F467185

General Info

Members Datasets Scaffolds Average Seq Length
593 362 593 85

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1027828|Ga0055524_10278282
Length 98
Sequence MCERDGLIGAIRPLWKNPMSAHPDQKQLLHLVFGGELDSLEGITFKDLAKLDIVGIYPNYATAHTAWKAKAQQTVDQAQTRYFIVHLHRLLDPETAAG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
24 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
110 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
111 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
112 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
113 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
114 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
197 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
203 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
204 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
205 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
206 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
207 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
208 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
209 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
212 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
213 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
214 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
225 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
226 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
233 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
234 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
235 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
236 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
237 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
238 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
239 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
240 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
241 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
242 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
243 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
244 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
245 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
246 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
247 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
299 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
317 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
318 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
339 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
340 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
341 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
344 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
349 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
352 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
353 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
354 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
355 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
356 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
357 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
358 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
359 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
360 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
361 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
362 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.77
Nodule 0
Rhizoplane 4.55
Rhizosphere 83.47
Stem 0
Stem Tuber 0
Unclassified 3.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1015587 2162886007 Bacteria 1305
2 2214767426 2209111006 Bacteria 2785
3 ARcpr5oldR_c000253 3300000041 Bacteria 8505
4 ARSoilYngRDRAFT_c00281 3300000042 Bacteria 7534
5 ARcpr5yngRDRAFT_c002660 3300000043 Bacteria 1837
6 ARSoilOldRDRAFT_c000231 3300000044 Bacteria 8483
7 ARCol0oldRDRAFT_c00994 3300000045 Bacteria 2167
8 ARCol0yngRDRAFT_1000260 3300000652 Bacteria 8518
9 JGI24737J22298_10020391 3300001990 Bacteria 2116
10 JGI24750J21931_1004571 3300002070 Bacteria 1681
11 JGI24035J26624_1001130 3300002126 Bacteria 2528
12 JGI24034J26672_10029907 3300002239 Bacteria 883
13 JGI24751J29686_10073052 3300002459 Bacteria 708
14 JGI25159J45721_1021639 3300002987 Bacteria 1207
15 JGI25151J46595_10000018 3300003187 Bacteria 238438
16 JGI25151J46595_10034061 3300003187 Bacteria 1952
17 JGI25153J46596_10004251 3300003215 Bacteria 7749
18 JGI26141J51220_1016149 3300003503 Bacteria 512
19 Ga0055526_1000362 3300003771 Bacteria 36713
20 Ga0055526_1000571 3300003771 Bacteria 29048
21 Ga0055524_1000048 3300003775 Bacteria 149598
22 Ga0055524_1027828 3300003775 Bacteria 1706
23 Ga0055534_1008656 3300003784 Bacteria 2285
24 JGI25405J52794_10051040 3300003911 Bacteria 886
25 Ga0065165_1000337 3300005262 Bacteria 76914
26 Ga0065717_1002397 3300005276 Bacteria 2048
27 Ga0065716_1001908 3300005277 Bacteria 2776
28 Ga0065714_10369378 3300005288 Bacteria 617
29 Ga0065704_10109412 3300005289 Bacteria 2004
30 Ga0065712_10078300 3300005290 Bacteria 3367
31 Ga0065715_10001249 3300005293 Bacteria 14318
32 Ga0065707_10126362 3300005295 Bacteria 2004
33 Ga0070683_102352263 3300005329 Bacteria 511
34 Ga0070690_100353756 3300005330 Bacteria 1067
35 Ga0070677_10222450 3300005333 Bacteria 923
36 Ga0070666_10499724 3300005335 Bacteria 882
37 Ga0070680_101874744 3300005336 Bacteria 520
38 Ga0070660_100171040 3300005339 Bacteria 1755
39 Ga0070660_101105022 3300005339 Bacteria 671
40 Ga0070689_100005511 3300005340 Bacteria 8652
41 Ga0070689_100132519 3300005340 Bacteria 1999
42 Ga0070689_100418910 3300005340 Bacteria 1135
43 Ga0070691_10738551 3300005341 Bacteria 594
44 Ga0070668_100110155 3300005347 Bacteria 2191
45 Ga0070668_100347040 3300005347 Bacteria 1255
46 Ga0070675_100372984 3300005354 Bacteria 1269
47 Ga0070671_100923777 3300005355 Bacteria 763
48 Ga0070674_100106760 3300005356 Bacteria 2049
49 Ga0070688_100196206 3300005365 Bacteria 1409
50 Ga0070713_100803507 3300005436 Bacteria 902
51 Ga0070710_10723997 3300005437 Bacteria 704
52 Ga0070710_11139953 3300005437 Bacteria 574
53 Ga0070711_100645935 3300005439 Bacteria 887
54 Ga0070700_100229568 3300005441 Bacteria 1320
55 Ga0070700_100879773 3300005441 Bacteria 728
56 Ga0070694_100259073 3300005444 Bacteria 1319
57 Ga0070708_100032775 3300005445 Bacteria 4509
58 Ga0070663_101606501 3300005455 Bacteria 580
59 Ga0070678_102311431 3300005456 Bacteria 510
60 Ga0070662_101043268 3300005457 Bacteria 701
61 Ga0070681_10737194 3300005458 Bacteria 902
62 Ga0068867_100190787 3300005459 Bacteria 1635
63 Ga0068867_100312173 3300005459 Bacteria 1300
64 Ga0068867_101644605 3300005459 Bacteria 601
65 Ga0070685_10083256 3300005466 Bacteria 1922
66 Ga0074259_11049951 3300005507 Bacteria 632
67 Ga0070679_100160756 3300005530 Bacteria 2221
68 Ga0070679_100219484 3300005530 Bacteria 1863
69 Ga0070679_100755994 3300005530 Bacteria 915
70 Ga0070679_101737760 3300005530 Bacteria 572
71 Ga0068853_100088489 3300005539 Bacteria 2719
72 Ga0070672_100651401 3300005543 Bacteria 920
73 Ga0070686_101131385 3300005544 Bacteria 648
74 Ga0070704_100774390 3300005549 Bacteria 856
75 Ga0068855_100109516 3300005563 Bacteria 3172
76 Ga0070664_101830047 3300005564 Bacteria 576
77 Ga0068857_100329950 3300005577 Bacteria 1410
78 Ga0068857_101536523 3300005577 Bacteria 649
79 Ga0068854_100134111 3300005578 Bacteria 1894
80 Ga0068856_101829695 3300005614 Bacteria 619
81 Ga0070702_100358261 3300005615 Bacteria 1030
82 Ga0068859_100026561 3300005617 Bacteria 5806
83 Ga0068859_100636361 3300005617 Bacteria 1159
84 Ga0068864_101185269 3300005618 Bacteria 762
85 Ga0068866_10194266 3300005718 Bacteria 1208
86 Ga0068861_100723613 3300005719 Bacteria 927
87 Ga0068851_10521056 3300005834 Bacteria 715
88 Ga0068858_100017088 3300005842 Bacteria 6809
89 Ga0068862_100930873 3300005844 Bacteria 856
90 Ga0081455_10000110 3300005937 Bacteria 92459
91 Ga0081540_1161839 3300005983 Bacteria 867
92 Ga0081539_10181037 3300005985 Bacteria 988
93 Ga0075365_10029225 3300006038 Bacteria 3521
94 Ga0075368_10135504 3300006042 Bacteria 1025
95 Ga0075368_10514054 3300006042 Bacteria 535
96 Ga0075364_10108738 3300006051 Bacteria 1849
97 Ga0075364_10469646 3300006051 Bacteria 860
98 Ga0075364_10571059 3300006051 Bacteria 773
99 Ga0075432_10028305 3300006058 Bacteria 1933
100 Ga0075432_10201207 3300006058 Bacteria 788
101 Ga0070712_100086102 3300006175 Bacteria 2289
102 Ga0075362_10157543 3300006177 Bacteria 1092
103 Ga0075362_10298600 3300006177 Bacteria 799
104 Ga0075367_10243956 3300006178 Bacteria 1126
105 Ga0075369_10189743 3300006186 Bacteria 947
106 Ga0075427_10003863 3300006194 Bacteria 2090
107 Ga0075366_10005461 3300006195 Bacteria 6889
108 Ga0097621_100649154 3300006237 Bacteria 968
109 Ga0097621_100840131 3300006237 Bacteria 853
110 Ga0097621_101781068 3300006237 Bacteria 587
111 Ga0068871_101419230 3300006358 Bacteria 655
112 Ga0075428_100002521 3300006844 Bacteria 19905
113 Ga0075430_100000128 3300006846 Bacteria 47770
114 Ga0075431_100018884 3300006847 Bacteria 7022
115 Ga0075433_10000103 3300006852 Bacteria 41320
116 Ga0075433_10259258 3300006852 Bacteria 1541
117 Ga0075434_100014461 3300006871 Bacteria 7542
118 Ga0075434_100022954 3300006871 Bacteria 6073
119 Ga0075434_100794325 3300006871 Bacteria 963
120 Ga0075429_100000381 3300006880 Bacteria 32664
121 Ga0075429_100812865 3300006880 Bacteria 818
122 Ga0068865_101632313 3300006881 Bacteria 580
123 Ga0068865_101712111 3300006881 Bacteria 567
124 Ga0075436_100477998 3300006914 Bacteria 910
125 Ga0097620_100026564 3300006931 Bacteria 5806
126 Ga0097620_100636467 3300006931 Bacteria 1159
127 Ga0075435_100006161 3300007076 Bacteria 8456
128 Ga0075435_100011373 3300007076 Bacteria 6542
129 Ga0105240_10519814 3300009093 Bacteria 1321
130 Ga0111539_10000787 3300009094 Bacteria 41244
131 Ga0111539_10002989 3300009094 Bacteria 22418
132 Ga0111539_11186417 3300009094 Bacteria 887
133 Ga0111539_11882510 3300009094 Bacteria 694
134 Ga0111539_13457124 3300009094 Bacteria 507
135 Ga0114129_10018046 3300009147 Bacteria 10051
136 Ga0114129_10045728 3300009147 Bacteria 6153
137 Ga0114129_11023613 3300009147 Bacteria 1039
138 Ga0114129_11684597 3300009147 Bacteria 774
139 Ga0105243_10001716 3300009148 Bacteria 18861
140 Ga0105241_10151490 3300009174 Bacteria 1898
141 Ga0105241_11941110 3300009174 Bacteria 578
142 Ga0105248_10393153 3300009177 Bacteria 1561
143 Ga0105248_12359944 3300009177 Bacteria 606
144 Ga0105237_10661721 3300009545 Bacteria 1051
145 Ga0105249_10064225 3300009553 Bacteria 3374
146 Ga0105239_10022754 3300010375 Bacteria 6909
147 Ga0105246_10130138 3300011119 Bacteria 1878
148 Ga0157343_1000395 3300012488 Bacteria 1720
149 Ga0157322_1000394 3300012490 Bacteria 1565
150 Ga0157329_1006681 3300012491 Bacteria 819
151 Ga0157341_1000469 3300012494 Bacteria 2051
152 Ga0157323_1002712 3300012495 Bacteria 1009
153 Ga0157338_1000826 3300012515 Bacteria 2015
154 Ga0157373_10991369 3300013100 Bacteria 627
155 Ga0157371_10012581 3300013102 Bacteria 6462
156 Ga0157370_10262131 3300013104 Bacteria 1597
157 Ga0171462_1009 3300013250 Bacteria 344993
158 Ga0157374_10162264 3300013296 Bacteria 2177
159 Ga0157378_11068503 3300013297 Bacteria 843
160 Ga0163162_10064822 3300013306 Bacteria 3699
161 Ga0163162_10476111 3300013306 Bacteria 1380
162 Ga0157372_10564395 3300013307 Bacteria 1327
163 Ga0157375_10035488 3300013308 Bacteria 4760
164 Ga0157380_10206239 3300014326 Bacteria 1748
165 Ga0182008_10058838 3300014497 Bacteria 1896
166 Ga0157379_10134584 3300014968 Bacteria 2226
167 Ga0157379_11906609 3300014968 Bacteria 586
168 Ga0157376_11750332 3300014969 Bacteria 657
169 Ga0182007_10058694 3300015262 Bacteria 1262
170 Ga0209673_1008228 3300025273 Bacteria 4667
171 Ga0209130_1001417 3300025284 Bacteria 15975
172 Ga0209675_1000799 3300025291 Bacteria 20784
173 Ga0209676_1038968 3300025292 Bacteria 1355
174 Ga0209025_1000010 3300025294 Bacteria 986612
175 Ga0209025_1001591 3300025294 Bacteria 28576
176 Ga0209025_1040973 3300025294 Bacteria 1993
177 Ga0209564_1000019 3300025295 Bacteria 573686
178 Ga0209564_1000034 3300025295 Bacteria 444284
179 Ga0209758_1000251 3300025297 Bacteria 108814
180 Ga0209256_1000026 3300025299 Bacteria 432835
181 Ga0209256_1000232 3300025299 Bacteria 99687
182 Ga0209256_1029369 3300025299 Bacteria 1534
183 Ga0207426_1013477 3300025302 Bacteria 3028
184 Ga0207426_1031206 3300025302 Bacteria 1740
185 Ga0209257_1031090 3300025304 Bacteria 1713
186 Ga0207697_10022213 3300025315 Bacteria 2600
187 Ga0207682_10173496 3300025893 Bacteria 982
188 Ga0207642_10130969 3300025899 Bacteria 1309
189 Ga0207642_10465215 3300025899 Bacteria 768
190 Ga0207710_10254166 3300025900 Bacteria 879
191 Ga0207688_10147917 3300025901 Bacteria 1386
192 Ga0207680_10366719 3300025903 Bacteria 1013
193 Ga0207680_10638948 3300025903 Bacteria 762
194 Ga0207647_10017565 3300025904 Bacteria 4862
195 Ga0207643_10067655 3300025908 Bacteria 2050
196 Ga0207705_10724240 3300025909 Bacteria 773
197 Ga0207654_10142866 3300025911 Bacteria 1528
198 Ga0207671_10401647 3300025914 Bacteria 1090
199 Ga0207693_10156646 3300025915 Bacteria 1791
200 Ga0207663_10317991 3300025916 Bacteria 1169
201 Ga0207663_10489512 3300025916 Bacteria 954
202 Ga0207660_10140596 3300025917 Bacteria 1845
203 Ga0207660_10515773 3300025917 Bacteria 970
204 Ga0207660_10553604 3300025917 Bacteria 936
205 Ga0207662_10588867 3300025918 Bacteria 773
206 Ga0207657_10028997 3300025919 Bacteria 5043
207 Ga0207652_10116402 3300025921 Bacteria 2375
208 Ga0207652_10539149 3300025921 Bacteria 1049
209 Ga0207652_10576024 3300025921 Bacteria 1011
210 Ga0207652_11883961 3300025921 Bacteria 503
211 Ga0207681_10278335 3300025923 Bacteria 1316
212 Ga0207659_10345391 3300025926 Bacteria 1233
213 Ga0207659_10553011 3300025926 Bacteria 978
214 Ga0207700_10919898 3300025928 Bacteria 783
215 Ga0207644_10829296 3300025931 Bacteria 774
216 Ga0207690_10060890 3300025932 Bacteria 2564
217 Ga0207706_10034755 3300025933 Bacteria 4484
218 Ga0207706_10456056 3300025933 Bacteria 1106
219 Ga0207670_10174202 3300025936 Bacteria 1615
220 Ga0207670_10212125 3300025936 Bacteria 1477
221 Ga0207670_10603344 3300025936 Bacteria 902
222 Ga0207669_10061980 3300025937 Bacteria 2301
223 Ga0207704_11960263 3300025938 Bacteria 504
224 Ga0207691_10083746 3300025940 Bacteria 2863
225 Ga0207691_10608380 3300025940 Bacteria 925
226 Ga0207711_11344942 3300025941 Bacteria 657
227 Ga0207661_10382489 3300025944 Bacteria 1274
228 Ga0207679_11214043 3300025945 Bacteria 692
229 Ga0207712_10606258 3300025961 Bacteria 948
230 Ga0207668_10039219 3300025972 Bacteria 3186
231 Ga0207668_10116212 3300025972 Bacteria 2017
232 Ga0207668_10200609 3300025972 Bacteria 1588
233 Ga0207668_11289945 3300025972 Bacteria 657
234 Ga0207677_10385858 3300026023 Bacteria 1184
235 Ga0207703_10041007 3300026035 Bacteria 3707
236 Ga0207639_10020651 3300026041 Bacteria 4717
237 Ga0207678_10009958 3300026067 Bacteria 8340
238 Ga0207678_10348036 3300026067 Bacteria 1278
239 Ga0207678_11599693 3300026067 Bacteria 574
240 Ga0207708_10035615 3300026075 Bacteria 3787
241 Ga0207708_10137241 3300026075 Bacteria 1916
242 Ga0207708_10583907 3300026075 Bacteria 945
243 Ga0207702_11582907 3300026078 Bacteria 649
244 Ga0207648_10407107 3300026089 Bacteria 1233
245 Ga0207648_11456304 3300026089 Bacteria 644
246 Ga0207674_10372230 3300026116 Bacteria 1381
247 Ga0207674_12045640 3300026116 Bacteria 537
248 Ga0207675_100121622 3300026118 Bacteria 2471
249 Ga0207683_10274075 3300026121 Bacteria 1541
250 Ga0207698_11750292 3300026142 Bacteria 637
251 Ga0209996_1014313 3300027395 Bacteria 1077
252 Ga0210000_1008868 3300027462 Bacteria 1476
253 Ga0209588_1104131 3300027671 Bacteria 912
254 Ga0209971_1004899 3300027682 Bacteria 3181
255 Ga0209966_1015359 3300027695 Bacteria 1437
256 Ga0209966_1116157 3300027695 Bacteria 612
257 Ga0209998_10005564 3300027717 Bacteria 2634
258 Ga0209998_10075583 3300027717 Bacteria 810
259 Ga0209974_10012884 3300027876 Bacteria 2792
260 Ga0209974_10024452 3300027876 Bacteria 1999
261 Ga0209974_10091804 3300027876 Bacteria 1054
262 Ga0207428_10000058 3300027907 Bacteria 158579
263 Ga0207428_10001877 3300027907 Bacteria 21401
264 Ga0207428_10576386 3300027907 Bacteria 812
265 Ga0268266_11034283 3300028379 Bacteria 795
266 Ga0268265_10076997 3300028380 Bacteria 2618
267 Ga0268264_10063477 3300028381 Bacteria 3105
268 Ga0265340_10391574 3300031247 Bacteria 613
269 Ga0265339_10560887 3300031249 Bacteria 525
270 Ga0307408_101105023 3300031548 Bacteria 735
271 Ga0265313_10256165 3300031595 Bacteria 712
272 Ga0316579_10002736 3300031691 Bacteria 6729
273 Ga0265314_10017614 3300031711 Bacteria 5600
274 Ga0265314_10186209 3300031711 Bacteria 1239
275 Ga0265314_10300922 3300031711 Bacteria 900
276 Ga0307406_10039922 3300031901 Bacteria 2915
277 Ga0307406_10285464 3300031901 Bacteria 1261
278 Ga0307416_103263642 3300032002 Bacteria 543
279 Ga0307414_10106706 3300032004 Bacteria 2121
280 Ga0307414_11704598 3300032004 Bacteria 588
281 Ga0316583_10321810 3300032133 Bacteria 535
282 Ga0373930_0000227 3300034816 Bacteria 7077
283 Ga0373948_0021808 3300034817 Bacteria 1229
284 Ga0373950_0000785 3300034818 Bacteria 3965
285 Ga0373959_0000278 3300034820 Bacteria 10960
286 Ga0373938_0000185 3300034957 Bacteria 9182
287 Ga0373928_0000509 3300035084 Bacteria 7637
288 Ga0373929_0000347 3300035085 Bacteria 8661
289 Ga0373934_0033195 3300035086 Bacteria 2026
290 Ga0373940_0000033 3300035088 Bacteria 15017
291 Ga0373949_0007020 3300035090 Bacteria 2470
292 Ga0373951_0002035 3300035091 Bacteria 5174
293 Ga0373952_0000067 3300035092 Bacteria 13144
294 Ga0373932_0011835 3300035112 Bacteria 2138
295 Ga0373939_0005595 3300035114 Bacteria 2994
296 Ga0373941_0000055 3300035115 Bacteria 17323
297 Ga0373953_0139227 3300035117 Bacteria 1037
298 Ga0373954_0034924 3300035118 Bacteria 2330
299 Ga0373957_0013363 3300035120 Bacteria 2785
300 Ga0373960_0000621 3300035121 Bacteria 7257
301 Ga0373943_0962013 3300035170 Bacteria 511
302 Ga0373955_0008944 3300035172 Bacteria 4674
303 Ga0373942_0000604 3300035207 Bacteria 10088
304 Ga0373961_0006501 3300035241 Bacteria 2806
305 Ga0373961_0162518 3300035241 Bacteria 768
306 Ga0373924_0275174 3300035410 Bacteria 746
307 Ga0373935_0146333 3300035692 Bacteria 1600
308 Ga0373933_0053701 3300035724 Bacteria 2413
309 Ga0373947_0058636 3300035725 Bacteria 2333
310 Ga0373937_0051826 3300036401 Bacteria 3761
311 Ga0373937_0705245 3300036401 Bacteria 956
312 Ga0373925_0008196 3300037068 Bacteria 7606
313 Ga0373925_0649790 3300037068 Bacteria 869
314 Ga0242419_012888 3300038698 Bacteria 656
315 Ga0242420_046149 3300038996 Bacteria 842
316 Ga0237816_09314 3300039145 Bacteria 586
317 Ga0439453_0155854 3300041408 Bacteria 544
318 Ga0439465_0236842 3300041413 Bacteria 672
319 Ga0451807_0706480 3300041486 Bacteria 523
320 Ga0439441_108094 3300042001 Bacteria 629
321 Ga0439450_026365 3300042008 Bacteria 1280
322 Ga0439454_051245 3300042011 Bacteria 697
323 Ga0439463_064797 3300042016 Bacteria 934
324 Ga0439458_0030570 3300042157 Bacteria 1282
325 Ga0439435_0278045 3300042436 Bacteria 569
326 Ga0439464_0106588 3300042439 Bacteria 855
327 Ga0439460_0119991 3300042461 Bacteria 859
328 Ga0439440_0139702 3300042993 Bacteria 687
329 Ga0453683_1148553 3300044673 Bacteria 519
330 Ga0453684_0205388 3300044712 Bacteria 2293
331 Ga0466960_0376935 3300044901 Bacteria 814
332 Ga0451576_0178747 3300045051 Bacteria 2215
333 Ga0495592_0004712 3300046454 Bacteria 10006
334 Ga0495641_0042436 3300046461 Bacteria 2108
335 Ga0495651_0272279 3300046462 Bacteria 1147
336 Ga0495653_0154010 3300046463 Bacteria 1603
337 Ga0495664_0148765 3300046477 Bacteria 1420
338 Ga0495628_0005498 3300046516 Bacteria 11090
339 Ga0495630_0117327 3300046517 Bacteria 2018
340 Ga0495632_0003225 3300046519 Bacteria 11714
341 Ga0495652_0033641 3300046529 Bacteria 4472
342 Ga0495640_0378965 3300046533 Bacteria 871
343 Ga0495587_0020754 3300046536 Bacteria 4053
344 Ga0495587_0841355 3300046536 Bacteria 500
345 Ga0495598_0069656 3300046537 Bacteria 1105
346 Ga0495667_0014419 3300046559 Bacteria 5340
347 Ga0495635_0109072 3300046663 Bacteria 1891
348 Ga0495661_0453549 3300046665 Bacteria 617
349 Ga0495588_0445882 3300046674 Bacteria 679
350 Ga0495657_0027025 3300046675 Bacteria 4056
351 Ga0495599_0004339 3300046678 Bacteria 8391
352 Ga0495646_0097491 3300046680 Bacteria 1689
353 Ga0495669_0531215 3300046684 Bacteria 572
354 Ga0495624_0176158 3300046690 Bacteria 1304
355 Ga0495600_0088393 3300046809 Bacteria 2021
356 Ga0495604_0025651 3300047317 Bacteria 4695
357 Ga0495674_0058374 3300047319 Bacteria 3374
358 Ga0495680_0069720 3300047322 Bacteria 2682
359 Ga0495684_0097041 3300047471 Bacteria 2230
360 Ga0495686_0252318 3300047472 Bacteria 991
361 Ga0495593_0383433 3300047673 Bacteria 703
362 Ga0495602_0008977 3300048088 Bacteria 10417
363 Ga0495602_0456574 3300048088 Bacteria 901
364 Ga0496100_0520869 3300048903 Bacteria 918
365 Ga0496102_0044569 3300048905 Bacteria 4026
366 Ga0496105_0089474 3300048908 Bacteria 2543
367 Ga0496106_0012821 3300048909 Bacteria 6188
368 Ga0496107_0087659 3300048910 Bacteria 2272
369 Ga0496108_0105128 3300048911 Bacteria 2410
370 Ga0496108_0440528 3300048911 Bacteria 1138
371 Ga0496109_0439229 3300048912 Bacteria 1233
372 Ga0496109_0496861 3300048912 Bacteria 1151
373 Ga0496109_1175757 3300048912 Bacteria 704
374 Ga0496110_0013167 3300048913 Bacteria 6830
375 Ga0496110_0927345 3300048913 Bacteria 777
376 Ga0496110_1104756 3300048913 Bacteria 701
377 Ga0496110_1194275 3300048913 Bacteria 669
378 Ga0496110_1206768 3300048913 Bacteria 665
379 Ga0496111_0127704 3300048914 Bacteria 1880
380 Ga0496111_0150935 3300048914 Bacteria 1723
381 Ga0496111_0197082 3300048914 Bacteria 1497
382 Ga0496111_1012095 3300048914 Bacteria 595
383 Ga0496113_0081004 3300048916 Bacteria 2488
384 Ga0496113_1034548 3300048916 Bacteria 646
385 Ga0496114_0065824 3300048917 Bacteria 3037
386 Ga0496114_0290353 3300048917 Bacteria 1443
387 Ga0496114_1287127 3300048917 Bacteria 618
388 Ga0496115_0031869 3300048918 Bacteria 4156
389 Ga0496115_0305513 3300048918 Bacteria 1303
390 Ga0496116_0064701 3300048919 Bacteria 2350
391 Ga0496117_0043257 3300048920 Bacteria 3277
392 Ga0496117_0267218 3300048920 Bacteria 923
393 Ga0496118_0328944 3300048921 Bacteria 825
394 Ga0496119_0534602 3300048922 Bacteria 541
395 Ga0496120_0285480 3300048923 Bacteria 761
396 Ga0496121_0307134 3300048924 Bacteria 1074
397 Ga0496122_0064755 3300048925 Bacteria 2657
398 Ga0496122_0219051 3300048925 Bacteria 1094
399 Ga0496123_0041361 3300048926 Bacteria 3196
400 Ga0496123_0173110 3300048926 Bacteria 1136
401 Ga0496123_0183946 3300048926 Bacteria 1088
402 Ga0496125_0000282 3300048928 Bacteria 101380
403 Ga0496125_0160216 3300048928 Bacteria 1530
404 Ga0496125_0331699 3300048928 Bacteria 917
405 Ga0496125_0360107 3300048928 Bacteria 865
406 Ga0496126_0064126 3300048929 Bacteria 3292
407 Ga0496126_0660466 3300048929 Bacteria 817
408 Ga0501031_0056956 3300049568 Bacteria 2547
409 Ga0501032_0005814 3300049569 Bacteria 9122
410 Ga0501032_0022549 3300049569 Bacteria 4364
411 Ga0501032_0080309 3300049569 Bacteria 2170
412 Ga0501032_0128223 3300049569 Bacteria 1675
413 Ga0501032_0583771 3300049569 Bacteria 711
414 Ga0501033_0003939 3300049570 Bacteria 12043
415 Ga0501033_0008967 3300049570 Bacteria 7724
416 Ga0501033_0012798 3300049570 Bacteria 6397
417 Ga0501033_0105529 3300049570 Bacteria 2053
418 Ga0501034_0017011 3300049571 Bacteria 7455
419 Ga0501034_0025138 3300049571 Bacteria 6061
420 Ga0501034_0161102 3300049571 Bacteria 2214
421 Ga0501034_0235966 3300049571 Bacteria 1776
422 Ga0501034_0255410 3300049571 Bacteria 1696
423 Ga0501034_0262862 3300049571 Bacteria 1668
424 Ga0501034_0274917 3300049571 Bacteria 1625
425 Ga0501034_0281175 3300049571 Bacteria 1603
426 Ga0501034_0365764 3300049571 Bacteria 1369
427 Ga0501036_0008301 3300049572 Bacteria 8510
428 Ga0501036_0033397 3300049572 Bacteria 4352
429 Ga0501036_0036040 3300049572 Bacteria 4186
430 Ga0501036_0440571 3300049572 Bacteria 1086
431 Ga0501036_0456638 3300049572 Bacteria 1064
432 Ga0501036_0936996 3300049572 Bacteria 710
433 Ga0501037_0010290 3300049573 Bacteria 6865
434 Ga0501037_0014152 3300049573 Bacteria 5873
435 Ga0501037_0035288 3300049573 Bacteria 3689
436 Ga0501037_0047155 3300049573 Bacteria 3159
437 Ga0501038_0015032 3300049574 Bacteria 7050
438 Ga0501038_0020331 3300049574 Bacteria 5970
439 Ga0501038_0051388 3300049574 Bacteria 3557
440 Ga0501038_0392985 3300049574 Bacteria 1074
441 Ga0501039_0001301 3300049575 Bacteria 18242
442 Ga0501039_0224310 3300049575 Bacteria 1477
443 Ga0501039_0308118 3300049575 Bacteria 1245
444 Ga0501039_0753831 3300049575 Bacteria 760
445 Ga0501041_0297230 3300049577 Bacteria 1017
446 Ga0501042_0083688 3300049578 Bacteria 2287
447 Ga0501042_0141123 3300049578 Bacteria 1737
448 Ga0501043_0002203 3300049579 Bacteria 16610
449 Ga0501043_0041913 3300049579 Bacteria 3596
450 Ga0501043_0087832 3300049579 Bacteria 2443
451 Ga0501043_0326893 3300049579 Bacteria 1168
452 Ga0501043_0379603 3300049579 Bacteria 1070
453 Ga0501043_1176741 3300049579 Bacteria 539
454 Ga0501046_0012154 3300049580 Bacteria 7338
455 Ga0501046_0407519 3300049580 Bacteria 981
456 Ga0501046_0436931 3300049580 Bacteria 942
457 Ga0501046_0732728 3300049580 Bacteria 695
458 Ga0501047_0005496 3300049581 Bacteria 11927
459 Ga0501047_0016792 3300049581 Bacteria 6994
460 Ga0501047_0135752 3300049581 Bacteria 2340
461 Ga0501047_0159507 3300049581 Bacteria 2128
462 Ga0501047_0507416 3300049581 Bacteria 1032
463 Ga0501047_0526369 3300049581 Bacteria 1008
464 Ga0501047_0784139 3300049581 Bacteria 768
465 Ga0501048_0000886 3300049582 Bacteria 22125
466 Ga0501048_0251496 3300049582 Bacteria 1255
467 Ga0501048_0302179 3300049582 Bacteria 1139
468 Ga0501067_0033707 3300049583 Bacteria 2841
469 Ga0501068_0012080 3300049584 Bacteria 4887
470 Ga0501068_0034753 3300049584 Bacteria 3008
471 Ga0501068_0143614 3300049584 Bacteria 1497
472 Ga0501068_0838650 3300049584 Bacteria 604
473 Ga0501068_1208047 3300049584 Bacteria 501
474 Ga0501069_0000437 3300049585 Bacteria 18980
475 Ga0501069_0088479 3300049585 Bacteria 1750
476 Ga0501069_0364034 3300049585 Bacteria 853
477 Ga0501070_0002038 3300049586 Bacteria 17765
478 Ga0501070_0011845 3300049586 Bacteria 7362
479 Ga0501070_0026855 3300049586 Bacteria 4829
480 Ga0501070_0122036 3300049586 Bacteria 2153
481 Ga0501070_0399194 3300049586 Bacteria 1112
482 Ga0501070_0608936 3300049586 Bacteria 870
483 Ga0501070_1034397 3300049586 Bacteria 636
484 Ga0501071_0005718 3300049587 Bacteria 8021
485 Ga0501071_0096456 3300049587 Bacteria 2176
486 Ga0501071_1061781 3300049587 Bacteria 626
487 Ga0501072_0010471 3300049588 Bacteria 7063
488 Ga0501072_0756562 3300049588 Bacteria 762
489 Ga0501073_0006839 3300049589 Bacteria 8478
490 Ga0501073_0007850 3300049589 Bacteria 7921
491 Ga0501073_0016521 3300049589 Bacteria 5350
492 Ga0501073_0028970 3300049589 Bacteria 3956
493 Ga0501073_0455653 3300049589 Bacteria 884
494 Ga0501073_0530836 3300049589 Bacteria 813
495 Ga0501073_0832642 3300049589 Bacteria 636
496 Ga0501073_0858167 3300049589 Bacteria 625
497 Ga0501074_0003168 3300049590 Bacteria 11602
498 Ga0501074_0028988 3300049590 Bacteria 4010
499 Ga0501074_0030900 3300049590 Bacteria 3881
500 Ga0501075_0004711 3300049591 Bacteria 9262
501 Ga0501075_0604168 3300049591 Bacteria 837
502 Ga0501076_0014561 3300049592 Bacteria 5928
503 Ga0501076_0035062 3300049592 Bacteria 3925
504 Ga0501076_0084946 3300049592 Bacteria 2543
505 Ga0501077_0059772 3300049593 Bacteria 2419
506 Ga0501077_0086240 3300049593 Bacteria 1990
507 Ga0501077_0475960 3300049593 Bacteria 800
508 Ga0501079_0009707 3300049741 Bacteria 7297
509 Ga0501079_0046836 3300049741 Bacteria 3337
510 Ga0501079_0088682 3300049741 Bacteria 2395
511 Ga0501079_0529243 3300049741 Bacteria 927
512 Ga0501080_0010101 3300049742 Bacteria 8632
513 Ga0501080_0040450 3300049742 Bacteria 4348
514 Ga0501080_0060516 3300049742 Bacteria 3525
515 Ga0501080_0492287 3300049742 Bacteria 1096
516 Ga0501081_0015721 3300049743 Bacteria 4995
517 Ga0501081_0127376 3300049743 Bacteria 1817
518 Ga0501081_0682676 3300049743 Bacteria 771
519 Ga0501083_0011452 3300049744 Bacteria 6221
520 Ga0501083_0153165 3300049744 Bacteria 1509
521 Ga0501083_0194569 3300049744 Bacteria 1323
522 Ga0501035_0001764 3300049822 Bacteria 21833
523 Ga0501035_0004712 3300049822 Bacteria 12950
524 Ga0501035_0016845 3300049822 Bacteria 6737
525 Ga0501035_0027344 3300049822 Bacteria 5214
526 Ga0501035_0085797 3300049822 Bacteria 2774
527 Ga0501035_0499219 3300049822 Bacteria 1002
528 Ga0501035_1408471 3300049822 Bacteria 534
529 Ga0501044_0010691 3300049823 Bacteria 9958
530 Ga0501044_0018487 3300049823 Bacteria 7467
531 Ga0501044_0025958 3300049823 Bacteria 6206
532 Ga0501044_0044749 3300049823 Bacteria 4591
533 Ga0501044_0110800 3300049823 Bacteria 2753
534 Ga0501045_0018183 3300049824 Bacteria 4996
535 Ga0501045_0707539 3300049824 Bacteria 743
536 nmdc:mga00v17_351574_c1 3300050491 Bacteria 958
537 nmdc:mga0yw44_1064017_c1 3300050492 Bacteria 547
538 nmdc:mga0yw44_485620_c1 3300050492 Bacteria 838
539 nmdc:mga0yw44_914399_c1 3300050492 Bacteria 595
540 nmdc:mga0yw44_937_c1 3300050492 Bacteria 7973
541 nmdc:mga0k408_26602_c1 3300050493 Bacteria 3281
542 nmdc:mga05p37_1492059_c1 3300050507 Bacteria 674
543 nmdc:mga05p37_334227_c1 3300050507 Bacteria 1788
544 nmdc:mga05p37_35_c1 3300050507 Bacteria 110751
545 nmdc:mga05p37_6170_c1 3300050507 Bacteria 14110
546 nmdc:mga05p37_890095_c1 3300050507 Bacteria 961
547 nmdc:mga09592_163_c1 3300050508 Bacteria 46620
548 nmdc:mga09592_41900_c1 3300050508 Bacteria 3851
549 nmdc:mga0qj67_143_c1 3300050509 Bacteria 48269
550 nmdc:mga0qj67_154190_c1 3300050509 Bacteria 1864
551 nmdc:mga06r32_34027_c1 3300050510 Bacteria 4803
552 nmdc:mga06r32_936_c1 3300050510 Bacteria 25964
553 nmdc:mga08y16_1040379_c1 3300050511 Bacteria 797
554 nmdc:mga08y16_1688624_c1 3300050511 Bacteria 589
555 nmdc:mga08y16_231052_c1 3300050511 Bacteria 1913
556 nmdc:mga08y16_2671_c1 3300050511 Bacteria 18327
557 nmdc:mga08y16_6719_c1 3300050511 Bacteria 12057
558 nmdc:mga0n895_33593_c1 3300050512 Bacteria 4932
559 nmdc:mga0n895_356672_c1 3300050512 Bacteria 1481
560 nmdc:mga0n895_457589_c1 3300050512 Bacteria 1288
561 nmdc:mga0rr50_1301_c1 3300050513 Bacteria 13614
562 nmdc:mga0rr50_3039_c1 3300050513 Bacteria 9598
563 nmdc:mga08x19_1012080_c1 3300050514 Bacteria 590
564 nmdc:mga08x19_437774_c1 3300050514 Bacteria 919
565 nmdc:mga0a205_2132_c1 3300050515 Bacteria 17371
566 nmdc:mga0a205_38040_c1 3300050515 Bacteria 4628
567 nmdc:mga0a205_63150_c1 3300050515 Bacteria 3578
568 nmdc:mga0sz30_511555_c1 3300050516 Bacteria 540
569 Ga0495601_0000485 3300053077 Bacteria 20919
570 Ga0495612_0000714 3300053078 Bacteria 13470
571 Ga0495595_0321732 3300053084 Bacteria 779
572 Ga0495595_0336146 3300053084 Bacteria 761
573 Ga0495619_0000487 3300053085 Bacteria 26605
574 Ga0495619_0465601 3300053085 Bacteria 871
575 Ga0500651_0328894 3300053093 Bacteria 871
576 Ga0500569_267146 3300053109 Bacteria 579
577 Ga0500608_254464 3300053122 Bacteria 683
578 Ga0500642_0229223 3300053130 Bacteria 859
579 Ga0500568_0039859 3300053139 Bacteria 1894
580 Ga0500586_272472 3300053145 Bacteria 521
581 Ga0500616_0109020 3300053153 Bacteria 1340
582 Ga0500636_0011757 3300053177 Bacteria 5124
583 Ga0501084_0018001 3300054114 Bacteria 5883
584 Ga0501084_0272197 3300054114 Bacteria 1430
585 Ga0501084_0457801 3300054114 Bacteria 1078
586 Ga0590075_111010 3300059424 Bacteria 716
587 Ga0501082_0029163 3300060353 Bacteria 4754
588 Ga0501082_0057648 3300060353 Bacteria 3346
589 Ga0501082_0227049 3300060353 Bacteria 1625
590 Ga0501082_0338044 3300060353 Bacteria 1312
591 Ga0501082_1331741 3300060353 Bacteria 627
592 Ga0530510_0064349 3300061734 Bacteria 2656
593 Ga0530510_0524342 3300061734 Bacteria 899

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046665 Ga0495661_0453549 Ga0495661_0453549_66_311 76
2 3300005347 Ga0070668_100347040 Ga0070668_1003470402 79
3 3300006051 Ga0075364_10108738 Ga0075364_101087383 79
4 3300002987 JGI25159J45721_1021639 JGI25159J45721_10216392 80
5 3300003187 JGI25151J46595_10000018 JGI25151J46595_1000001828 80
6 3300003187 JGI25151J46595_10034061 JGI25151J46595_100340613 80
7 3300003771 Ga0055526_1000362 Ga0055526_100036224 80
8 3300003771 Ga0055526_1000571 Ga0055526_10005718 80
9 3300003775 Ga0055524_1000048 Ga0055524_1000048101 80
10 3300003775 Ga0055524_1027828 Ga0055524_10278282 80
11 3300003784 Ga0055534_1008656 Ga0055534_10086563 80
12 3300005262 Ga0065165_1000337 Ga0065165_100033726 80
13 3300006038 Ga0075365_10029225 Ga0075365_100292253 80
14 3300006042 Ga0075368_10514054 Ga0075368_105140541 80
15 3300006051 Ga0075364_10469646 Ga0075364_104696462 80
16 3300006186 Ga0075369_10189743 Ga0075369_101897432 80
17 3300013250 Ga0171462_1009 Ga0171462_100997 80
18 3300025273 Ga0209673_1008228 Ga0209673_10082284 80
19 3300025284 Ga0209130_1001417 Ga0209130_100141719 80
20 3300025291 Ga0209675_1000799 Ga0209675_100079915 80
21 3300025292 Ga0209676_1038968 Ga0209676_10389682 80
22 3300025294 Ga0209025_1000010 Ga0209025_100001037 80
23 3300025294 Ga0209025_1001591 Ga0209025_100159122 80
24 3300025294 Ga0209025_1040973 Ga0209025_10409733 80
25 3300025295 Ga0209564_1000019 Ga0209564_1000019207 80
26 3300025295 Ga0209564_1000034 Ga0209564_1000034204 80
27 3300025299 Ga0209256_1000026 Ga0209256_1000026192 80
28 3300025299 Ga0209256_1000232 Ga0209256_100023225 80
29 3300025299 Ga0209256_1029369 Ga0209256_10293692 80
30 3300025302 Ga0207426_1013477 Ga0207426_10134772 80
31 3300025304 Ga0209257_1031090 Ga0209257_10310902 80
32 3300025972 Ga0207668_10039219 Ga0207668_100392192 80
33 3300031901 Ga0307406_10039922 Ga0307406_100399224 80
34 3300032004 Ga0307414_11704598 Ga0307414_117045982 80
35 3300039145 Ga0237816_09314 Ga0237816_09314_220_462 80
36 3300041413 Ga0439465_0236842 Ga0439465_0236842_84_326 80
37 3300048913 Ga0496110_1104756 Ga0496110_1104756_163_405 80
38 3300048917 Ga0496114_0290353 Ga0496114_0290353_18_260 80
39 3300048920 Ga0496117_0043257 Ga0496117_0043257_1742_1996 80
40 3300048920 Ga0496117_0267218 Ga0496117_0267218_19_261 80
41 3300048921 Ga0496118_0328944 Ga0496118_0328944_460_714 80
42 3300048922 Ga0496119_0534602 Ga0496119_0534602_104_358 80
43 3300048923 Ga0496120_0285480 Ga0496120_0285480_427_681 80
44 3300048924 Ga0496121_0307134 Ga0496121_0307134_172_414 80
45 3300048925 Ga0496122_0064755 Ga0496122_0064755_2248_2502 80
46 3300048925 Ga0496122_0219051 Ga0496122_0219051_357_599 80
47 3300048926 Ga0496123_0041361 Ga0496123_0041361_2185_2427 80
48 3300048926 Ga0496123_0173110 Ga0496123_0173110_218_472 80
49 3300048926 Ga0496123_0183946 Ga0496123_0183946_400_642 80
50 3300048928 Ga0496125_0160216 Ga0496125_0160216_1276_1518 80
51 3300048928 Ga0496125_0331699 Ga0496125_0331699_240_482 80
52 3300048929 Ga0496126_0064126 Ga0496126_0064126_2566_2841 80
53 3300048929 Ga0496126_0660466 Ga0496126_0660466_26_268 80
54 3300049571 Ga0501034_0025138 Ga0501034_0025138_846_1091 80
55 3300049575 Ga0501039_0224310 Ga0501039_0224310_1185_1430 80
56 3300049581 Ga0501047_0784139 Ga0501047_0784139_22_282 80
57 3300049586 Ga0501070_1034397 Ga0501070_1034397_293_538 80
58 3300050491 nmdc:mga00v17_351574_c1 nmdc:mga00v17_351574_c1_472_714 80
59 3300050492 nmdc:mga0yw44_1064017_c1 nmdc:mga0yw44_1064017_c1_193_435 80
60 3300050492 nmdc:mga0yw44_914399_c1 nmdc:mga0yw44_914399_c1_202_444 80
61 3300050492 nmdc:mga0yw44_937_c1 nmdc:mga0yw44_937_c1_6119_6361 80
62 3300053109 Ga0500569_267146 Ga0500569_267146_58_312 80
63 3300053122 Ga0500608_254464 Ga0500608_254464_28_282 80
64 3300053177 Ga0500636_0011757 Ga0500636_0011757_2701_2955 80
65 3300003215 JGI25153J46596_10004251 JGI25153J46596_100042512 81
66 3300005459 Ga0068867_101644605 Ga0068867_1016446051 81
67 3300006042 Ga0075368_10135504 Ga0075368_101355042 81
68 3300006051 Ga0075364_10571059 Ga0075364_105710592 81
69 3300006177 Ga0075362_10157543 Ga0075362_101575432 81
70 3300006177 Ga0075362_10298600 Ga0075362_102986001 81
71 3300006178 Ga0075367_10243956 Ga0075367_102439562 81
72 3300006195 Ga0075366_10005461 Ga0075366_100054613 81
73 3300009094 Ga0111539_11882510 Ga0111539_118825102 81
74 3300009147 Ga0114129_11684597 Ga0114129_116845972 81
75 3300009177 Ga0105248_12359944 Ga0105248_123599442 81
76 3300013100 Ga0157373_10991369 Ga0157373_109913692 81
77 3300025297 Ga0209758_1000251 Ga0209758_100025114 81
78 3300025302 Ga0207426_1031206 Ga0207426_10312063 81
79 3300025916 Ga0207663_10317991 Ga0207663_103179912 81
80 3300031247 Ga0265340_10391574 Ga0265340_103915742 81
81 3300031249 Ga0265339_10560887 Ga0265339_105608872 81
82 3300031711 Ga0265314_10017614 Ga0265314_100176142 81
83 3300031901 Ga0307406_10285464 Ga0307406_102854642 81
84 3300032004 Ga0307414_10106706 Ga0307414_101067063 81
85 3300035241 Ga0373961_0162518 Ga0373961_0162518_131_418 81
86 3300041486 Ga0451807_0706480 Ga0451807_0706480_47_292 81
87 3300042001 Ga0439441_108094 Ga0439441_108094_295_546 81
88 3300042011 Ga0439454_051245 Ga0439454_051245_410_661 81
89 3300044901 Ga0466960_0376935 Ga0466960_0376935_377_628 81
90 3300046519 Ga0495632_0003225 Ga0495632_0003225_6154_6399 81
91 3300046674 Ga0495588_0445882 Ga0495588_0445882_342_587 81
92 3300047472 Ga0495686_0252318 Ga0495686_0252318_220_465 81
93 3300048913 Ga0496110_1194275 Ga0496110_1194275_232_477 81
94 3300048914 Ga0496111_0150935 Ga0496111_0150935_884_1129 81
95 3300048919 Ga0496116_0064701 Ga0496116_0064701_1202_1447 81
96 3300048928 Ga0496125_0000282 Ga0496125_0000282_97723_97968 81
97 3300049569 Ga0501032_0022549 Ga0501032_0022549_3624_3887 81
98 3300049570 Ga0501033_0008967 Ga0501033_0008967_2065_2328 81
99 3300049571 Ga0501034_0255410 Ga0501034_0255410_654_917 81
100 3300049571 Ga0501034_0262862 Ga0501034_0262862_833_1084 81
101 3300049572 Ga0501036_0033397 Ga0501036_0033397_1440_1703 81
102 3300049572 Ga0501036_0440571 Ga0501036_0440571_553_807 81
103 3300049573 Ga0501037_0014152 Ga0501037_0014152_3879_4142 81
104 3300049574 Ga0501038_0020331 Ga0501038_0020331_1721_1984 81
105 3300049574 Ga0501038_0392985 Ga0501038_0392985_219_473 81
106 3300049577 Ga0501041_0297230 Ga0501041_0297230_326_580 81
107 3300049578 Ga0501042_0083688 Ga0501042_0083688_200_454 81
108 3300049579 Ga0501043_0087832 Ga0501043_0087832_1395_1658 81
109 3300049579 Ga0501043_0326893 Ga0501043_0326893_684_932 81
110 3300049580 Ga0501046_0407519 Ga0501046_0407519_633_887 81
111 3300049580 Ga0501046_0732728 Ga0501046_0732728_153_416 81
112 3300049581 Ga0501047_0507416 Ga0501047_0507416_654_917 81
113 3300049582 Ga0501048_0302179 Ga0501048_0302179_194_448 81
114 3300049584 Ga0501068_0143614 Ga0501068_0143614_476_730 81
115 3300049586 Ga0501070_0026855 Ga0501070_0026855_1206_1469 81
116 3300049586 Ga0501070_0608936 Ga0501070_0608936_611_859 81
117 3300049587 Ga0501071_0005718 Ga0501071_0005718_5363_5617 81
118 3300049588 Ga0501072_0010471 Ga0501072_0010471_3320_3574 81
119 3300049589 Ga0501073_0530836 Ga0501073_0530836_198_452 81
120 3300049589 Ga0501073_0858167 Ga0501073_0858167_115_378 81
121 3300049590 Ga0501074_0030900 Ga0501074_0030900_1950_2204 81
122 3300049591 Ga0501075_0004711 Ga0501075_0004711_4137_4391 81
123 3300049592 Ga0501076_0035062 Ga0501076_0035062_3583_3837 81
124 3300049593 Ga0501077_0059772 Ga0501077_0059772_2135_2389 81
125 3300049741 Ga0501079_0046836 Ga0501079_0046836_411_665 81
126 3300049741 Ga0501079_0529243 Ga0501079_0529243_470_742 81
127 3300049743 Ga0501081_0127376 Ga0501081_0127376_757_1011 81
128 3300049822 Ga0501035_0027344 Ga0501035_0027344_1232_1480 81
129 3300049822 Ga0501035_0085797 Ga0501035_0085797_786_1049 81
130 3300049822 Ga0501035_0499219 Ga0501035_0499219_188_451 81
131 3300049823 Ga0501044_0018487 Ga0501044_0018487_5561_5824 81
132 3300049823 Ga0501044_0044749 Ga0501044_0044749_885_1133 81
133 3300049824 Ga0501045_0018183 Ga0501045_0018183_1855_2109 81
134 3300050493 nmdc:mga0k408_26602_c1 nmdc:mga0k408_26602_c1_1541_1801 81
135 3300050516 nmdc:mga0sz30_511555_c1 nmdc:mga0sz30_511555_c1_268_519 81
136 3300053093 Ga0500651_0328894 Ga0500651_0328894_207_455 81
137 3300053130 Ga0500642_0229223 Ga0500642_0229223_302_553 81
138 3300053139 Ga0500568_0039859 Ga0500568_0039859_675_926 81
139 3300053145 Ga0500586_272472 Ga0500586_272472_108_353 81
140 3300053153 Ga0500616_0109020 Ga0500616_0109020_734_985 81
141 3300054114 Ga0501084_0457801 Ga0501084_0457801_434_688 81
142 3300059424 Ga0590075_111010 Ga0590075_111010_374_628 81
143 3300060353 Ga0501082_0057648 Ga0501082_0057648_2163_2417 81
144 3300060353 Ga0501082_1331741 Ga0501082_1331741_223_495 81
145 3300061734 Ga0530510_0064349 Ga0530510_0064349_1860_2114 81
146 3300005329 Ga0070683_102352263 Ga0070683_1023522632 82
147 3300005336 Ga0070680_101874744 Ga0070680_1018747441 82
148 3300005339 Ga0070660_100171040 Ga0070660_1001710403 82
149 3300005339 Ga0070660_101105022 Ga0070660_1011050222 82
150 3300005340 Ga0070689_100132519 Ga0070689_1001325192 82
151 3300005441 Ga0070700_100229568 Ga0070700_1002295681 82
152 3300005459 Ga0068867_100190787 Ga0068867_1001907872 82
153 3300005530 Ga0070679_101737760 Ga0070679_1017377602 82
154 3300005549 Ga0070704_100774390 Ga0070704_1007743902 82
155 3300005563 Ga0068855_100109516 Ga0068855_1001095162 82
156 3300005564 Ga0070664_101830047 Ga0070664_1018300472 82
157 3300005577 Ga0068857_100329950 Ga0068857_1003299502 82
158 3300005577 Ga0068857_101536523 Ga0068857_1015365232 82
159 3300005578 Ga0068854_100134111 Ga0068854_1001341112 82
160 3300005614 Ga0068856_101829695 Ga0068856_1018296952 82
161 3300005617 Ga0068859_100636361 Ga0068859_1006363612 82
162 3300005719 Ga0068861_100723613 Ga0068861_1007236132 82
163 3300005844 Ga0068862_100930873 Ga0068862_1009308731 82
164 3300005983 Ga0081540_1161839 Ga0081540_11618392 82
165 3300005985 Ga0081539_10181037 Ga0081539_101810372 82
166 3300006237 Ga0097621_100649154 Ga0097621_1006491542 82
167 3300006931 Ga0097620_100636467 Ga0097620_1006364672 82
168 3300009093 Ga0105240_10519814 Ga0105240_105198142 82
169 3300009147 Ga0114129_10045728 Ga0114129_100457286 82
170 3300009147 Ga0114129_11023613 Ga0114129_110236132 82
171 3300009174 Ga0105241_11941110 Ga0105241_119411102 82
172 3300013104 Ga0157370_10262131 Ga0157370_102621312 82
173 3300013297 Ga0157378_11068503 Ga0157378_110685032 82
174 3300013307 Ga0157372_10564395 Ga0157372_105643952 82
175 3300014497 Ga0182008_10058838 Ga0182008_100588382 82
176 3300014969 Ga0157376_11750332 Ga0157376_117503322 82
177 3300015262 Ga0182007_10058694 Ga0182007_100586942 82
178 3300025908 Ga0207643_10067655 Ga0207643_100676553 82
179 3300025909 Ga0207705_10724240 Ga0207705_107242402 82
180 3300025921 Ga0207652_11883961 Ga0207652_118839611 82
181 3300025936 Ga0207670_10174202 Ga0207670_101742022 82
182 3300025936 Ga0207670_10603344 Ga0207670_106033442 82
183 3300026067 Ga0207678_10009958 Ga0207678_100099586 82
184 3300026075 Ga0207708_10137241 Ga0207708_101372412 82
185 3300026078 Ga0207702_11582907 Ga0207702_115829072 82
186 3300026089 Ga0207648_10407107 Ga0207648_104071072 82
187 3300026116 Ga0207674_10372230 Ga0207674_103722302 82
188 3300026116 Ga0207674_12045640 Ga0207674_120456402 82
189 3300031548 Ga0307408_101105023 Ga0307408_1011050231 82
190 3300031595 Ga0265313_10256165 Ga0265313_102561652 82
191 3300031711 Ga0265314_10300922 Ga0265314_103009222 82
192 3300032002 Ga0307416_103263642 Ga0307416_1032636422 82
193 3300036401 Ga0373937_0705245 Ga0373937_0705245_92_346 82
194 3300037068 Ga0373925_0649790 Ga0373925_0649790_251_505 82
195 3300041408 Ga0439453_0155854 Ga0439453_0155854_145_432 82
196 3300046536 Ga0495587_0841355 Ga0495587_0841355_156_410 82
197 3300046537 Ga0495598_0069656 Ga0495598_0069656_360_614 82
198 3300048908 Ga0496105_0089474 Ga0496105_0089474_1490_1744 82
199 3300048912 Ga0496109_1175757 Ga0496109_1175757_253_507 82
200 3300048913 Ga0496110_1206768 Ga0496110_1206768_175_429 82
201 3300048914 Ga0496111_0197082 Ga0496111_0197082_156_410 82
202 3300048914 Ga0496111_1012095 Ga0496111_1012095_185_439 82
203 3300048916 Ga0496113_1034548 Ga0496113_1034548_195_443 82
204 3300048917 Ga0496114_0065824 Ga0496114_0065824_2107_2361 82
205 3300048918 Ga0496115_0031869 Ga0496115_0031869_1877_2131 82
206 3300048918 Ga0496115_0305513 Ga0496115_0305513_799_1053 82
207 3300048928 Ga0496125_0360107 Ga0496125_0360107_336_584 82
208 3300049568 Ga0501031_0056956 Ga0501031_0056956_1597_1848 82
209 3300049569 Ga0501032_0005814 Ga0501032_0005814_2017_2316 82
210 3300049569 Ga0501032_0080309 Ga0501032_0080309_1875_2126 82
211 3300049569 Ga0501032_0583771 Ga0501032_0583771_109_360 82
212 3300049570 Ga0501033_0003939 Ga0501033_0003939_7972_8223 82
213 3300049570 Ga0501033_0012798 Ga0501033_0012798_1512_1811 82
214 3300049570 Ga0501033_0105529 Ga0501033_0105529_614_865 82
215 3300049571 Ga0501034_0017011 Ga0501034_0017011_6105_6404 82
216 3300049571 Ga0501034_0235966 Ga0501034_0235966_1302_1553 82
217 3300049571 Ga0501034_0274917 Ga0501034_0274917_440_691 82
218 3300049571 Ga0501034_0365764 Ga0501034_0365764_726_977 82
219 3300049572 Ga0501036_0008301 Ga0501036_0008301_5772_6071 82
220 3300049572 Ga0501036_0036040 Ga0501036_0036040_3485_3736 82
221 3300049572 Ga0501036_0936996 Ga0501036_0936996_313_564 82
222 3300049573 Ga0501037_0010290 Ga0501037_0010290_5515_5814 82
223 3300049573 Ga0501037_0035288 Ga0501037_0035288_3170_3421 82
224 3300049573 Ga0501037_0047155 Ga0501037_0047155_1210_1461 82
225 3300049574 Ga0501038_0015032 Ga0501038_0015032_5295_5594 82
226 3300049574 Ga0501038_0051388 Ga0501038_0051388_1523_1774 82
227 3300049575 Ga0501039_0001301 Ga0501039_0001301_7502_7801 82
228 3300049575 Ga0501039_0308118 Ga0501039_0308118_67_318 82
229 3300049578 Ga0501042_0141123 Ga0501042_0141123_714_1013 82
230 3300049579 Ga0501043_0002203 Ga0501043_0002203_5730_6029 82
231 3300049579 Ga0501043_0041913 Ga0501043_0041913_802_1053 82
232 3300049580 Ga0501046_0012154 Ga0501046_0012154_2056_2355 82
233 3300049580 Ga0501046_0436931 Ga0501046_0436931_681_932 82
234 3300049581 Ga0501047_0005496 Ga0501047_0005496_11105_11356 82
235 3300049581 Ga0501047_0016792 Ga0501047_0016792_5772_6071 82
236 3300049581 Ga0501047_0135752 Ga0501047_0135752_1660_1911 82
237 3300049581 Ga0501047_0526369 Ga0501047_0526369_32_283 82
238 3300049582 Ga0501048_0000886 Ga0501048_0000886_10885_11184 82
239 3300049582 Ga0501048_0251496 Ga0501048_0251496_444_695 82
240 3300049583 Ga0501067_0033707 Ga0501067_0033707_1744_2043 82
241 3300049584 Ga0501068_0012080 Ga0501068_0012080_3138_3437 82
242 3300049584 Ga0501068_0034753 Ga0501068_0034753_610_861 82
243 3300049584 Ga0501068_0838650 Ga0501068_0838650_201_455 82
244 3300049584 Ga0501068_1208047 Ga0501068_1208047_196_447 82
245 3300049585 Ga0501069_0000437 Ga0501069_0000437_10885_11184 82
246 3300049585 Ga0501069_0088479 Ga0501069_0088479_239_490 82
247 3300049585 Ga0501069_0364034 Ga0501069_0364034_16_267 82
248 3300049586 Ga0501070_0002038 Ga0501070_0002038_12193_12444 82
249 3300049586 Ga0501070_0011845 Ga0501070_0011845_6012_6311 82
250 3300049586 Ga0501070_0122036 Ga0501070_0122036_861_1112 82
251 3300049586 Ga0501070_0399194 Ga0501070_0399194_541_792 82
252 3300049587 Ga0501071_0096456 Ga0501071_0096456_775_1074 82
253 3300049587 Ga0501071_1061781 Ga0501071_1061781_113_364 82
254 3300049589 Ga0501073_0006839 Ga0501073_0006839_2017_2316 82
255 3300049589 Ga0501073_0016521 Ga0501073_0016521_1969_2220 82
256 3300049589 Ga0501073_0832642 Ga0501073_0832642_175_426 82
257 3300049590 Ga0501074_0003168 Ga0501074_0003168_10732_11031 82
258 3300049590 Ga0501074_0028988 Ga0501074_0028988_345_596 82
259 3300049592 Ga0501076_0084946 Ga0501076_0084946_826_1125 82
260 3300049741 Ga0501079_0009707 Ga0501079_0009707_4716_5015 82
261 3300049742 Ga0501080_0010101 Ga0501080_0010101_5642_5941 82
262 3300049742 Ga0501080_0040450 Ga0501080_0040450_1326_1577 82
263 3300049742 Ga0501080_0060516 Ga0501080_0060516_2419_2670 82
264 3300049742 Ga0501080_0492287 Ga0501080_0492287_516_767 82
265 3300049744 Ga0501083_0011452 Ga0501083_0011452_5550_5849 82
266 3300049744 Ga0501083_0153165 Ga0501083_0153165_227_478 82
267 3300049822 Ga0501035_0001764 Ga0501035_0001764_12141_12392 82
268 3300049822 Ga0501035_0004712 Ga0501035_0004712_4694_4945 82
269 3300049822 Ga0501035_0016845 Ga0501035_0016845_924_1223 82
270 3300049823 Ga0501044_0010691 Ga0501044_0010691_4037_4288 82
271 3300049823 Ga0501044_0025958 Ga0501044_0025958_924_1223 82
272 3300049823 Ga0501044_0110800 Ga0501044_0110800_357_608 82
273 3300050507 nmdc:mga05p37_1492059_c1 nmdc:mga05p37_1492059_c1_285_539 82
274 3300050507 nmdc:mga05p37_334227_c1 nmdc:mga05p37_334227_c1_814_1068 82
275 3300050514 nmdc:mga08x19_1012080_c1 nmdc:mga08x19_1012080_c1_96_350 82
276 3300053084 Ga0495595_0321732 Ga0495595_0321732_77_331 82
277 3300053085 Ga0495619_0465601 Ga0495619_0465601_433_687 82
278 3300054114 Ga0501084_0018001 Ga0501084_0018001_1690_1989 82
279 3300060353 Ga0501082_0029163 Ga0501082_0029163_2338_2637 82
280 3300060353 Ga0501082_0227049 Ga0501082_0227049_711_962 82
281 3300005330 Ga0070690_100353756 Ga0070690_1003537562 83
282 3300005333 Ga0070677_10222450 Ga0070677_102224501 83
283 3300005340 Ga0070689_100418910 Ga0070689_1004189101 83
284 3300005347 Ga0070668_100110155 Ga0070668_1001101553 83
285 3300005354 Ga0070675_100372984 Ga0070675_1003729842 83
286 3300005355 Ga0070671_100923777 Ga0070671_1009237772 83
287 3300005356 Ga0070674_100106760 Ga0070674_1001067602 83
288 3300005365 Ga0070688_100196206 Ga0070688_1001962062 83
289 3300005441 Ga0070700_100879773 Ga0070700_1008797731 83
290 3300005456 Ga0070678_102311431 Ga0070678_1023114311 83
291 3300005457 Ga0070662_101043268 Ga0070662_1010432681 83
292 3300005543 Ga0070672_100651401 Ga0070672_1006514012 83
293 3300005544 Ga0070686_101131385 Ga0070686_1011313852 83
294 3300005615 Ga0070702_100358261 Ga0070702_1003582612 83
295 3300005618 Ga0068864_101185269 Ga0068864_1011852692 83
296 3300005718 Ga0068866_10194266 Ga0068866_101942662 83
297 3300005834 Ga0068851_10521056 Ga0068851_105210562 83
298 3300006058 Ga0075432_10028305 Ga0075432_100283051 83
299 3300006194 Ga0075427_10003863 Ga0075427_100038633 83
300 3300006237 Ga0097621_100840131 Ga0097621_1008401312 83
301 3300006237 Ga0097621_101781068 Ga0097621_1017810682 83
302 3300006358 Ga0068871_101419230 Ga0068871_1014192302 83
303 3300006844 Ga0075428_100002521 Ga0075428_1000025213 83
304 3300006846 Ga0075430_100000128 Ga0075430_1000001289 83
305 3300006847 Ga0075431_100018884 Ga0075431_1000188845 83
306 3300006852 Ga0075433_10000103 Ga0075433_1000010337 83
307 3300006871 Ga0075434_100014461 Ga0075434_1000144613 83
308 3300006871 Ga0075434_100022954 Ga0075434_1000229544 83
309 3300006880 Ga0075429_100000381 Ga0075429_1000003818 83
310 3300006880 Ga0075429_100812865 Ga0075429_1008128651 83
311 3300006881 Ga0068865_101632313 Ga0068865_1016323132 83
312 3300006881 Ga0068865_101712111 Ga0068865_1017121112 83
313 3300006914 Ga0075436_100477998 Ga0075436_1004779981 83
314 3300007076 Ga0075435_100006161 Ga0075435_1000061617 83
315 3300007076 Ga0075435_100011373 Ga0075435_1000113735 83
316 3300009094 Ga0111539_10000787 Ga0111539_1000078726 83
317 3300009094 Ga0111539_13457124 Ga0111539_134571242 83
318 3300011119 Ga0105246_10130138 Ga0105246_101301382 83
319 3300013306 Ga0163162_10476111 Ga0163162_104761112 83
320 3300025893 Ga0207682_10173496 Ga0207682_101734962 83
321 3300025899 Ga0207642_10465215 Ga0207642_104652152 83
322 3300025903 Ga0207680_10638948 Ga0207680_106389482 83
323 3300025918 Ga0207662_10588867 Ga0207662_105888672 83
324 3300025926 Ga0207659_10345391 Ga0207659_103453912 83
325 3300025926 Ga0207659_10553011 Ga0207659_105530112 83
326 3300025931 Ga0207644_10829296 Ga0207644_108292962 83
327 3300025933 Ga0207706_10456056 Ga0207706_104560562 83
328 3300025937 Ga0207669_10061980 Ga0207669_100619803 83
329 3300025940 Ga0207691_10608380 Ga0207691_106083802 83
330 3300025945 Ga0207679_11214043 Ga0207679_112140432 83
331 3300025972 Ga0207668_10116212 Ga0207668_101162123 83
332 3300026023 Ga0207677_10385858 Ga0207677_103858582 83
333 3300026067 Ga0207678_10348036 Ga0207678_103480362 83
334 3300026075 Ga0207708_10583907 Ga0207708_105839072 83
335 3300026089 Ga0207648_11456304 Ga0207648_114563042 83
336 3300026121 Ga0207683_10274075 Ga0207683_102740751 83
337 3300027671 Ga0209588_1104131 Ga0209588_11041312 83
338 3300027907 Ga0207428_10000058 Ga0207428_1000005849 83
339 3300032133 Ga0316583_10321810 Ga0316583_103218102 83
340 3300048903 Ga0496100_0520869 Ga0496100_0520869_289_546 83
341 3300048911 Ga0496108_0440528 Ga0496108_0440528_619_876 83
342 3300048912 Ga0496109_0439229 Ga0496109_0439229_660_917 83
343 3300048913 Ga0496110_0927345 Ga0496110_0927345_277_558 83
344 3300048917 Ga0496114_1287127 Ga0496114_1287127_17_298 83
345 3300049579 Ga0501043_1176741 Ga0501043_1176741_136_387 83
346 3300049589 Ga0501073_0007850 Ga0501073_0007850_4376_4633 83
347 3300049593 Ga0501077_0475960 Ga0501077_0475960_50_301 83
348 3300049744 Ga0501083_0194569 Ga0501083_0194569_556_813 83
349 3300050492 nmdc:mga0yw44_485620_c1 nmdc:mga0yw44_485620_c1_570_827 83
350 3300050507 nmdc:mga05p37_35_c1 nmdc:mga05p37_35_c1_69847_70098 83
351 3300050507 nmdc:mga05p37_6170_c1 nmdc:mga05p37_6170_c1_8580_8831 83
352 3300050508 nmdc:mga09592_163_c1 nmdc:mga09592_163_c1_17536_17787 83
353 3300050509 nmdc:mga0qj67_143_c1 nmdc:mga0qj67_143_c1_17535_17786 83
354 3300050510 nmdc:mga06r32_936_c1 nmdc:mga06r32_936_c1_15823_16074 83
355 3300050511 nmdc:mga08y16_2671_c1 nmdc:mga08y16_2671_c1_16647_16898 83
356 3300050512 nmdc:mga0n895_33593_c1 nmdc:mga0n895_33593_c1_3252_3503 83
357 3300050513 nmdc:mga0rr50_1301_c1 nmdc:mga0rr50_1301_c1_7629_7880 83
358 3300050513 nmdc:mga0rr50_3039_c1 nmdc:mga0rr50_3039_c1_5037_5288 83
359 3300050514 nmdc:mga08x19_437774_c1 nmdc:mga08x19_437774_c1_137_388 83
360 3300050515 nmdc:mga0a205_2132_c1 nmdc:mga0a205_2132_c1_16472_16723 83
361 3300050515 nmdc:mga0a205_38040_c1 nmdc:mga0a205_38040_c1_3060_3311 83
362 3300027717 Ga0209998_10075583 Ga0209998_100755831 84
363 3300027876 Ga0209974_10024452 Ga0209974_100244523 84
364 3300031711 Ga0265314_10186209 Ga0265314_101862092 84
365 3300049569 Ga0501032_0128223 Ga0501032_0128223_1067_1339 84
366 3300049571 Ga0501034_0161102 Ga0501034_0161102_1711_1983 84
367 3300049571 Ga0501034_0281175 Ga0501034_0281175_259_531 84
368 3300049572 Ga0501036_0456638 Ga0501036_0456638_498_770 84
369 3300049575 Ga0501039_0753831 Ga0501039_0753831_341_613 84
370 3300049579 Ga0501043_0379603 Ga0501043_0379603_218_490 84
371 3300049581 Ga0501047_0159507 Ga0501047_0159507_1258_1530 84
372 3300049589 Ga0501073_0028970 Ga0501073_0028970_2612_2884 84
373 3300049589 Ga0501073_0455653 Ga0501073_0455653_84_356 84
374 3300049822 Ga0501035_1408471 Ga0501035_1408471_43_315 84
375 2162886007 SwRhRL2b_contig_1015587 SwRhRL2b_0059.00001500 85
376 2209111006 2214767426 2213785232 85
377 3300000041 ARcpr5oldR_c000253 ARcpr5oldR_00025310 85
378 3300000042 ARSoilYngRDRAFT_c00281 ARSoilYngRDRAFT_002812 85
379 3300000043 ARcpr5yngRDRAFT_c002660 ARcpr5yngRDRAFT_0026603 85
380 3300000044 ARSoilOldRDRAFT_c000231 ARSoilOldRDRAFT_00023110 85
381 3300000045 ARCol0oldRDRAFT_c00994 ARCol0oldRDRAFT_009942 85
382 3300000652 ARCol0yngRDRAFT_1000260 ARCol0yngRDRAFT_10002602 85
383 3300001990 JGI24737J22298_10020391 JGI24737J22298_100203913 85
384 3300002070 JGI24750J21931_1004571 JGI24750J21931_10045713 85
385 3300002126 JGI24035J26624_1001130 JGI24035J26624_10011302 85
386 3300002239 JGI24034J26672_10029907 JGI24034J26672_100299071 85
387 3300002459 JGI24751J29686_10073052 JGI24751J29686_100730522 85
388 3300003503 JGI26141J51220_1016149 JGI26141J51220_10161492 85
389 3300003911 JGI25405J52794_10051040 JGI25405J52794_100510402 85
390 3300005276 Ga0065717_1002397 Ga0065717_10023972 85
391 3300005277 Ga0065716_1001908 Ga0065716_10019082 85
392 3300005288 Ga0065714_10369378 Ga0065714_103693782 85
393 3300005289 Ga0065704_10109412 Ga0065704_101094122 85
394 3300005290 Ga0065712_10078300 Ga0065712_100783002 85
395 3300005293 Ga0065715_10001249 Ga0065715_1000124913 85
396 3300005295 Ga0065707_10126362 Ga0065707_101263622 85
397 3300005335 Ga0070666_10499724 Ga0070666_104997242 85
398 3300005340 Ga0070689_100005511 Ga0070689_1000055113 85
399 3300005341 Ga0070691_10738551 Ga0070691_107385511 85
400 3300005436 Ga0070713_100803507 Ga0070713_1008035071 85
401 3300005437 Ga0070710_10723997 Ga0070710_107239972 85
402 3300005437 Ga0070710_11139953 Ga0070710_111399531 85
403 3300005439 Ga0070711_100645935 Ga0070711_1006459352 85
404 3300005444 Ga0070694_100259073 Ga0070694_1002590731 85
405 3300005445 Ga0070708_100032775 Ga0070708_1000327756 85
406 3300005455 Ga0070663_101606501 Ga0070663_1016065011 85
407 3300005458 Ga0070681_10737194 Ga0070681_107371942 85
408 3300005459 Ga0068867_100312173 Ga0068867_1003121732 85
409 3300005466 Ga0070685_10083256 Ga0070685_100832563 85
410 3300005507 Ga0074259_11049951 Ga0074259_110499512 85
411 3300005530 Ga0070679_100160756 Ga0070679_1001607562 85
412 3300005530 Ga0070679_100219484 Ga0070679_1002194841 85
413 3300005530 Ga0070679_100755994 Ga0070679_1007559942 85
414 3300005539 Ga0068853_100088489 Ga0068853_1000884893 85
415 3300005617 Ga0068859_100026561 Ga0068859_1000265613 85
416 3300005842 Ga0068858_100017088 Ga0068858_1000170883 85
417 3300005937 Ga0081455_10000110 Ga0081455_1000011071 85
418 3300006058 Ga0075432_10201207 Ga0075432_102012072 85
419 3300006175 Ga0070712_100086102 Ga0070712_1000861023 85
420 3300006852 Ga0075433_10259258 Ga0075433_102592583 85
421 3300006871 Ga0075434_100794325 Ga0075434_1007943252 85
422 3300006931 Ga0097620_100026564 Ga0097620_1000265643 85
423 3300009094 Ga0111539_10002989 Ga0111539_1000298911 85
424 3300009094 Ga0111539_11186417 Ga0111539_111864172 85
425 3300009147 Ga0114129_10018046 Ga0114129_100180462 85
426 3300009148 Ga0105243_10001716 Ga0105243_100017168 85
427 3300009174 Ga0105241_10151490 Ga0105241_101514903 85
428 3300009177 Ga0105248_10393153 Ga0105248_103931532 85
429 3300009545 Ga0105237_10661721 Ga0105237_106617211 85
430 3300009553 Ga0105249_10064225 Ga0105249_100642254 85
431 3300010375 Ga0105239_10022754 Ga0105239_100227546 85
432 3300012488 Ga0157343_1000395 Ga0157343_10003951 85
433 3300012490 Ga0157322_1000394 Ga0157322_10003943 85
434 3300012491 Ga0157329_1006681 Ga0157329_10066812 85
435 3300012494 Ga0157341_1000469 Ga0157341_10004693 85
436 3300012495 Ga0157323_1002712 Ga0157323_10027122 85
437 3300012515 Ga0157338_1000826 Ga0157338_10008262 85
438 3300013102 Ga0157371_10012581 Ga0157371_100125813 85
439 3300013296 Ga0157374_10162264 Ga0157374_101622643 85
440 3300013306 Ga0163162_10064822 Ga0163162_100648224 85
441 3300013308 Ga0157375_10035488 Ga0157375_100354884 85
442 3300014326 Ga0157380_10206239 Ga0157380_102062393 85
443 3300014968 Ga0157379_10134584 Ga0157379_101345843 85
444 3300014968 Ga0157379_11906609 Ga0157379_119066091 85
445 3300025315 Ga0207697_10022213 Ga0207697_100222133 85
446 3300025899 Ga0207642_10130969 Ga0207642_101309692 85
447 3300025900 Ga0207710_10254166 Ga0207710_102541662 85
448 3300025901 Ga0207688_10147917 Ga0207688_101479171 85
449 3300025903 Ga0207680_10366719 Ga0207680_103667192 85
450 3300025904 Ga0207647_10017565 Ga0207647_100175652 85
451 3300025911 Ga0207654_10142866 Ga0207654_101428663 85
452 3300025914 Ga0207671_10401647 Ga0207671_104016471 85
453 3300025915 Ga0207693_10156646 Ga0207693_101566461 85
454 3300025916 Ga0207663_10489512 Ga0207663_104895122 85
455 3300025917 Ga0207660_10140596 Ga0207660_101405962 85
456 3300025917 Ga0207660_10515773 Ga0207660_105157732 85
457 3300025917 Ga0207660_10553604 Ga0207660_105536042 85
458 3300025919 Ga0207657_10028997 Ga0207657_100289974 85
459 3300025921 Ga0207652_10116402 Ga0207652_101164023 85
460 3300025921 Ga0207652_10539149 Ga0207652_105391492 85
461 3300025921 Ga0207652_10576024 Ga0207652_105760242 85
462 3300025923 Ga0207681_10278335 Ga0207681_102783352 85
463 3300025928 Ga0207700_10919898 Ga0207700_109198981 85
464 3300025932 Ga0207690_10060890 Ga0207690_100608903 85
465 3300025933 Ga0207706_10034755 Ga0207706_100347553 85
466 3300025936 Ga0207670_10212125 Ga0207670_102121252 85
467 3300025938 Ga0207704_11960263 Ga0207704_119602632 85
468 3300025940 Ga0207691_10083746 Ga0207691_100837464 85
469 3300025941 Ga0207711_11344942 Ga0207711_113449422 85
470 3300025944 Ga0207661_10382489 Ga0207661_103824892 85
471 3300025961 Ga0207712_10606258 Ga0207712_106062582 85
472 3300025972 Ga0207668_10200609 Ga0207668_102006091 85
473 3300025972 Ga0207668_11289945 Ga0207668_112899452 85
474 3300026035 Ga0207703_10041007 Ga0207703_100410073 85
475 3300026041 Ga0207639_10020651 Ga0207639_100206513 85
476 3300026067 Ga0207678_11599693 Ga0207678_115996932 85
477 3300026075 Ga0207708_10035615 Ga0207708_100356154 85
478 3300026118 Ga0207675_100121622 Ga0207675_1001216222 85
479 3300026142 Ga0207698_11750292 Ga0207698_117502922 85
480 3300027395 Ga0209996_1014313 Ga0209996_10143132 85
481 3300027462 Ga0210000_1008868 Ga0210000_10088682 85
482 3300027682 Ga0209971_1004899 Ga0209971_10048994 85
483 3300027695 Ga0209966_1015359 Ga0209966_10153593 85
484 3300027695 Ga0209966_1116157 Ga0209966_11161572 85
485 3300027717 Ga0209998_10005564 Ga0209998_100055643 85
486 3300027876 Ga0209974_10012884 Ga0209974_100128841 85
487 3300027876 Ga0209974_10091804 Ga0209974_100918042 85
488 3300027907 Ga0207428_10001877 Ga0207428_1000187710 85
489 3300027907 Ga0207428_10576386 Ga0207428_105763861 85
490 3300028379 Ga0268266_11034283 Ga0268266_110342832 85
491 3300028380 Ga0268265_10076997 Ga0268265_100769974 85
492 3300028381 Ga0268264_10063477 Ga0268264_100634772 85
493 3300031691 Ga0316579_10002736 Ga0316579_100027364 85
494 3300034816 Ga0373930_0000227 Ga0373930_0000227_1493_1750 85
495 3300034817 Ga0373948_0021808 Ga0373948_0021808_381_638 85
496 3300034818 Ga0373950_0000785 Ga0373950_0000785_3571_3828 85
497 3300034820 Ga0373959_0000278 Ga0373959_0000278_6458_6715 85
498 3300034957 Ga0373938_0000185 Ga0373938_0000185_4760_5017 85
499 3300035084 Ga0373928_0000509 Ga0373928_0000509_4713_4970 85
500 3300035085 Ga0373929_0000347 Ga0373929_0000347_6333_6590 85
501 3300035086 Ga0373934_0033195 Ga0373934_0033195_999_1256 85
502 3300035088 Ga0373940_0000033 Ga0373940_0000033_10225_10482 85
503 3300035090 Ga0373949_0007020 Ga0373949_0007020_1686_1943 85
504 3300035091 Ga0373951_0002035 Ga0373951_0002035_1336_1593 85
505 3300035092 Ga0373952_0000067 Ga0373952_0000067_6816_7073 85
506 3300035112 Ga0373932_0011835 Ga0373932_0011835_196_453 85
507 3300035114 Ga0373939_0005595 Ga0373939_0005595_2146_2403 85
508 3300035115 Ga0373941_0000055 Ga0373941_0000055_7365_7622 85
509 3300035117 Ga0373953_0139227 Ga0373953_0139227_705_962 85
510 3300035118 Ga0373954_0034924 Ga0373954_0034924_533_790 85
511 3300035120 Ga0373957_0013363 Ga0373957_0013363_688_945 85
512 3300035121 Ga0373960_0000621 Ga0373960_0000621_3724_3981 85
513 3300035170 Ga0373943_0962013 Ga0373943_0962013_225_482 85
514 3300035172 Ga0373955_0008944 Ga0373955_0008944_3681_3938 85
515 3300035207 Ga0373942_0000604 Ga0373942_0000604_2669_2926 85
516 3300035241 Ga0373961_0006501 Ga0373961_0006501_1052_1309 85
517 3300035410 Ga0373924_0275174 Ga0373924_0275174_474_731 85
518 3300035692 Ga0373935_0146333 Ga0373935_0146333_1031_1288 85
519 3300035724 Ga0373933_0053701 Ga0373933_0053701_330_587 85
520 3300035725 Ga0373947_0058636 Ga0373947_0058636_1159_1416 85
521 3300036401 Ga0373937_0051826 Ga0373937_0051826_830_1087 85
522 3300037068 Ga0373925_0008196 Ga0373925_0008196_5580_5837 85
523 3300038698 Ga0242419_012888 Ga0242419_012888_106_363 85
524 3300038996 Ga0242420_046149 Ga0242420_046149_234_491 85
525 3300042008 Ga0439450_026365 Ga0439450_026365_201_458 85
526 3300042016 Ga0439463_064797 Ga0439463_064797_596_853 85
527 3300042157 Ga0439458_0030570 Ga0439458_0030570_299_556 85
528 3300042436 Ga0439435_0278045 Ga0439435_0278045_15_272 85
529 3300042439 Ga0439464_0106588 Ga0439464_0106588_468_725 85
530 3300042461 Ga0439460_0119991 Ga0439460_0119991_450_707 85
531 3300042993 Ga0439440_0139702 Ga0439440_0139702_378_635 85
532 3300044673 Ga0453683_1148553 Ga0453683_1148553_34_291 85
533 3300044712 Ga0453684_0205388 Ga0453684_0205388_601_858 85
534 3300045051 Ga0451576_0178747 Ga0451576_0178747_1318_1575 85
535 3300046454 Ga0495592_0004712 Ga0495592_0004712_3853_4110 85
536 3300046461 Ga0495641_0042436 Ga0495641_0042436_99_356 85
537 3300046462 Ga0495651_0272279 Ga0495651_0272279_313_570 85
538 3300046463 Ga0495653_0154010 Ga0495653_0154010_233_490 85
539 3300046477 Ga0495664_0148765 Ga0495664_0148765_642_899 85
540 3300046516 Ga0495628_0005498 Ga0495628_0005498_9191_9448 85
541 3300046517 Ga0495630_0117327 Ga0495630_0117327_1013_1270 85
542 3300046529 Ga0495652_0033641 Ga0495652_0033641_2410_2667 85
543 3300046533 Ga0495640_0378965 Ga0495640_0378965_182_439 85
544 3300046536 Ga0495587_0020754 Ga0495587_0020754_1752_2009 85
545 3300046559 Ga0495667_0014419 Ga0495667_0014419_2501_2758 85
546 3300046663 Ga0495635_0109072 Ga0495635_0109072_829_1086 85
547 3300046675 Ga0495657_0027025 Ga0495657_0027025_3585_3842 85
548 3300046678 Ga0495599_0004339 Ga0495599_0004339_1739_1996 85
549 3300046680 Ga0495646_0097491 Ga0495646_0097491_875_1132 85
550 3300046684 Ga0495669_0531215 Ga0495669_0531215_34_291 85
551 3300046690 Ga0495624_0176158 Ga0495624_0176158_139_396 85
552 3300046809 Ga0495600_0088393 Ga0495600_0088393_206_463 85
553 3300047317 Ga0495604_0025651 Ga0495604_0025651_1976_2233 85
554 3300047319 Ga0495674_0058374 Ga0495674_0058374_1537_1794 85
555 3300047322 Ga0495680_0069720 Ga0495680_0069720_1153_1410 85
556 3300047471 Ga0495684_0097041 Ga0495684_0097041_1563_1820 85
557 3300047673 Ga0495593_0383433 Ga0495593_0383433_21_278 85
558 3300048088 Ga0495602_0008977 Ga0495602_0008977_4089_4346 85
559 3300048088 Ga0495602_0456574 Ga0495602_0456574_122_379 85
560 3300048905 Ga0496102_0044569 Ga0496102_0044569_190_447 85
561 3300048909 Ga0496106_0012821 Ga0496106_0012821_5495_5752 85
562 3300048910 Ga0496107_0087659 Ga0496107_0087659_1879_2136 85
563 3300048911 Ga0496108_0105128 Ga0496108_0105128_1146_1403 85
564 3300048912 Ga0496109_0496861 Ga0496109_0496861_164_421 85
565 3300048913 Ga0496110_0013167 Ga0496110_0013167_6182_6439 85
566 3300048914 Ga0496111_0127704 Ga0496111_0127704_728_985 85
567 3300048916 Ga0496113_0081004 Ga0496113_0081004_1502_1759 85
568 3300049588 Ga0501072_0756562 Ga0501072_0756562_473_730 85
569 3300049591 Ga0501075_0604168 Ga0501075_0604168_423_680 85
570 3300049592 Ga0501076_0014561 Ga0501076_0014561_3451_3708 85
571 3300049593 Ga0501077_0086240 Ga0501077_0086240_359_616 85
572 3300049741 Ga0501079_0088682 Ga0501079_0088682_210_467 85
573 3300049743 Ga0501081_0015721 Ga0501081_0015721_2714_2971 85
574 3300049743 Ga0501081_0682676 Ga0501081_0682676_318_614 85
575 3300049824 Ga0501045_0707539 Ga0501045_0707539_150_407 85
576 3300050507 nmdc:mga05p37_890095_c1 nmdc:mga05p37_890095_c1_357_623 85
577 3300050508 nmdc:mga09592_41900_c1 nmdc:mga09592_41900_c1_66_332 85
578 3300050509 nmdc:mga0qj67_154190_c1 nmdc:mga0qj67_154190_c1_706_972 85
579 3300050510 nmdc:mga06r32_34027_c1 nmdc:mga06r32_34027_c1_535_801 85
580 3300050511 nmdc:mga08y16_1040379_c1 nmdc:mga08y16_1040379_c1_264_530 85
581 3300050511 nmdc:mga08y16_1688624_c1 nmdc:mga08y16_1688624_c1_57_314 85
582 3300050511 nmdc:mga08y16_231052_c1 nmdc:mga08y16_231052_c1_263_529 85
583 3300050511 nmdc:mga08y16_6719_c1 nmdc:mga08y16_6719_c1_1191_1448 85
584 3300050512 nmdc:mga0n895_356672_c1 nmdc:mga0n895_356672_c1_1108_1365 85
585 3300050512 nmdc:mga0n895_457589_c1 nmdc:mga0n895_457589_c1_22_279 85
586 3300050515 nmdc:mga0a205_63150_c1 nmdc:mga0a205_63150_c1_1360_1617 85
587 3300053077 Ga0495601_0000485 Ga0495601_0000485_17352_17609 85
588 3300053078 Ga0495612_0000714 Ga0495612_0000714_7107_7364 85
589 3300053084 Ga0495595_0336146 Ga0495595_0336146_167_424 85
590 3300053085 Ga0495619_0000487 Ga0495619_0000487_25466_25723 85
591 3300054114 Ga0501084_0272197 Ga0501084_0272197_949_1206 85
592 3300060353 Ga0501082_0338044 Ga0501082_0338044_142_399 85
593 3300061734 Ga0530510_0524342 Ga0530510_0524342_116_373 85

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13773

DUF4170

Domain of unknown function (DUF4170)

28

87

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mhe-assembly1.cif.gz_B nmr structure of the protein np_419126.1 from caulobacter crescentus 0.7565 1 77
2mhe-assembly1.cif.gz_B nmr structure of the protein np_419126.1 from caulobacter crescentus 0.7217 1 77
3o2h-assembly1.cif.gz_A e. coli clps in complex with a leu n-end rule peptide 0.6408 7 71
7wq5-assembly2.cif.gz_B crystal structure of arabidopsis transcriptional factor wrinkled1 with dsdna 0.6374 18 57
1mg9-assembly1.cif.gz_A the structural basis of clps-mediated switch in clpa substrate recognition 0.6368 9 71
ID Description Score Start End Superfamily
af_K7UQ19_118_172_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.8179 32 60 3.30.730.10
af_Q2TQ39_75_158_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7982 34 57 3.30.730.10
af_Q9SGJ6_29_87_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7818 30 57 3.30.730.10
af_C0P9B0_100_150_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7594 29 59 3.30.730.10
af_B4FET9_33_90_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7568 34 63 3.30.730.10
ID Description Score Start End GO Terms
AF-A0A3D4F2C3-F1-model_v4 deleted 0.9745 13 69
AF-A0A1Q3JIW1-F1-model_v4 Inositol monophosphatase 0.9391 8 77
AF-A0A258DDP0-F1-model_v4 Inositol monophosphatase 0.9377 8 77
AF-A0A2E1RWQ1-F1-model_v4 Inositol monophosphatase 0.9377 9 77
AF-C6XHY3-F1-model_v4 DUF4170 domain-containing protein 0.9358 3 73

Feature Viewer

pLDDT pTM Quality
77.76 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map