_10000508 3300006195 Bacteria 17968
167 Ga0097621_100079368 3300006237 Bacteria 2728
168 Ga0075370_10061939 3300006353 Bacteria 2132
169 Ga0068871_100354807 3300006358 Bacteria 1298
170 Ga0075428_100006448 3300006844 Bacteria 13054
171 Ga0075428_100373267 3300006844 Bacteria 1529
172 Ga0075430_100004400 3300006846 Bacteria 11896
173 Ga0075431_100000458 3300006847 Bacteria 33564
174 Ga0075431_100006168 3300006847 Bacteria 11896
175 Ga0075431_100006295 3300006847 Bacteria 11792
176 Ga0075431_100011725 3300006847 Bacteria 8842
177 Ga0075431_100023290 3300006847 Bacteria 6336
178 Ga0075431_100135022 3300006847 Bacteria 2543
179 Ga0075431_100280326 3300006847 Bacteria 1687
180 Ga0075433_10007849 3300006852 Bacteria 8485
181 Ga0075433_10047864 3300006852 Bacteria 3719
182 Ga0075434_100095034 3300006871 Bacteria 2986
183 Ga0075434_100129843 3300006871 Bacteria 2538
184 Ga0075434_100255841 3300006871 Bacteria 1770
185 Ga0075434_100882282 3300006871 Bacteria 910
186 Ga0075434_101389889 3300006871 Bacteria 712
187 Ga0075429_100034178 3300006880 Bacteria 4416
188 Ga0075429_100039935 3300006880 Bacteria 4084
189 Ga0075429_100134597 3300006880 Bacteria 2163
190 Ga0075429_100137306 3300006880 Bacteria 2140
191 Ga0075429_100269695 3300006880 Bacteria 1491
192 Ga0075429_100485816 3300006880 Bacteria 1082
193 Ga0075429_100502275 3300006880 Bacteria 1063
194 Ga0075429_100520012 3300006880 Bacteria 1043
195 Ga0068865_100015467 3300006881 Bacteria 4867
196 Ga0068865_100018330 3300006881 Bacteria 4515
197 Ga0068865_100257900 3300006881 Bacteria 1379
198 Ga0075436_100001079 3300006914 Bacteria 18354
199 Ga0075436_100014267 3300006914 Bacteria 5442
200 Ga0075436_100243083 3300006914 Bacteria 1280
201 Ga0097620_100007901 3300006931 Bacteria 10793
202 Ga0097620_100072551 3300006931 Bacteria 3479
203 Ga0097620_100165259 3300006931 Bacteria 2293
204 Ga0097620_100775673 3300006931 Bacteria 1047
205 Ga0097620_100895865 3300006931 Bacteria 972
206 Ga0075435_100000164 3300007076 Bacteria 38529
207 Ga0075435_100051490 3300007076 Bacteria 3317
208 Ga0099794_10000500 3300007265 Bacteria 13123
209 Ga0099795_10251169 3300007788 Bacteria 763
210 Ga0105240_11040758 3300009093 Bacteria 874
211 Ga0105240_11973166 3300009093 Bacteria 607
212 Ga0111539_10004125 3300009094 Bacteria 19070
213 Ga0111539_10028142 3300009094 Bacteria 6862
214 Ga0105245_10000163 3300009098 Bacteria 62999
215 Ga0105245_10207135 3300009098 Bacteria 1886
216 Ga0105245_10995774 3300009098 Bacteria 882
217 Ga0105245_11704674 3300009098 Bacteria 682
218 Ga0105247_10180094 3300009101 Bacteria 1410
219 Ga0114129_10000524 3300009147 Bacteria 46852
220 Ga0114129_10000599 3300009147 Bacteria 44461
221 Ga0114129_10007198 3300009147 Bacteria 15833
222 Ga0114129_10040240 3300009147 Bacteria 6589
223 Ga0114129_10049084 3300009147 Bacteria 5932
224 Ga0114129_10144895 3300009147 Bacteria 3254
225 Ga0114129_10534690 3300009147 Bacteria 1526
226 Ga0114129_11547872 3300009147 Bacteria 813
227 Ga0114129_11587989 3300009147 Bacteria 801
228 Ga0114129_11803760 3300009147 Bacteria 744
229 Ga0114129_13019685 3300009147 Bacteria 553
230 Ga0105243_10011244 3300009148 Bacteria 6770
231 Ga0105243_10045563 3300009148 Bacteria 3447
232 Ga0105243_10403222 3300009148 Bacteria 1271
233 Ga0105241_10001691 3300009174 Bacteria 16762
234 Ga0105241_10476182 3300009174 Bacteria 1109
235 Ga0105242_10000941 3300009176 Bacteria 22687
236 Ga0105242_10149944 3300009176 Bacteria 2032
237 Ga0105242_10199447 3300009176 Bacteria 1777
238 Ga0105248_10504945 3300009177 Bacteria 1363
239 Ga0105248_10750517 3300009177 Bacteria 1101
240 Ga0105248_11253123 3300009177 Bacteria 839
241 Ga0105237_10152528 3300009545 Bacteria 2307
242 Ga0105237_10493769 3300009545 Bacteria 1231
243 Ga0105237_11326296 3300009545 Unclassified 726
244 Ga0105238_10121942 3300009551 Bacteria 2586
245 Ga0105238_10839755 3300009551 Bacteria 935
246 Ga0105249_10193896 3300009553 Bacteria 1984
247 Ga0105249_10222674 3300009553 Bacteria 1857
248 Ga0105249_10467092 3300009553 Bacteria 1303
249 Ga0099796_10155680 3300010159 Bacteria 902
250 Ga0105239_10398103 3300010375 Bacteria 1558
251 Ga0105239_10838734 3300010375 Bacteria 1054
252 Ga0105239_12890301 3300010375 Bacteria 560
253 Ga0105246_10022733 3300011119 Bacteria 4049
254 Ga0105246_10127439 3300011119 Bacteria 1896
255 Ga0157373_10000112 3300013100 Bacteria 64218
256 Ga0157371_10134590 3300013102 Bacteria 1760
257 Ga0157371_10270448 3300013102 Bacteria 1226
258 Ga0157369_10002956 3300013105 Bacteria 20316
259 Ga0157369_10446260 3300013105 Bacteria 1340
260 Ga0157374_12374686 3300013296 Bacteria 557
261 Ga0157378_10001104 3300013297 Bacteria 24588
262 Ga0157378_10030793 3300013297 Bacteria 4737
263 Ga0157378_10057178 3300013297 Bacteria 3476
264 Ga0157378_10127684 3300013297 Bacteria 2351
265 Ga0157378_10168894 3300013297 Bacteria 2050
266 Ga0157378_10256119 3300013297 Bacteria 1677
267 Ga0157378_10769961 3300013297 Bacteria 986
268 Ga0157378_11041715 3300013297 Bacteria 854
269 Ga0163162_10004299 3300013306 Bacteria 13709
270 Ga0163162_10036413 3300013306 Bacteria 4904
271 Ga0163162_10673547 3300013306 Bacteria 1157
272 Ga0163162_10973066 3300013306 Bacteria 959
273 Ga0157372_10000607 3300013307 Bacteria 39122
274 Ga0157372_10796652 3300013307 Bacteria 1098
275 Ga0157375_10000003 3300013308 Bacteria 476325
276 Ga0157375_10000008 3300013308 Bacteria 373560
277 Ga0157375_10031049 3300013308 Bacteria 5043
278 Ga0157375_10031165 3300013308 Bacteria 5035
279 Ga0157375_10075832 3300013308 Bacteria 3388
280 Ga0157380_10010938 3300014326 Bacteria 6544
281 Ga0157380_11466976 3300014326 Bacteria 734
282 Ga0157377_10000062 3300014745 Bacteria 81937
283 Ga0157377_10025261 3300014745 Bacteria 3167
284 Ga0157377_10032482 3300014745 Bacteria 2842
285 Ga0157377_10819897 3300014745 Bacteria 688
286 Ga0163161_10055398 3300017792 Bacteria 2879
287 Ga0163161_10395087 3300017792 Bacteria 1108
288 Ga0206356_11651644 3300020070 Bacteria 1468
289 Ga0206354_10450769 3300020081 Bacteria 1078
290 Ga0224712_10157040 3300022467 Bacteria 1012
291 Ga0207656_10146947 3300025321 Bacteria 1114
292 Ga0207653_10005065 3300025885 Bacteria 4116
293 Ga0207682_10029617 3300025893 Bacteria 2189
294 Ga0207692_10789598 3300025898 Bacteria 620
295 Ga0207642_10042796 3300025899 Bacteria 1993
296 Ga0207688_10035510 3300025901 Bacteria 2762
297 Ga0207699_10521547 3300025906 Bacteria 859
298 Ga0207645_10001367 3300025907 Bacteria 20031
299 Ga0207645_10310726 3300025907 Bacteria 1050
300 Ga0207643_10000042 3300025908 Bacteria 84491
301 Ga0207643_10024070 3300025908 Bacteria 3360
302 Ga0207643_10028152 3300025908 Bacteria 3119
303 Ga0207643_10393012 3300025908 Bacteria 876
304 Ga0207705_10031256 3300025909 Bacteria 3799
305 Ga0207705_10303033 3300025909 Bacteria 1226
306 Ga0207684_11039355 3300025910 Bacteria 684
307 Ga0207654_10001649 3300025911 Bacteria 11671
308 Ga0207654_10178766 3300025911 Bacteria 1383
309 Ga0207707_10000225 3300025912 Bacteria 60839
310 Ga0207671_10336780 3300025914 Bacteria 1195
311 Ga0207671_10775443 3300025914 Bacteria 761
312 Ga0207660_10001606 3300025917 Bacteria 15153
313 Ga0207660_10113749 3300025917 Bacteria 2040
314 Ga0207660_10353533 3300025917 Bacteria 1178
315 Ga0207662_10000831 3300025918 Bacteria 14208
316 Ga0207662_10068039 3300025918 Bacteria 2150
317 Ga0207662_10504387 3300025918 Bacteria 833
318 Ga0207657_10000393 3300025919 Bacteria 46100
319 Ga0207657_10919155 3300025919 Bacteria 674
320 Ga0207649_10002071 3300025920 Bacteria 11405
321 Ga0207652_10000610 3300025921 Bacteria 35634
322 Ga0207652_10000935 3300025921 Bacteria 27479
323 Ga0207652_10797803 3300025921 Bacteria 839
324 Ga0207646_10059928 3300025922 Bacteria 3399
325 Ga0207681_10005165 3300025923 Bacteria 8017
326 Ga0207681_10091728 3300025923 Bacteria 2171
327 Ga0207681_10184851 3300025923 Bacteria 1590
328 Ga0207694_10734147 3300025924 Bacteria 833
329 Ga0207650_10008486 3300025925 Bacteria 7014
330 Ga0207659_10296110 3300025926 Bacteria 1327
331 Ga0207687_10000374 3300025927 Bacteria 29972
332 Ga0207687_10000880 3300025927 Bacteria 20352
333 Ga0207687_10061174 3300025927 Bacteria 2659
334 Ga0207700_10003016 3300025928 Bacteria 9705
335 Ga0207700_10103458 3300025928 Bacteria 2277
336 Ga0207644_10098925 3300025931 Bacteria 2188
337 Ga0207690_10010270 3300025932 Bacteria 5560
338 Ga0207706_10007710 3300025933 Bacteria 9938
339 Ga0207706_10109692 3300025933 Bacteria 2429
340 Ga0207706_10519447 3300025933 Bacteria 1027
341 Ga0207686_10005580 3300025934 Bacteria 6745
342 Ga0207686_10122937 3300025934 Bacteria 1769
343 Ga0207686_10881040 3300025934 Bacteria 721
344 Ga0207709_10032044 3300025935 Bacteria 3075
345 Ga0207709_10079202 3300025935 Bacteria 2112
346 Ga0207670_10000700 3300025936 Bacteria 17718
347 Ga0207670_10008472 3300025936 Bacteria 5811
348 Ga0207670_10022074 3300025936 Bacteria 3939
349 Ga0207704_10040271 3300025938 Bacteria 2729
350 Ga0207704_10126486 3300025938 Bacteria 1761
351 Ga0207704_10260895 3300025938 Bacteria 1306
352 Ga0207665_10084441 3300025939 Bacteria 2191
353 Ga0207665_10188519 3300025939 Bacteria 1497
354 Ga0207665_10843320 3300025939 Bacteria 725
355 Ga0207691_10004543 3300025940 Bacteria 13432
356 Ga0207691_10005479 3300025940 Bacteria 12254
357 Ga0207691_10005724 3300025940 Bacteria 12017
358 Ga0207691_10498769 3300025940 Bacteria 1034
359 Ga0207711_10416132 3300025941 Bacteria 1250
360 Ga0207711_11016492 3300025941 Bacteria 769
361 Ga0207689_10000006 3300025942 Bacteria 133746
362 Ga0207689_10003247 3300025942 Bacteria 14903
363 Ga0207689_10026734 3300025942 Bacteria 4833
364 Ga0207689_10045436 3300025942 Bacteria 3631
365 Ga0207689_10402163 3300025942 Bacteria 1142
366 Ga0207689_10796662 3300025942 Bacteria 798
367 Ga0207661_10163255 3300025944 Bacteria 1934
368 Ga0207679_10000227 3300025945 Bacteria 43907
369 Ga0207667_10003357 3300025949 Bacteria 19750
370 Ga0207651_10072582 3300025960 Bacteria 2444
371 Ga0207651_11441120 3300025960 Bacteria 620
372 Ga0207712_10023630 3300025961 Bacteria 4060
373 Ga0207712_10098288 3300025961 Bacteria 2171
374 Ga0207712_10966213 3300025961 Bacteria 755
375 Ga0207668_10109263 3300025972 Bacteria 2071
376 Ga0207668_10493299 3300025972 Bacteria 1052
377 Ga0207640_10025913 3300025981 Bacteria 3555
378 Ga0207658_10059879 3300025986 Bacteria 2839
379 Ga0207658_10066770 3300025986 Bacteria 2707
380 Ga0207677_10000001 3300026023 Bacteria 534789
381 Ga0207677_10003704 3300026023 Bacteria 8108
382 Ga0207677_10065244 3300026023 Bacteria 2539
383 Ga0207677_10682547 3300026023 Bacteria 910
384 Ga0207703_10000249 3300026035 Bacteria 60645
385 Ga0207703_10030300 3300026035 Bacteria 4275
386 Ga0207703_10201239 3300026035 Bacteria 1770
387 Ga0207639_10000013 3300026041 Bacteria 293084
388 Ga0207639_10003272 3300026041 Bacteria 10915
389 Ga0207639_10125245 3300026041 Bacteria 2118
390 Ga0207678_10005636 3300026067 Bacteria 11192
391 Ga0207678_10013748 3300026067 Bacteria 7110
392 Ga0207678_10994216 3300026067 Bacteria 742
393 Ga0207708_10554915 3300026075 Bacteria 969
394 Ga0207708_11106862 3300026075 Bacteria 691
395 Ga0207702_10009161 3300026078 Bacteria 8326
396 Ga0207641_10009149 3300026088 Bacteria 8179
397 Ga0207641_10131447 3300026088 Bacteria 2248
398 Ga0207641_10459502 3300026088 Bacteria 1232
399 Ga0207641_10921165 3300026088 Bacteria 868
400 Ga0207648_10005245 3300026089 Bacteria 13102
401 Ga0207648_10007453 3300026089 Bacteria 10757
402 Ga0207648_10205198 3300026089 Bacteria 1749
403 Ga0207676_10000015 3300026095 Bacteria 329100
404 Ga0207676_10013264 3300026095 Bacteria 5919
405 Ga0207676_10034890 3300026095 Bacteria 3812
406 Ga0207674_10003120 3300026116 Bacteria 20446
407 Ga0207674_10092171 3300026116 Bacteria 3020
408 Ga0207674_10386262 3300026116 Bacteria 1353
409 Ga0207674_11416974 3300026116 Bacteria 664
410 Ga0207675_100001272 3300026118 Bacteria 25230
411 Ga0207675_100019657 3300026118 Bacteria 6304
412 Ga0207675_100552681 3300026118 Bacteria 1150
413 Ga0207683_10066272 3300026121 Bacteria 3184
414 Ga0207698_10781650 3300026142 Bacteria 956
415 Ga0209973_1023003 3300027252 Bacteria 840
416 Ga0209981_1011372 3300027378 Bacteria 1226
417 Ga0209996_1005900 3300027395 Bacteria 1573
418 Ga0209984_1019325 3300027424 Bacteria 925
419 Ga0209968_1001184 3300027526 Bacteria 3988
420 Ga0209999_1005017 3300027543 Bacteria 2381
421 Ga0209982_1000470 3300027552 Bacteria 4975
422 Ga0209970_1001781 3300027614 Bacteria 3729
423 Ga0210002_1011383 3300027617 Bacteria 1374
424 Ga0209983_1000785 3300027665 Bacteria 6903
425 Ga0209588_1002565 3300027671 Bacteria 4932
426 Ga0209971_1000133 3300027682 Bacteria 22063
427 Ga0209966_1000251 3300027695 Bacteria 19624
428 Ga0209998_10000095 3300027717 Bacteria 35134
429 Ga0209813_10045006 3300027866 Bacteria 1358
430 Ga0209813_10081263 3300027866 Bacteria 1072
431 Ga0209974_10003509 3300027876 Bacteria 5646
432 Ga0207428_10000041 3300027907 Bacteria 203097
433 Ga0268266_10040450 3300028379 Bacteria 3974
434 Ga0268266_10857789 3300028379 Bacteria 878
435 Ga0268266_10859315 3300028379 Bacteria 877
436 Ga0268265_10274506 3300028380 Bacteria 1505
437 Ga0268265_11368082 3300028380 Bacteria 709
438 Ga0268264_10004945 3300028381 Bacteria 11285
439 Ga0268264_10029115 3300028381 Bacteria 4522
440 Ga0268264_10036307 3300028381 Bacteria 4059
441 Ga0268264_10811383 3300028381 Bacteria 935
442 Ga0307511_10009165 3300030521 Bacteria 9862
443 Ga0265330_10002636 3300031235 Bacteria 9732
444 Ga0265332_10000111 3300031238 Bacteria 69906
445 Ga0265328_10000279 3300031239 Bacteria 23812
446 Ga0265329_10003071 3300031242 Bacteria 7404
447 Ga0265331_10000119 3300031250 Bacteria 103745
448 Ga0265327_10363284 3300031251 Bacteria 631
449 Ga0265316_10000392 3300031344 Bacteria 50006
450 Ga0307408_100009189 3300031548 Bacteria 6518
451 Ga0307508_10288385 3300031616 Bacteria 1235
452 Ga0265314_10000194 3300031711 Bacteria 90562
453 Ga0265342_10010969 3300031712 Bacteria 6227
454 Ga0307416_101691974 3300032002 Bacteria 737
455 Ga0307507_10000011 3300033179 Bacteria 261849
456 Ga0373951_0005689 3300035091 Bacteria 2885
457 Ga0373952_0026736 3300035092 Bacteria 1255
458 Ga0373932_0000045 3300035112 Bacteria 29756
459 Ga0373941_0029584 3300035115 Bacteria 1617
460 Ga0373960_0004171 3300035121 Bacteria 3302
461 Ga0373942_0215474 3300035207 Bacteria 642
462 Ga0373961_0001937 3300035241 Bacteria 5609
463 Ga0373931_0093150 3300035691 Bacteria 1682
464 Ga0373927_0492795 3300035695 Unclassified 810
465 Ga0373933_0137020 3300035724 Bacteria 1543
466 Ga0373925_0918195 3300037068 Bacteria 721
467 Ga0395898_0693670 3300037466 Bacteria 960
468 Ga0395898_1338574 3300037466 Bacteria 645
469 Ga0436362_1177659 3300039453 Bacteria 556
470 Ga0439448_0002719 3300042005 Bacteria 4835
471 Ga0439455_0013276 3300042012 Bacteria 1863
472 Ga0439458_0005116 3300042157 Bacteria 2957
473 Ga0439459_0000539 3300042438 Bacteria 5003
474 Ga0451577_0014687 3300042876 Bacteria 7295
475 Ga0451577_0268225 3300042876 Bacteria 1546
476 Ga0451577_0294596 3300042876 Bacteria 1470
477 Ga0451577_0816637 3300042876 Bacteria 842
478 Ga0453683_0000757 3300044673 Bacteria 32522
479 Ga0453683_0408510 3300044673 Bacteria 875
480 Ga0453683_0656756 3300044673 Bacteria 686
481 Ga0453684_0008251 3300044712 Bacteria 18774
482 Ga0453684_0044695 3300044712 Bacteria 5920
483 Ga0453684_0124332 3300044712 Bacteria 3108
484 Ga0453684_0247656 3300044712 Bacteria 2048
485 Ga0453684_0327261 3300044712 Bacteria 1734
486 Ga0453684_1036281 3300044712 Bacteria 870
487 Ga0453684_1584573 3300044712 Bacteria 673
488 Ga0466960_0165432 3300044901 Bacteria 1190
489 Ga0451576_0008534 3300045051 Bacteria 12014
490 Ga0451576_0044781 3300045051 Bacteria 4662
491 Ga0451576_0062015 3300045051 Bacteria 3898
492 Ga0451576_0343575 3300045051 Bacteria 1563
493 Ga0451576_0844436 3300045051 Bacteria 961
494 Ga0451576_1459558 3300045051 Bacteria 711
495 Ga0495580_0093689 3300046472 Bacteria 2090
496 Ga0495620_0000518 3300046515 Bacteria 24924
497 Ga0495642_0166383 3300046528 Bacteria 957
498 Ga0495656_0360894 3300046615 Bacteria 754
499 Ga0495669_0032512 3300046684 Bacteria 2294
500 Ga0495670_0253528 3300046691 Bacteria 938
501 Ga0495679_124812 3300047446 Bacteria 701
502 Ga0495602_0495409 3300048088 Bacteria 855
503 Ga0496102_0087429 3300048905 Bacteria 2880
504 Ga0496106_0075193 3300048909 Bacteria 2587
505 Ga0496107_0686686 3300048910 Bacteria 753
506 Ga0496112_1582900 3300048915 Bacteria 569
507 Ga0501036_0029766 3300049572 Bacteria 4614
508 Ga0501036_0124295 3300049572 Bacteria 2179
509 Ga0501037_0370342 3300049573 Bacteria 986
510 Ga0501038_0332463 3300049574 Bacteria 1186
511 Ga0501040_0000678 3300049576 Bacteria 20986
512 Ga0501041_0000180 3300049577 Bacteria 28591
513 Ga0501042_0024295 3300049578 Bacteria 4250
514 Ga0501042_0420206 3300049578 Bacteria 969
515 Ga0501046_0000621 3300049580 Bacteria 34861
516 Ga0501048_0068930 3300049582 Bacteria 2498
517 Ga0501067_0102066 3300049583 Bacteria 1594
518 Ga0501069_0018568 3300049585 Bacteria 3754
519 Ga0501071_0221826 3300049587 Bacteria 1423
520 Ga0501071_0501028 3300049587 Bacteria 932
521 Ga0501072_0009691 3300049588 Bacteria 7326
522 Ga0501072_1400099 3300049588 Bacteria 541
523 Ga0501073_0033716 3300049589 Bacteria 3644
524 Ga0501074_0015682 3300049590 Bacteria 5508
525 Ga0501074_0283942 3300049590 Bacteria 1177
526 Ga0501075_0018968 3300049591 Bacteria 4987
527 Ga0501076_0006896 3300049592 Bacteria 8252
528 Ga0501076_1227397 3300049592 Bacteria 617
529 Ga0501077_0019383 3300049593 Bacteria 4303
530 Ga0501079_0000227 3300049741 Bacteria 33663
531 Ga0501080_0005677 3300049742 Bacteria 11154
532 Ga0501081_0773115 3300049743 Bacteria 722
533 Ga0501083_0015931 3300049744 Bacteria 5263
534 Ga0501035_0424307 3300049822 Bacteria 1104
535 Ga0501045_0000079 3300049824 Bacteria 46140
536 Ga0501045_0304046 3300049824 Bacteria 1187
537 Ga0501045_1334070 3300049824 Bacteria 522
538 nmdc:mga03683_25617_c1 3300050489 Bacteria 2320
539 nmdc:mga03n38_161344_c1 3300050490 Bacteria 1135
540 nmdc:mga03n38_438450_c1 3300050490 Bacteria 725
541 nmdc:mga0k408_137_c1 3300050493 Bacteria 36779
542 nmdc:mga06z11_1974_c1 3300050494 Bacteria 7754
543 nmdc:mga06z11_97543_c1 3300050494 Bacteria 1607
544 nmdc:mga04h51_54185_c1 3300050495 Bacteria 1355
545 nmdc:mga04h51_96387_c1 3300050495 Bacteria 1072
546 nmdc:mga07m45_61210_c1 3300050496 Bacteria 2132
547 nmdc:mga05p37_301587_c1 3300050507 Bacteria 1903
548 nmdc:mga05p37_39091_c1 3300050507 Bacteria 5822
549 nmdc:mga05p37_397452_c1 3300050507 Bacteria 1610
550 nmdc:mga05p37_42863_c1 3300050507 Bacteria 5563
551 nmdc:mga05p37_487252_c1 3300050507 Bacteria 1418
552 nmdc:mga05p37_60003_c1 3300050507 Bacteria 4684
553 nmdc:mga05p37_68614_c1 3300050507 Bacteria 3349
554 nmdc:mga05p37_98625_c1 3300050507 Bacteria 3599
555 nmdc:mga09592_144087_c1 3300050508 Bacteria 2054
556 nmdc:mga09592_150955_c1 3300050508 Bacteria 2004
557 nmdc:mga09592_332024_c1 3300050508 Bacteria 1316
558 nmdc:mga09592_42694_c1 3300050508 Bacteria 3814
559 nmdc:mga09592_502976_c1 3300050508 Bacteria 1043
560 nmdc:mga09592_5066_c1 3300050508 Bacteria 10690
561 nmdc:mga0qj67_2246_c1 3300050509 Bacteria 13729
562 nmdc:mga0qj67_724460_c1 3300050509 Bacteria 790
563 nmdc:mga06r32_22559_c1 3300050510 Bacteria 5821
564 nmdc:mga06r32_4578_c1 3300050510 Bacteria 12399
565 nmdc:mga06r32_70273_c1 3300050510 Bacteria 3385
566 nmdc:mga06r32_802_c1 3300050510 Bacteria 27860
567 nmdc:mga08y16_21975_c1 3300050511 Bacteria 6735
568 nmdc:mga08y16_336_c1 3300050511 Bacteria 42608
569 nmdc:mga0n895_1274824_c1 3300050512 Bacteria 707
570 nmdc:mga0n895_1486234_c1 3300050512 Bacteria 644
571 nmdc:mga0n895_174390_c1 3300050512 Bacteria 2181
572 nmdc:mga0n895_307790_c1 3300050512 Bacteria 1606
573 nmdc:mga0n895_428111_c1 3300050512 Bacteria 1337
574 nmdc:mga0n895_725298_c1 3300050512 Bacteria 988
575 nmdc:mga0rr50_16257_c1 3300050513 Bacteria 4936
576 nmdc:mga0rr50_1834067_c1 3300050513 Bacteria 510
577 nmdc:mga0rr50_240100_c1 3300050513 Bacteria 1502
578 nmdc:mga0rr50_26_c1 3300050513 Bacteria 110468
579 nmdc:mga0rr50_34910_c1 3300050513 Bacteria 3606
580 nmdc:mga0rr50_443056_c1 3300050513 Bacteria 1100
581 nmdc:mga08x19_414_c1 3300050514 Bacteria 29696
582 nmdc:mga08x19_55445_c1 3300050514 Bacteria 2555
583 nmdc:mga0a205_119736_c1 3300050515 Bacteria 2532
584 nmdc:mga0a205_38479_c1 3300050515 Bacteria 4602
585 nmdc:mga0a205_517218_c1 3300050515 Bacteria 1050
586 Ga0495655_0000078 3300053083 Bacteria 18626
587 Ga0500573_0166484 3300053140 Bacteria 1196
588 Ga0501084_0008747 3300054114 Bacteria 8373
589 Ga0501084_0315344 3300054114 Bacteria 1321
590 Ga0501082_0000445 3300060353 Bacteria 36616
591 Ga0501082_0001228 3300060353 Bacteria 22539
592 2923525850 2923525760 Bacteria 4472324
593 Ga0451576_0197744
594 rootH1_10152555
595 JGI26143J51219_1006521
596 JGI26141J51220_1001086
597 JGI25405J52794_10043149
598 Ga0065712_10207024
599 Ga0065715_10213587
600 Ga0065707_10096390
601 Ga0070658_10021790
602 Ga0070658_10384940
603 Ga0070676_10000185
604 Ga0070683_100199468
605 Ga0070690_101443248
606 Ga0070670_100002439
607 Ga0070670_100645577
608 Ga0070677_10026231
609 Ga0068869_100000142
610 Ga0068869_100003995
611 Ga0068869_100033417
612 Ga0068869_100128869
613 Ga0068869_100373821
614 Ga0070680_100011252
615 Ga0070680_100124671
616 Ga0070682_100000035
617 Ga0070682_100000146
618 Ga0068868_100001085
619 Ga0068868_100348336
620 Ga0070660_100826075
621 Ga0070689_100002053
622 Ga0070689_100018382
623 Ga0070689_100058857
624 Ga0070689_101120911
625 Ga0070691_10006682
626 Ga0070691_10011592
627 Ga0070691_10228695
628 Ga0070687_100012090
629 Ga0070687_100052672
630 Ga0070661_100000358
631 Ga0070661_100710925
632 Ga0070692_10006276
633 Ga0070692_10168656
634 Ga0070668_100090229
635 Ga0070669_100012038
636 Ga0070669_100188676
637 Ga0070675_100010352
638 Ga0070675_100109877
639 Ga0070671_100328645
640 Ga0070673_100045697
641 Ga0070673_100319120
642 Ga0070673_100646681
643 Ga0070659_100000581
644 Ga0070667_100160770
645 Ga0070703_10006636
646 Ga0070709_10192278
647 Ga0070713_100005708
648 Ga0070713_100098456
649 Ga0070710_10156889
650 Ga0070710_10667884
651 Ga0070701_10008235
652 Ga0070701_10060889
653 Ga0070711_100584221
654 Ga0070705_100008834
655 Ga0070705_100256376
656 Ga0070705_100811824
657 Ga0070700_101129288
658 Ga0070694_100000293
659 Ga0070694_100283953
660 Ga0070663_100002077
661 Ga0070663_100061234
662 Ga0070663_100780186
663 Ga0070678_100049337
664 Ga0070662_100014404
665 Ga0070662_100041160
666 Ga0070662_100086824
667 Ga0070681_10090947
668 Ga0068867_100000681
669 Ga0068867_100020571
670 Ga0068867_100641262
671 Ga0070685_10018403
672 Ga0070685_10727919
673 Ga0070706_100795948
674 Ga0070707_100005363
675 Ga0070698_100102292
676 Ga0070698_100416271
677 Ga0070698_100592168
678 Ga0070699_100049217
679 Ga0070699_101311804
680 Ga0070679_100000114
681 Ga0070684_100061863
682 Ga0068853_100016816
683 Ga0068853_100054492
684 Ga0068853_100135974
685 Ga0070672_100000302
686 Ga0070672_100004303
687 Ga0070672_100023316
688 Ga0070672_100026148
689 Ga0070686_100015179
690 Ga0070686_100069721
691 Ga0070686_100409634
692 Ga0070695_100015626
693 Ga0070695_100025237
694 Ga0070695_100399062
695 Ga0070696_100000472
696 Ga0070696_100012242
697 Ga0070693_100000023
698 Ga0070693_100041623
699 Ga0070693_101106627
700 Ga0070665_100195929
701 Ga0070704_100000398
702 Ga0070704_100102211
703 Ga0070704_100956004
704 Ga0070704_100969583
705 Ga0068855_100000607
706 Ga0070664_100122061
707 Ga0068857_100025824
708 Ga0068857_100076834
709 Ga0068854_100001032
710 Ga0068854_100126481
711 Ga0068856_100001021
712 Ga0070702_100013514
713 Ga0070702_100082213
714 Ga0070702_100519511
715 Ga0070702_100587153
716 Ga0068859_100007901
717 Ga0068859_100072549
718 Ga0068859_100165262
719 Ga0068859_100775489
720 Ga0068859_100895972
721 Ga0068864_100000007
722 Ga0068864_100005193
723 Ga0068864_100192971
724 Ga0068866_10026091
725 Ga0068866_10121360
726 Ga0068861_100037285
727 Ga0068861_100390369
728 Ga0068870_10000571
729 Ga0068870_10021831
730 Ga0068870_10023512
731 Ga0068870_10465415
732 Ga0068863_100015700
733 Ga0068863_100163921
734 Ga0068863_100476942
735 Ga0068858_100008154
736 Ga0068858_100068824
737 Ga0068858_100083268
738 Ga0068858_100098157
739 Ga0068860_100001939
740 Ga0068860_100030025
741 Ga0068860_100030755
742 Ga0068860_101333018
743 Ga0068862_100003055
744 Ga0068862_100020250
745 Ga0068862_100634776
746 Ga0068862_100917407
747 Ga0081455_10002202
748 Ga0070717_10000068
749 Ga0070717_10033957
750 Ga0075365_10018561
751 Ga0075368_10004988
752 Ga0075368_10123777
753 Ga0075363_100159777
754 Ga0070716_100087027
755 Ga0070712_100192169
756 Ga0075362_10027407
757 Ga0075367_10025608
758 Ga0075366_10000508
759 Ga0097621_100079368
760 Ga0075370_10061939
761 Ga0068871_100354807
762 Ga0075428_100006448
763 Ga0075428_100373267
764 Ga0075430_100004400
765 Ga0075431_100000458
766 Ga0075431_100006168
767 Ga0075431_100006295
768 Ga0075431_100011725
769 Ga0075431_100023290
770 Ga0075431_100135022
771 Ga0075431_100280326
772 Ga0075433_10007849
773 Ga0075433_10047864
774 Ga0075434_100095034
775 Ga0075434_100129843
776 Ga0075434_100255841
777 Ga0075434_100882282
778 Ga0075434_101389889
779 Ga0075429_100034178
780 Ga0075429_100039935
781 Ga0075429_100134597
782 Ga0075429_100137306
783 Ga0075429_100269695
784 Ga0075429_100485816
785 Ga0075429_100502275
786 Ga0075429_100520012
787 Ga0068865_100015467
788 Ga0068865_100018330
789 Ga0068865_100257900
790 Ga0075436_100001079
791 Ga0075436_100014267
792 Ga0075436_100243083
793 Ga0097620_100007901
794 Ga0097620_100072551
795 Ga0097620_100165259
796 Ga0097620_100775673
797 Ga0097620_100895865
798 Ga0075435_100000164
799 Ga0075435_100051490
800 Ga0099794_10000500
801 Ga0099795_10251169
802 Ga0105240_11040758
803 Ga0105240_11973166
804 Ga0111539_10004125
805 Ga0111539_10028142
806 Ga0105245_10000163
807 Ga0105245_10207135
808 Ga0105245_10995774
809 Ga0105245_11704674
810 Ga0105247_10180094
811 Ga0114129_10000524
812 Ga0114129_10000599
813 Ga0114129_10007198
814 Ga0114129_10040240
815 Ga0114129_10049084
816 Ga0114129_10144895
817 Ga0114129_10534690
818 Ga0114129_11547872
819 Ga0114129_11587989
820 Ga0114129_11803760
821 Ga0114129_13019685
822 Ga0105243_10011244
823 Ga0105243_10045563
824 Ga0105243_10403222
825 Ga0105241_10001691
826 Ga0105241_10476182
827 Ga0105242_10000941
828 Ga0105242_10149944
829 Ga0105242_10199447
830 Ga0105248_10504945
831 Ga0105248_10750517
832 Ga0105248_11253123
833 Ga0105237_10152528
834 Ga0105237_10493769
835 Ga0105237_11326296
836 Ga0105238_10121942
837 Ga0105238_10839755
838 Ga0105249_10193896
839 Ga0105249_10222674
840 Ga0105249_10467092
841 Ga0099796_10155680
842 Ga0105239_10398103
843 Ga0105239_10838734
844 Ga0105239_12890301
845 Ga0105246_10022733
846 Ga0105246_10127439
847 Ga0157373_10000112
848 Ga0157371_10134590
849 Ga0157371_10270448
850 Ga0157369_10002956
851 Ga0157369_10446260
852 Ga0157374_12374686
853 Ga0157378_10001104
854 Ga0157378_10030793
855 Ga0157378_10057178
856 Ga0157378_10127684
857 Ga0157378_10168894
858 Ga0157378_10256119
859 Ga0157378_10769961
860 Ga0157378_11041715
861 Ga0163162_10004299
862 Ga0163162_10036413
863 Ga0163162_10673547
864 Ga0163162_10973066
865 Ga0157372_10000607
866 Ga0157372_10796652
867 Ga0157375_10000003
868 Ga0157375_10000008
869 Ga0157375_10031049
870 Ga0157375_10031165
871 Ga0157375_10075832
872 Ga0157380_10010938
873 Ga0157380_11466976
874 Ga0157377_10000062
875 Ga0157377_10025261
876 Ga0157377_10032482
877 Ga0157377_10819897
878 Ga0163161_10055398
879 Ga0163161_10395087
880 Ga0206356_11651644
881 Ga0206354_10450769
882 Ga0224712_10157040
883 Ga0207656_10146947
884 Ga0207653_10005065
885 Ga0207682_10029617
886 Ga0207692_10789598
887 Ga0207642_10042796
888 Ga0207688_10035510
889 Ga0207699_10521547
890 Ga0207645_10001367
891 Ga0207645_10310726
892 Ga0207643_10000042
893 Ga0207643_10024070
894 Ga0207643_10028152
895 Ga0207643_10393012
896 Ga0207705_10031256
897 Ga0207705_10303033
898 Ga0207684_11039355
899 Ga0207654_10001649
900 Ga0207654_10178766
901 Ga0207707_10000225
902 Ga0207671_10336780
903 Ga0207671_10775443
904 Ga0207660_10001606
905 Ga0207660_10113749
906 Ga0207660_10353533
907 Ga0207662_10000831
908 Ga0207662_10068039
909 Ga0207662_10504387
910 Ga0207657_10000393
911 Ga0207657_10919155
912 Ga0207649_10002071
913 Ga0207652_10000610
914 Ga0207652_10000935
915 Ga0207652_10797803
916 Ga0207646_10059928
917 Ga0207681_10005165
918 Ga0207681_10091728
919 Ga0207681_10184851
920 Ga0207694_10734147
921 Ga0207650_10008486
922 Ga0207659_10296110
923 Ga0207687_10000374
924 Ga0207687_10000880
925 Ga0207687_10061174
926 Ga0207700_10003016
927 Ga0207700_10103458
928 Ga0207644_10098925
929 Ga0207690_10010270
930 Ga0207706_10007710
931 Ga0207706_10109692
932 Ga0207706_10519447
933 Ga0207686_10005580
934 Ga0207686_10122937
935 Ga0207686_10881040
936 Ga0207709_10032044
937 Ga0207709_10079202
938 Ga0207670_10000700
939 Ga0207670_10008472
940 Ga0207670_10022074
941 Ga0207704_10040271
942 Ga0207704_10126486
943 Ga0207704_10260895
944 Ga0207665_10084441
945 Ga0207665_10188519
946 Ga0207665_10843320
947 Ga0207691_10004543
948 Ga0207691_10005479
949 Ga0207691_10005724
950 Ga0207691_10498769
951 Ga0207711_10416132
952 Ga0207711_11016492
953 Ga0207689_10000006
954 Ga0207689_10003247
955 Ga0207689_10026734
956 Ga0207689_10045436
957 Ga0207689_10402163
958 Ga0207689_10796662
959 Ga0207661_10163255
960 Ga0207679_10000227
961 Ga0207667_10003357
962 Ga0207651_10072582
963 Ga0207651_11441120
964 Ga0207712_10023630
965 Ga0207712_10098288
966 Ga0207712_10966213
967 Ga0207668_10109263
968 Ga0207668_10493299
969 Ga0207640_10025913
970 Ga0207658_10059879
971 Ga0207658_10066770
972 Ga0207677_10000001
973 Ga0207677_10003704
974 Ga0207677_10065244
975 Ga0207677_10682547
976 Ga0207703_10000249
977 Ga0207703_10030300
978 Ga0207703_10201239
979 Ga0207639_10000013
980 Ga0207639_10003272
981 Ga0207639_10125245
982 Ga0207678_10005636
983 Ga0207678_10013748
984 Ga0207678_10994216
985 Ga0207708_10554915
986 Ga0207708_11106862
987 Ga0207702_10009161
988 Ga0207641_10009149
989 Ga0207641_10131447
990 Ga0207641_10459502
991 Ga0207641_10921165
992 Ga0207648_10005245
993 Ga0207648_10007453
994 Ga0207648_10205198
995 Ga0207676_10000015
996 Ga0207676_10013264
997 Ga0207676_10034890
998 Ga0207674_10003120
999 Ga0207674_10092171
1000 Ga0207674_10386262
1001 Ga0207674_11416974
1002 Ga0207675_100001272
1003 Ga0207675_100019657
1004 Ga0207675_100552681
1005 Ga0207683_10066272
1006 Ga0207698_10781650
1007 Ga0209973_1023003
1008 Ga0209981_1011372
1009 Ga0209996_1005900
1010 Ga0209984_1019325
1011 Ga0209968_1001184
1012 Ga0209999_1005017
1013 Ga0209982_1000470
1014 Ga0209970_1001781
1015 Ga0210002_1011383
1016 Ga0209983_1000785
1017 Ga0209588_1002565
1018 Ga0209971_1000133
1019 Ga0209966_1000251
1020 Ga0209998_10000095
1021 Ga0209813_10045006
1022 Ga0209813_10081263
1023 Ga0209974_10003509
1024 Ga0207428_10000041
1025 Ga0268266_10040450
1026 Ga0268266_10857789
1027 Ga0268266_10859315
1028 Ga0268265_10274506
1029 Ga0268265_11368082
1030 Ga0268264_10004945
1031 Ga0268264_10029115
1032 Ga0268264_10036307
1033 Ga0268264_10811383
1034 Ga0307511_10009165
1035 Ga0265330_10002636
1036 Ga0265332_10000111
1037 Ga0265328_10000279
1038 Ga0265329_10003071
1039 Ga0265331_10000119
1040 Ga0265327_10363284
1041 Ga0265316_10000392
1042 Ga0307408_100009189
1043 Ga0307508_10288385
1044 Ga0265314_10000194
1045 Ga0265342_10010969
1046 Ga0307416_101691974
1047 Ga0307507_10000011
1048 Ga0373951_0005689
1049 Ga0373952_0026736
1050 Ga0373932_0000045
1051 Ga0373941_0029584
1052 Ga0373960_0004171
1053 Ga0373942_0215474
1054 Ga0373961_0001937
1055 Ga0373931_0093150
1056 Ga0373927_0492795
1057 Ga0373933_0137020
1058 Ga0373925_0918195
1059 Ga0395898_0693670
1060 Ga0395898_1338574
1061 Ga0436362_1177659
1062 Ga0439448_0002719
1063 Ga0439455_0013276
1064 Ga0439458_0005116
1065 Ga0439459_0000539
1066 Ga0451577_0014687
1067 Ga0451577_0268225
1068 Ga0451577_0294596
1069 Ga0451577_0816637
1070 Ga0453683_0000757
1071 Ga0453683_0408510
1072 Ga0453683_0656756
1073 Ga0453684_0008251
1074 Ga0453684_0044695
1075 Ga0453684_0124332
1076 Ga0453684_0247656
1077 Ga0453684_0327261
1078 Ga0453684_1036281
1079 Ga0453684_1584573
1080 Ga0466960_0165432
1081 Ga0451576_0008534
1082 Ga0451576_0044781
1083 Ga0451576_0062015
1084 Ga0451576_0343575
1085 Ga0451576_0844436
1086 Ga0451576_1459558
1087 Ga0495580_0093689
1088 Ga0495620_0000518
1089 Ga0495642_0166383
1090 Ga0495656_0360894
1091 Ga0495669_0032512
1092 Ga0495670_0253528
1093 Ga0495679_124812
1094 Ga0495602_0495409
1095 Ga0496102_0087429
1096 Ga0496106_0075193
1097 Ga0496107_0686686
1098 Ga0496112_1582900
1099 Ga0501036_0029766
1100 Ga0501036_0124295
1101 Ga0501037_0370342
1102 Ga0501038_0332463
1103 Ga0501040_0000678
1104 Ga0501041_0000180
1105 Ga0501042_0024295
1106 Ga0501042_0420206
1107 Ga0501046_0000621
1108 Ga0501048_0068930
1109 Ga0501067_0102066
1110 Ga0501069_0018568
1111 Ga0501071_0221826
1112 Ga0501071_0501028
1113 Ga0501072_0009691
1114 Ga0501072_1400099
1115 Ga0501073_0033716
1116 Ga0501074_0015682
1117 Ga0501074_0283942
1118 Ga0501075_0018968
1119 Ga0501076_0006896
1120 Ga0501076_1227397
1121 Ga0501077_0019383
1122 Ga0501079_0000227
1123 Ga0501080_0005677
1124 Ga0501081_0773115
1125 Ga0501083_0015931
1126 Ga0501035_0424307
1127 Ga0501045_0000079
1128 Ga0501045_0304046
1129 Ga0501045_1334070
1130 nmdc:mga03683_25617_c1
1131 nmdc:mga03n38_161344_c1
1132 nmdc:mga03n38_438450_c1
1133 nmdc:mga0k408_137_c1
1134 nmdc:mga06z11_1974_c1
1135 nmdc:mga06z11_97543_c1
1136 nmdc:mga04h51_54185_c1
1137 nmdc:mga04h51_96387_c1
1138 nmdc:mga07m45_61210_c1
1139 nmdc:mga05p37_301587_c1
1140 nmdc:mga05p37_39091_c1
1141 nmdc:mga05p37_397452_c1
1142 nmdc:mga05p37_42863_c1
1143 nmdc:mga05p37_487252_c1
1144 nmdc:mga05p37_60003_c1
1145 nmdc:mga05p37_68614_c1
1146 nmdc:mga05p37_98625_c1
1147 nmdc:mga09592_144087_c1
1148 nmdc:mga09592_150955_c1
1149 nmdc:mga09592_332024_c1
1150 nmdc:mga09592_42694_c1
1151 nmdc:mga09592_502976_c1
1152 nmdc:mga09592_5066_c1
1153 nmdc:mga0qj67_2246_c1
1154 nmdc:mga0qj67_724460_c1
1155 nmdc:mga06r32_22559_c1
1156 nmdc:mga06r32_4578_c1
1157 nmdc:mga06r32_70273_c1
1158 nmdc:mga06r32_802_c1
1159 nmdc:mga08y16_21975_c1
1160 nmdc:mga08y16_336_c1
1161 nmdc:mga0n895_1274824_c1
1162 nmdc:mga0n895_1486234_c1
1163 nmdc:mga0n895_174390_c1
1164 nmdc:mga0n895_307790_c1
1165 nmdc:mga0n895_428111_c1
1166 nmdc:mga0n895_725298_c1
1167 nmdc:mga0rr50_16257_c1
1168 nmdc:mga0rr50_1834067_c1
1169 nmdc:mga0rr50_240100_c1
1170 nmdc:mga0rr50_26_c1
1171 nmdc:mga0rr50_34910_c1
1172 nmdc:mga0rr50_443056_c1
1173 nmdc:mga08x19_414_c1
1174 nmdc:mga08x19_55445_c1
1175 nmdc:mga0a205_119736_c1
1176 nmdc:mga0a205_38479_c1
1177 nmdc:mga0a205_517218_c1
1178 Ga0495655_0000078
1179 Ga0500573_0166484
1180 Ga0501084_0008747
1181 Ga0501084_0315344
1182 Ga0501082_0000445
1183 Ga0501082_0001228
1184 2923525850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

22

158

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4toc-assembly1.cif.gz_C 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa 0.9989 2 156
4toc-assembly1.cif.gz_L 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa 0.9988 2 156
4toc-assembly1.cif.gz_B 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa 0.9987 2 156
4toc-assembly1.cif.gz_A 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa 0.9987 4 156
4toc-assembly1.cif.gz_N 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa 0.9986 1 156
ID Description Score Start End Superfamily
5d8rA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9979 1 156 1.20.1260.10
5zurA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9973 1 153 1.20.1260.10
3iseA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9971 3 156 1.20.1260.10
3is8T00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9969 2 156 1.20.1260.10
3iseD00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9969 3 156 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A3C2DH40-F1-model_v4 Bacterioferritin 1.003 1 133 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A2V9SKB7-F1-model_v4 Bacterioferritin 1.003 1 108 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A3M1EPG4-F1-model_v4 Bacterioferritin 1.003 1 97 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A2S9YM12-F1-model_v4 Bacterioferritin (EC 1.16.3.1) 1.002 1 153 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A6G3X1W6-F1-model_v4 Bacterioferritin 1.002 1 88 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037

Map