F467185
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 593 | 362 | 593 | 85 |
Family's Representative Sequence
| Representative Sequence | 3300003775|Ga0055524_1027828|Ga0055524_10278282 |
| Length | 98 |
| Sequence | MCERDGLIGAIRPLWKNPMSAHPDQKQLLHLVFGGELDSLEGITFKDLAKLDIVGIYPNYATAHTAWKAKAQQTVDQAQTRYFIVHLHRLLDPETAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 24 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 110 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 111 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 112 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 113 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 114 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 198 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 203 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 205 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 207 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 208 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 210 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 217 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 233 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 234 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 235 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 236 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 237 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 238 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 239 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 240 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 241 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 242 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 243 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 244 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 245 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 246 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 247 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 248 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 249 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 285 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 288 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 292 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 293 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 294 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 295 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 296 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 297 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 298 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 299 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 300 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 301 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 302 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 337 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 352 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 353 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 354 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 355 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 356 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 357 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 358 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 359 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 361 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.77 |
| Nodule | 0 |
| Rhizoplane | 4.55 |
| Rhizosphere | 83.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1015587 | 2162886007 | Bacteria | 1305 |
| 2 | 2214767426 | 2209111006 | Bacteria | 2785 |
| 3 | ARcpr5oldR_c000253 | 3300000041 | Bacteria | 8505 |
| 4 | ARSoilYngRDRAFT_c00281 | 3300000042 | Bacteria | 7534 |
| 5 | ARcpr5yngRDRAFT_c002660 | 3300000043 | Bacteria | 1837 |
| 6 | ARSoilOldRDRAFT_c000231 | 3300000044 | Bacteria | 8483 |
| 7 | ARCol0oldRDRAFT_c00994 | 3300000045 | Bacteria | 2167 |
| 8 | ARCol0yngRDRAFT_1000260 | 3300000652 | Bacteria | 8518 |
| 9 | JGI24737J22298_10020391 | 3300001990 | Bacteria | 2116 |
| 10 | JGI24750J21931_1004571 | 3300002070 | Bacteria | 1681 |
| 11 | JGI24035J26624_1001130 | 3300002126 | Bacteria | 2528 |
| 12 | JGI24034J26672_10029907 | 3300002239 | Bacteria | 883 |
| 13 | JGI24751J29686_10073052 | 3300002459 | Bacteria | 708 |
| 14 | JGI25159J45721_1021639 | 3300002987 | Bacteria | 1207 |
| 15 | JGI25151J46595_10000018 | 3300003187 | Bacteria | 238438 |
| 16 | JGI25151J46595_10034061 | 3300003187 | Bacteria | 1952 |
| 17 | JGI25153J46596_10004251 | 3300003215 | Bacteria | 7749 |
| 18 | JGI26141J51220_1016149 | 3300003503 | Bacteria | 512 |
| 19 | Ga0055526_1000362 | 3300003771 | Bacteria | 36713 |
| 20 | Ga0055526_1000571 | 3300003771 | Bacteria | 29048 |
| 21 | Ga0055524_1000048 | 3300003775 | Bacteria | 149598 |
| 22 | Ga0055524_1027828 | 3300003775 | Bacteria | 1706 |
| 23 | Ga0055534_1008656 | 3300003784 | Bacteria | 2285 |
| 24 | JGI25405J52794_10051040 | 3300003911 | Bacteria | 886 |
| 25 | Ga0065165_1000337 | 3300005262 | Bacteria | 76914 |
| 26 | Ga0065717_1002397 | 3300005276 | Bacteria | 2048 |
| 27 | Ga0065716_1001908 | 3300005277 | Bacteria | 2776 |
| 28 | Ga0065714_10369378 | 3300005288 | Bacteria | 617 |
| 29 | Ga0065704_10109412 | 3300005289 | Bacteria | 2004 |
| 30 | Ga0065712_10078300 | 3300005290 | Bacteria | 3367 |
| 31 | Ga0065715_10001249 | 3300005293 | Bacteria | 14318 |
| 32 | Ga0065707_10126362 | 3300005295 | Bacteria | 2004 |
| 33 | Ga0070683_102352263 | 3300005329 | Bacteria | 511 |
| 34 | Ga0070690_100353756 | 3300005330 | Bacteria | 1067 |
| 35 | Ga0070677_10222450 | 3300005333 | Bacteria | 923 |
| 36 | Ga0070666_10499724 | 3300005335 | Bacteria | 882 |
| 37 | Ga0070680_101874744 | 3300005336 | Bacteria | 520 |
| 38 | Ga0070660_100171040 | 3300005339 | Bacteria | 1755 |
| 39 | Ga0070660_101105022 | 3300005339 | Bacteria | 671 |
| 40 | Ga0070689_100005511 | 3300005340 | Bacteria | 8652 |
| 41 | Ga0070689_100132519 | 3300005340 | Bacteria | 1999 |
| 42 | Ga0070689_100418910 | 3300005340 | Bacteria | 1135 |
| 43 | Ga0070691_10738551 | 3300005341 | Bacteria | 594 |
| 44 | Ga0070668_100110155 | 3300005347 | Bacteria | 2191 |
| 45 | Ga0070668_100347040 | 3300005347 | Bacteria | 1255 |
| 46 | Ga0070675_100372984 | 3300005354 | Bacteria | 1269 |
| 47 | Ga0070671_100923777 | 3300005355 | Bacteria | 763 |
| 48 | Ga0070674_100106760 | 3300005356 | Bacteria | 2049 |
| 49 | Ga0070688_100196206 | 3300005365 | Bacteria | 1409 |
| 50 | Ga0070713_100803507 | 3300005436 | Bacteria | 902 |
| 51 | Ga0070710_10723997 | 3300005437 | Bacteria | 704 |
| 52 | Ga0070710_11139953 | 3300005437 | Bacteria | 574 |
| 53 | Ga0070711_100645935 | 3300005439 | Bacteria | 887 |
| 54 | Ga0070700_100229568 | 3300005441 | Bacteria | 1320 |
| 55 | Ga0070700_100879773 | 3300005441 | Bacteria | 728 |
| 56 | Ga0070694_100259073 | 3300005444 | Bacteria | 1319 |
| 57 | Ga0070708_100032775 | 3300005445 | Bacteria | 4509 |
| 58 | Ga0070663_101606501 | 3300005455 | Bacteria | 580 |
| 59 | Ga0070678_102311431 | 3300005456 | Bacteria | 510 |
| 60 | Ga0070662_101043268 | 3300005457 | Bacteria | 701 |
| 61 | Ga0070681_10737194 | 3300005458 | Bacteria | 902 |
| 62 | Ga0068867_100190787 | 3300005459 | Bacteria | 1635 |
| 63 | Ga0068867_100312173 | 3300005459 | Bacteria | 1300 |
| 64 | Ga0068867_101644605 | 3300005459 | Bacteria | 601 |
| 65 | Ga0070685_10083256 | 3300005466 | Bacteria | 1922 |
| 66 | Ga0074259_11049951 | 3300005507 | Bacteria | 632 |
| 67 | Ga0070679_100160756 | 3300005530 | Bacteria | 2221 |
| 68 | Ga0070679_100219484 | 3300005530 | Bacteria | 1863 |
| 69 | Ga0070679_100755994 | 3300005530 | Bacteria | 915 |
| 70 | Ga0070679_101737760 | 3300005530 | Bacteria | 572 |
| 71 | Ga0068853_100088489 | 3300005539 | Bacteria | 2719 |
| 72 | Ga0070672_100651401 | 3300005543 | Bacteria | 920 |
| 73 | Ga0070686_101131385 | 3300005544 | Bacteria | 648 |
| 74 | Ga0070704_100774390 | 3300005549 | Bacteria | 856 |
| 75 | Ga0068855_100109516 | 3300005563 | Bacteria | 3172 |
| 76 | Ga0070664_101830047 | 3300005564 | Bacteria | 576 |
| 77 | Ga0068857_100329950 | 3300005577 | Bacteria | 1410 |
| 78 | Ga0068857_101536523 | 3300005577 | Bacteria | 649 |
| 79 | Ga0068854_100134111 | 3300005578 | Bacteria | 1894 |
| 80 | Ga0068856_101829695 | 3300005614 | Bacteria | 619 |
| 81 | Ga0070702_100358261 | 3300005615 | Bacteria | 1030 |
| 82 | Ga0068859_100026561 | 3300005617 | Bacteria | 5806 |
| 83 | Ga0068859_100636361 | 3300005617 | Bacteria | 1159 |
| 84 | Ga0068864_101185269 | 3300005618 | Bacteria | 762 |
| 85 | Ga0068866_10194266 | 3300005718 | Bacteria | 1208 |
| 86 | Ga0068861_100723613 | 3300005719 | Bacteria | 927 |
| 87 | Ga0068851_10521056 | 3300005834 | Bacteria | 715 |
| 88 | Ga0068858_100017088 | 3300005842 | Bacteria | 6809 |
| 89 | Ga0068862_100930873 | 3300005844 | Bacteria | 856 |
| 90 | Ga0081455_10000110 | 3300005937 | Bacteria | 92459 |
| 91 | Ga0081540_1161839 | 3300005983 | Bacteria | 867 |
| 92 | Ga0081539_10181037 | 3300005985 | Bacteria | 988 |
| 93 | Ga0075365_10029225 | 3300006038 | Bacteria | 3521 |
| 94 | Ga0075368_10135504 | 3300006042 | Bacteria | 1025 |
| 95 | Ga0075368_10514054 | 3300006042 | Bacteria | 535 |
| 96 | Ga0075364_10108738 | 3300006051 | Bacteria | 1849 |
| 97 | Ga0075364_10469646 | 3300006051 | Bacteria | 860 |
| 98 | Ga0075364_10571059 | 3300006051 | Bacteria | 773 |
| 99 | Ga0075432_10028305 | 3300006058 | Bacteria | 1933 |
| 100 | Ga0075432_10201207 | 3300006058 | Bacteria | 788 |
| 101 | Ga0070712_100086102 | 3300006175 | Bacteria | 2289 |
| 102 | Ga0075362_10157543 | 3300006177 | Bacteria | 1092 |
| 103 | Ga0075362_10298600 | 3300006177 | Bacteria | 799 |
| 104 | Ga0075367_10243956 | 3300006178 | Bacteria | 1126 |
| 105 | Ga0075369_10189743 | 3300006186 | Bacteria | 947 |
| 106 | Ga0075427_10003863 | 3300006194 | Bacteria | 2090 |
| 107 | Ga0075366_10005461 | 3300006195 | Bacteria | 6889 |
| 108 | Ga0097621_100649154 | 3300006237 | Bacteria | 968 |
| 109 | Ga0097621_100840131 | 3300006237 | Bacteria | 853 |
| 110 | Ga0097621_101781068 | 3300006237 | Bacteria | 587 |
| 111 | Ga0068871_101419230 | 3300006358 | Bacteria | 655 |
| 112 | Ga0075428_100002521 | 3300006844 | Bacteria | 19905 |
| 113 | Ga0075430_100000128 | 3300006846 | Bacteria | 47770 |
| 114 | Ga0075431_100018884 | 3300006847 | Bacteria | 7022 |
| 115 | Ga0075433_10000103 | 3300006852 | Bacteria | 41320 |
| 116 | Ga0075433_10259258 | 3300006852 | Bacteria | 1541 |
| 117 | Ga0075434_100014461 | 3300006871 | Bacteria | 7542 |
| 118 | Ga0075434_100022954 | 3300006871 | Bacteria | 6073 |
| 119 | Ga0075434_100794325 | 3300006871 | Bacteria | 963 |
| 120 | Ga0075429_100000381 | 3300006880 | Bacteria | 32664 |
| 121 | Ga0075429_100812865 | 3300006880 | Bacteria | 818 |
| 122 | Ga0068865_101632313 | 3300006881 | Bacteria | 580 |
| 123 | Ga0068865_101712111 | 3300006881 | Bacteria | 567 |
| 124 | Ga0075436_100477998 | 3300006914 | Bacteria | 910 |
| 125 | Ga0097620_100026564 | 3300006931 | Bacteria | 5806 |
| 126 | Ga0097620_100636467 | 3300006931 | Bacteria | 1159 |
| 127 | Ga0075435_100006161 | 3300007076 | Bacteria | 8456 |
| 128 | Ga0075435_100011373 | 3300007076 | Bacteria | 6542 |
| 129 | Ga0105240_10519814 | 3300009093 | Bacteria | 1321 |
| 130 | Ga0111539_10000787 | 3300009094 | Bacteria | 41244 |
| 131 | Ga0111539_10002989 | 3300009094 | Bacteria | 22418 |
| 132 | Ga0111539_11186417 | 3300009094 | Bacteria | 887 |
| 133 | Ga0111539_11882510 | 3300009094 | Bacteria | 694 |
| 134 | Ga0111539_13457124 | 3300009094 | Bacteria | 507 |
| 135 | Ga0114129_10018046 | 3300009147 | Bacteria | 10051 |
| 136 | Ga0114129_10045728 | 3300009147 | Bacteria | 6153 |
| 137 | Ga0114129_11023613 | 3300009147 | Bacteria | 1039 |
| 138 | Ga0114129_11684597 | 3300009147 | Bacteria | 774 |
| 139 | Ga0105243_10001716 | 3300009148 | Bacteria | 18861 |
| 140 | Ga0105241_10151490 | 3300009174 | Bacteria | 1898 |
| 141 | Ga0105241_11941110 | 3300009174 | Bacteria | 578 |
| 142 | Ga0105248_10393153 | 3300009177 | Bacteria | 1561 |
| 143 | Ga0105248_12359944 | 3300009177 | Bacteria | 606 |
| 144 | Ga0105237_10661721 | 3300009545 | Bacteria | 1051 |
| 145 | Ga0105249_10064225 | 3300009553 | Bacteria | 3374 |
| 146 | Ga0105239_10022754 | 3300010375 | Bacteria | 6909 |
| 147 | Ga0105246_10130138 | 3300011119 | Bacteria | 1878 |
| 148 | Ga0157343_1000395 | 3300012488 | Bacteria | 1720 |
| 149 | Ga0157322_1000394 | 3300012490 | Bacteria | 1565 |
| 150 | Ga0157329_1006681 | 3300012491 | Bacteria | 819 |
| 151 | Ga0157341_1000469 | 3300012494 | Bacteria | 2051 |
| 152 | Ga0157323_1002712 | 3300012495 | Bacteria | 1009 |
| 153 | Ga0157338_1000826 | 3300012515 | Bacteria | 2015 |
| 154 | Ga0157373_10991369 | 3300013100 | Bacteria | 627 |
| 155 | Ga0157371_10012581 | 3300013102 | Bacteria | 6462 |
| 156 | Ga0157370_10262131 | 3300013104 | Bacteria | 1597 |
| 157 | Ga0171462_1009 | 3300013250 | Bacteria | 344993 |
| 158 | Ga0157374_10162264 | 3300013296 | Bacteria | 2177 |
| 159 | Ga0157378_11068503 | 3300013297 | Bacteria | 843 |
| 160 | Ga0163162_10064822 | 3300013306 | Bacteria | 3699 |
| 161 | Ga0163162_10476111 | 3300013306 | Bacteria | 1380 |
| 162 | Ga0157372_10564395 | 3300013307 | Bacteria | 1327 |
| 163 | Ga0157375_10035488 | 3300013308 | Bacteria | 4760 |
| 164 | Ga0157380_10206239 | 3300014326 | Bacteria | 1748 |
| 165 | Ga0182008_10058838 | 3300014497 | Bacteria | 1896 |
| 166 | Ga0157379_10134584 | 3300014968 | Bacteria | 2226 |
| 167 | Ga0157379_11906609 | 3300014968 | Bacteria | 586 |
| 168 | Ga0157376_11750332 | 3300014969 | Bacteria | 657 |
| 169 | Ga0182007_10058694 | 3300015262 | Bacteria | 1262 |
| 170 | Ga0209673_1008228 | 3300025273 | Bacteria | 4667 |
| 171 | Ga0209130_1001417 | 3300025284 | Bacteria | 15975 |
| 172 | Ga0209675_1000799 | 3300025291 | Bacteria | 20784 |
| 173 | Ga0209676_1038968 | 3300025292 | Bacteria | 1355 |
| 174 | Ga0209025_1000010 | 3300025294 | Bacteria | 986612 |
| 175 | Ga0209025_1001591 | 3300025294 | Bacteria | 28576 |
| 176 | Ga0209025_1040973 | 3300025294 | Bacteria | 1993 |
| 177 | Ga0209564_1000019 | 3300025295 | Bacteria | 573686 |
| 178 | Ga0209564_1000034 | 3300025295 | Bacteria | 444284 |
| 179 | Ga0209758_1000251 | 3300025297 | Bacteria | 108814 |
| 180 | Ga0209256_1000026 | 3300025299 | Bacteria | 432835 |
| 181 | Ga0209256_1000232 | 3300025299 | Bacteria | 99687 |
| 182 | Ga0209256_1029369 | 3300025299 | Bacteria | 1534 |
| 183 | Ga0207426_1013477 | 3300025302 | Bacteria | 3028 |
| 184 | Ga0207426_1031206 | 3300025302 | Bacteria | 1740 |
| 185 | Ga0209257_1031090 | 3300025304 | Bacteria | 1713 |
| 186 | Ga0207697_10022213 | 3300025315 | Bacteria | 2600 |
| 187 | Ga0207682_10173496 | 3300025893 | Bacteria | 982 |
| 188 | Ga0207642_10130969 | 3300025899 | Bacteria | 1309 |
| 189 | Ga0207642_10465215 | 3300025899 | Bacteria | 768 |
| 190 | Ga0207710_10254166 | 3300025900 | Bacteria | 879 |
| 191 | Ga0207688_10147917 | 3300025901 | Bacteria | 1386 |
| 192 | Ga0207680_10366719 | 3300025903 | Bacteria | 1013 |
| 193 | Ga0207680_10638948 | 3300025903 | Bacteria | 762 |
| 194 | Ga0207647_10017565 | 3300025904 | Bacteria | 4862 |
| 195 | Ga0207643_10067655 | 3300025908 | Bacteria | 2050 |
| 196 | Ga0207705_10724240 | 3300025909 | Bacteria | 773 |
| 197 | Ga0207654_10142866 | 3300025911 | Bacteria | 1528 |
| 198 | Ga0207671_10401647 | 3300025914 | Bacteria | 1090 |
| 199 | Ga0207693_10156646 | 3300025915 | Bacteria | 1791 |
| 200 | Ga0207663_10317991 | 3300025916 | Bacteria | 1169 |
| 201 | Ga0207663_10489512 | 3300025916 | Bacteria | 954 |
| 202 | Ga0207660_10140596 | 3300025917 | Bacteria | 1845 |
| 203 | Ga0207660_10515773 | 3300025917 | Bacteria | 970 |
| 204 | Ga0207660_10553604 | 3300025917 | Bacteria | 936 |
| 205 | Ga0207662_10588867 | 3300025918 | Bacteria | 773 |
| 206 | Ga0207657_10028997 | 3300025919 | Bacteria | 5043 |
| 207 | Ga0207652_10116402 | 3300025921 | Bacteria | 2375 |
| 208 | Ga0207652_10539149 | 3300025921 | Bacteria | 1049 |
| 209 | Ga0207652_10576024 | 3300025921 | Bacteria | 1011 |
| 210 | Ga0207652_11883961 | 3300025921 | Bacteria | 503 |
| 211 | Ga0207681_10278335 | 3300025923 | Bacteria | 1316 |
| 212 | Ga0207659_10345391 | 3300025926 | Bacteria | 1233 |
| 213 | Ga0207659_10553011 | 3300025926 | Bacteria | 978 |
| 214 | Ga0207700_10919898 | 3300025928 | Bacteria | 783 |
| 215 | Ga0207644_10829296 | 3300025931 | Bacteria | 774 |
| 216 | Ga0207690_10060890 | 3300025932 | Bacteria | 2564 |
| 217 | Ga0207706_10034755 | 3300025933 | Bacteria | 4484 |
| 218 | Ga0207706_10456056 | 3300025933 | Bacteria | 1106 |
| 219 | Ga0207670_10174202 | 3300025936 | Bacteria | 1615 |
| 220 | Ga0207670_10212125 | 3300025936 | Bacteria | 1477 |
| 221 | Ga0207670_10603344 | 3300025936 | Bacteria | 902 |
| 222 | Ga0207669_10061980 | 3300025937 | Bacteria | 2301 |
| 223 | Ga0207704_11960263 | 3300025938 | Bacteria | 504 |
| 224 | Ga0207691_10083746 | 3300025940 | Bacteria | 2863 |
| 225 | Ga0207691_10608380 | 3300025940 | Bacteria | 925 |
| 226 | Ga0207711_11344942 | 3300025941 | Bacteria | 657 |
| 227 | Ga0207661_10382489 | 3300025944 | Bacteria | 1274 |
| 228 | Ga0207679_11214043 | 3300025945 | Bacteria | 692 |
| 229 | Ga0207712_10606258 | 3300025961 | Bacteria | 948 |
| 230 | Ga0207668_10039219 | 3300025972 | Bacteria | 3186 |
| 231 | Ga0207668_10116212 | 3300025972 | Bacteria | 2017 |
| 232 | Ga0207668_10200609 | 3300025972 | Bacteria | 1588 |
| 233 | Ga0207668_11289945 | 3300025972 | Bacteria | 657 |
| 234 | Ga0207677_10385858 | 3300026023 | Bacteria | 1184 |
| 235 | Ga0207703_10041007 | 3300026035 | Bacteria | 3707 |
| 236 | Ga0207639_10020651 | 3300026041 | Bacteria | 4717 |
| 237 | Ga0207678_10009958 | 3300026067 | Bacteria | 8340 |
| 238 | Ga0207678_10348036 | 3300026067 | Bacteria | 1278 |
| 239 | Ga0207678_11599693 | 3300026067 | Bacteria | 574 |
| 240 | Ga0207708_10035615 | 3300026075 | Bacteria | 3787 |
| 241 | Ga0207708_10137241 | 3300026075 | Bacteria | 1916 |
| 242 | Ga0207708_10583907 | 3300026075 | Bacteria | 945 |
| 243 | Ga0207702_11582907 | 3300026078 | Bacteria | 649 |
| 244 | Ga0207648_10407107 | 3300026089 | Bacteria | 1233 |
| 245 | Ga0207648_11456304 | 3300026089 | Bacteria | 644 |
| 246 | Ga0207674_10372230 | 3300026116 | Bacteria | 1381 |
| 247 | Ga0207674_12045640 | 3300026116 | Bacteria | 537 |
| 248 | Ga0207675_100121622 | 3300026118 | Bacteria | 2471 |
| 249 | Ga0207683_10274075 | 3300026121 | Bacteria | 1541 |
| 250 | Ga0207698_11750292 | 3300026142 | Bacteria | 637 |
| 251 | Ga0209996_1014313 | 3300027395 | Bacteria | 1077 |
| 252 | Ga0210000_1008868 | 3300027462 | Bacteria | 1476 |
| 253 | Ga0209588_1104131 | 3300027671 | Bacteria | 912 |
| 254 | Ga0209971_1004899 | 3300027682 | Bacteria | 3181 |
| 255 | Ga0209966_1015359 | 3300027695 | Bacteria | 1437 |
| 256 | Ga0209966_1116157 | 3300027695 | Bacteria | 612 |
| 257 | Ga0209998_10005564 | 3300027717 | Bacteria | 2634 |
| 258 | Ga0209998_10075583 | 3300027717 | Bacteria | 810 |
| 259 | Ga0209974_10012884 | 3300027876 | Bacteria | 2792 |
| 260 | Ga0209974_10024452 | 3300027876 | Bacteria | 1999 |
| 261 | Ga0209974_10091804 | 3300027876 | Bacteria | 1054 |
| 262 | Ga0207428_10000058 | 3300027907 | Bacteria | 158579 |
| 263 | Ga0207428_10001877 | 3300027907 | Bacteria | 21401 |
| 264 | Ga0207428_10576386 | 3300027907 | Bacteria | 812 |
| 265 | Ga0268266_11034283 | 3300028379 | Bacteria | 795 |
| 266 | Ga0268265_10076997 | 3300028380 | Bacteria | 2618 |
| 267 | Ga0268264_10063477 | 3300028381 | Bacteria | 3105 |
| 268 | Ga0265340_10391574 | 3300031247 | Bacteria | 613 |
| 269 | Ga0265339_10560887 | 3300031249 | Bacteria | 525 |
| 270 | Ga0307408_101105023 | 3300031548 | Bacteria | 735 |
| 271 | Ga0265313_10256165 | 3300031595 | Bacteria | 712 |
| 272 | Ga0316579_10002736 | 3300031691 | Bacteria | 6729 |
| 273 | Ga0265314_10017614 | 3300031711 | Bacteria | 5600 |
| 274 | Ga0265314_10186209 | 3300031711 | Bacteria | 1239 |
| 275 | Ga0265314_10300922 | 3300031711 | Bacteria | 900 |
| 276 | Ga0307406_10039922 | 3300031901 | Bacteria | 2915 |
| 277 | Ga0307406_10285464 | 3300031901 | Bacteria | 1261 |
| 278 | Ga0307416_103263642 | 3300032002 | Bacteria | 543 |
| 279 | Ga0307414_10106706 | 3300032004 | Bacteria | 2121 |
| 280 | Ga0307414_11704598 | 3300032004 | Bacteria | 588 |
| 281 | Ga0316583_10321810 | 3300032133 | Bacteria | 535 |
| 282 | Ga0373930_0000227 | 3300034816 | Bacteria | 7077 |
| 283 | Ga0373948_0021808 | 3300034817 | Bacteria | 1229 |
| 284 | Ga0373950_0000785 | 3300034818 | Bacteria | 3965 |
| 285 | Ga0373959_0000278 | 3300034820 | Bacteria | 10960 |
| 286 | Ga0373938_0000185 | 3300034957 | Bacteria | 9182 |
| 287 | Ga0373928_0000509 | 3300035084 | Bacteria | 7637 |
| 288 | Ga0373929_0000347 | 3300035085 | Bacteria | 8661 |
| 289 | Ga0373934_0033195 | 3300035086 | Bacteria | 2026 |
| 290 | Ga0373940_0000033 | 3300035088 | Bacteria | 15017 |
| 291 | Ga0373949_0007020 | 3300035090 | Bacteria | 2470 |
| 292 | Ga0373951_0002035 | 3300035091 | Bacteria | 5174 |
| 293 | Ga0373952_0000067 | 3300035092 | Bacteria | 13144 |
| 294 | Ga0373932_0011835 | 3300035112 | Bacteria | 2138 |
| 295 | Ga0373939_0005595 | 3300035114 | Bacteria | 2994 |
| 296 | Ga0373941_0000055 | 3300035115 | Bacteria | 17323 |
| 297 | Ga0373953_0139227 | 3300035117 | Bacteria | 1037 |
| 298 | Ga0373954_0034924 | 3300035118 | Bacteria | 2330 |
| 299 | Ga0373957_0013363 | 3300035120 | Bacteria | 2785 |
| 300 | Ga0373960_0000621 | 3300035121 | Bacteria | 7257 |
| 301 | Ga0373943_0962013 | 3300035170 | Bacteria | 511 |
| 302 | Ga0373955_0008944 | 3300035172 | Bacteria | 4674 |
| 303 | Ga0373942_0000604 | 3300035207 | Bacteria | 10088 |
| 304 | Ga0373961_0006501 | 3300035241 | Bacteria | 2806 |
| 305 | Ga0373961_0162518 | 3300035241 | Bacteria | 768 |
| 306 | Ga0373924_0275174 | 3300035410 | Bacteria | 746 |
| 307 | Ga0373935_0146333 | 3300035692 | Bacteria | 1600 |
| 308 | Ga0373933_0053701 | 3300035724 | Bacteria | 2413 |
| 309 | Ga0373947_0058636 | 3300035725 | Bacteria | 2333 |
| 310 | Ga0373937_0051826 | 3300036401 | Bacteria | 3761 |
| 311 | Ga0373937_0705245 | 3300036401 | Bacteria | 956 |
| 312 | Ga0373925_0008196 | 3300037068 | Bacteria | 7606 |
| 313 | Ga0373925_0649790 | 3300037068 | Bacteria | 869 |
| 314 | Ga0242419_012888 | 3300038698 | Bacteria | 656 |
| 315 | Ga0242420_046149 | 3300038996 | Bacteria | 842 |
| 316 | Ga0237816_09314 | 3300039145 | Bacteria | 586 |
| 317 | Ga0439453_0155854 | 3300041408 | Bacteria | 544 |
| 318 | Ga0439465_0236842 | 3300041413 | Bacteria | 672 |
| 319 | Ga0451807_0706480 | 3300041486 | Bacteria | 523 |
| 320 | Ga0439441_108094 | 3300042001 | Bacteria | 629 |
| 321 | Ga0439450_026365 | 3300042008 | Bacteria | 1280 |
| 322 | Ga0439454_051245 | 3300042011 | Bacteria | 697 |
| 323 | Ga0439463_064797 | 3300042016 | Bacteria | 934 |
| 324 | Ga0439458_0030570 | 3300042157 | Bacteria | 1282 |
| 325 | Ga0439435_0278045 | 3300042436 | Bacteria | 569 |
| 326 | Ga0439464_0106588 | 3300042439 | Bacteria | 855 |
| 327 | Ga0439460_0119991 | 3300042461 | Bacteria | 859 |
| 328 | Ga0439440_0139702 | 3300042993 | Bacteria | 687 |
| 329 | Ga0453683_1148553 | 3300044673 | Bacteria | 519 |
| 330 | Ga0453684_0205388 | 3300044712 | Bacteria | 2293 |
| 331 | Ga0466960_0376935 | 3300044901 | Bacteria | 814 |
| 332 | Ga0451576_0178747 | 3300045051 | Bacteria | 2215 |
| 333 | Ga0495592_0004712 | 3300046454 | Bacteria | 10006 |
| 334 | Ga0495641_0042436 | 3300046461 | Bacteria | 2108 |
| 335 | Ga0495651_0272279 | 3300046462 | Bacteria | 1147 |
| 336 | Ga0495653_0154010 | 3300046463 | Bacteria | 1603 |
| 337 | Ga0495664_0148765 | 3300046477 | Bacteria | 1420 |
| 338 | Ga0495628_0005498 | 3300046516 | Bacteria | 11090 |
| 339 | Ga0495630_0117327 | 3300046517 | Bacteria | 2018 |
| 340 | Ga0495632_0003225 | 3300046519 | Bacteria | 11714 |
| 341 | Ga0495652_0033641 | 3300046529 | Bacteria | 4472 |
| 342 | Ga0495640_0378965 | 3300046533 | Bacteria | 871 |
| 343 | Ga0495587_0020754 | 3300046536 | Bacteria | 4053 |
| 344 | Ga0495587_0841355 | 3300046536 | Bacteria | 500 |
| 345 | Ga0495598_0069656 | 3300046537 | Bacteria | 1105 |
| 346 | Ga0495667_0014419 | 3300046559 | Bacteria | 5340 |
| 347 | Ga0495635_0109072 | 3300046663 | Bacteria | 1891 |
| 348 | Ga0495661_0453549 | 3300046665 | Bacteria | 617 |
| 349 | Ga0495588_0445882 | 3300046674 | Bacteria | 679 |
| 350 | Ga0495657_0027025 | 3300046675 | Bacteria | 4056 |
| 351 | Ga0495599_0004339 | 3300046678 | Bacteria | 8391 |
| 352 | Ga0495646_0097491 | 3300046680 | Bacteria | 1689 |
| 353 | Ga0495669_0531215 | 3300046684 | Bacteria | 572 |
| 354 | Ga0495624_0176158 | 3300046690 | Bacteria | 1304 |
| 355 | Ga0495600_0088393 | 3300046809 | Bacteria | 2021 |
| 356 | Ga0495604_0025651 | 3300047317 | Bacteria | 4695 |
| 357 | Ga0495674_0058374 | 3300047319 | Bacteria | 3374 |
| 358 | Ga0495680_0069720 | 3300047322 | Bacteria | 2682 |
| 359 | Ga0495684_0097041 | 3300047471 | Bacteria | 2230 |
| 360 | Ga0495686_0252318 | 3300047472 | Bacteria | 991 |
| 361 | Ga0495593_0383433 | 3300047673 | Bacteria | 703 |
| 362 | Ga0495602_0008977 | 3300048088 | Bacteria | 10417 |
| 363 | Ga0495602_0456574 | 3300048088 | Bacteria | 901 |
| 364 | Ga0496100_0520869 | 3300048903 | Bacteria | 918 |
| 365 | Ga0496102_0044569 | 3300048905 | Bacteria | 4026 |
| 366 | Ga0496105_0089474 | 3300048908 | Bacteria | 2543 |
| 367 | Ga0496106_0012821 | 3300048909 | Bacteria | 6188 |
| 368 | Ga0496107_0087659 | 3300048910 | Bacteria | 2272 |
| 369 | Ga0496108_0105128 | 3300048911 | Bacteria | 2410 |
| 370 | Ga0496108_0440528 | 3300048911 | Bacteria | 1138 |
| 371 | Ga0496109_0439229 | 3300048912 | Bacteria | 1233 |
| 372 | Ga0496109_0496861 | 3300048912 | Bacteria | 1151 |
| 373 | Ga0496109_1175757 | 3300048912 | Bacteria | 704 |
| 374 | Ga0496110_0013167 | 3300048913 | Bacteria | 6830 |
| 375 | Ga0496110_0927345 | 3300048913 | Bacteria | 777 |
| 376 | Ga0496110_1104756 | 3300048913 | Bacteria | 701 |
| 377 | Ga0496110_1194275 | 3300048913 | Bacteria | 669 |
| 378 | Ga0496110_1206768 | 3300048913 | Bacteria | 665 |
| 379 | Ga0496111_0127704 | 3300048914 | Bacteria | 1880 |
| 380 | Ga0496111_0150935 | 3300048914 | Bacteria | 1723 |
| 381 | Ga0496111_0197082 | 3300048914 | Bacteria | 1497 |
| 382 | Ga0496111_1012095 | 3300048914 | Bacteria | 595 |
| 383 | Ga0496113_0081004 | 3300048916 | Bacteria | 2488 |
| 384 | Ga0496113_1034548 | 3300048916 | Bacteria | 646 |
| 385 | Ga0496114_0065824 | 3300048917 | Bacteria | 3037 |
| 386 | Ga0496114_0290353 | 3300048917 | Bacteria | 1443 |
| 387 | Ga0496114_1287127 | 3300048917 | Bacteria | 618 |
| 388 | Ga0496115_0031869 | 3300048918 | Bacteria | 4156 |
| 389 | Ga0496115_0305513 | 3300048918 | Bacteria | 1303 |
| 390 | Ga0496116_0064701 | 3300048919 | Bacteria | 2350 |
| 391 | Ga0496117_0043257 | 3300048920 | Bacteria | 3277 |
| 392 | Ga0496117_0267218 | 3300048920 | Bacteria | 923 |
| 393 | Ga0496118_0328944 | 3300048921 | Bacteria | 825 |
| 394 | Ga0496119_0534602 | 3300048922 | Bacteria | 541 |
| 395 | Ga0496120_0285480 | 3300048923 | Bacteria | 761 |
| 396 | Ga0496121_0307134 | 3300048924 | Bacteria | 1074 |
| 397 | Ga0496122_0064755 | 3300048925 | Bacteria | 2657 |
| 398 | Ga0496122_0219051 | 3300048925 | Bacteria | 1094 |
| 399 | Ga0496123_0041361 | 3300048926 | Bacteria | 3196 |
| 400 | Ga0496123_0173110 | 3300048926 | Bacteria | 1136 |
| 401 | Ga0496123_0183946 | 3300048926 | Bacteria | 1088 |
| 402 | Ga0496125_0000282 | 3300048928 | Bacteria | 101380 |
| 403 | Ga0496125_0160216 | 3300048928 | Bacteria | 1530 |
| 404 | Ga0496125_0331699 | 3300048928 | Bacteria | 917 |
| 405 | Ga0496125_0360107 | 3300048928 | Bacteria | 865 |
| 406 | Ga0496126_0064126 | 3300048929 | Bacteria | 3292 |
| 407 | Ga0496126_0660466 | 3300048929 | Bacteria | 817 |
| 408 | Ga0501031_0056956 | 3300049568 | Bacteria | 2547 |
| 409 | Ga0501032_0005814 | 3300049569 | Bacteria | 9122 |
| 410 | Ga0501032_0022549 | 3300049569 | Bacteria | 4364 |
| 411 | Ga0501032_0080309 | 3300049569 | Bacteria | 2170 |
| 412 | Ga0501032_0128223 | 3300049569 | Bacteria | 1675 |
| 413 | Ga0501032_0583771 | 3300049569 | Bacteria | 711 |
| 414 | Ga0501033_0003939 | 3300049570 | Bacteria | 12043 |
| 415 | Ga0501033_0008967 | 3300049570 | Bacteria | 7724 |
| 416 | Ga0501033_0012798 | 3300049570 | Bacteria | 6397 |
| 417 | Ga0501033_0105529 | 3300049570 | Bacteria | 2053 |
| 418 | Ga0501034_0017011 | 3300049571 | Bacteria | 7455 |
| 419 | Ga0501034_0025138 | 3300049571 | Bacteria | 6061 |
| 420 | Ga0501034_0161102 | 3300049571 | Bacteria | 2214 |
| 421 | Ga0501034_0235966 | 3300049571 | Bacteria | 1776 |
| 422 | Ga0501034_0255410 | 3300049571 | Bacteria | 1696 |
| 423 | Ga0501034_0262862 | 3300049571 | Bacteria | 1668 |
| 424 | Ga0501034_0274917 | 3300049571 | Bacteria | 1625 |
| 425 | Ga0501034_0281175 | 3300049571 | Bacteria | 1603 |
| 426 | Ga0501034_0365764 | 3300049571 | Bacteria | 1369 |
| 427 | Ga0501036_0008301 | 3300049572 | Bacteria | 8510 |
| 428 | Ga0501036_0033397 | 3300049572 | Bacteria | 4352 |
| 429 | Ga0501036_0036040 | 3300049572 | Bacteria | 4186 |
| 430 | Ga0501036_0440571 | 3300049572 | Bacteria | 1086 |
| 431 | Ga0501036_0456638 | 3300049572 | Bacteria | 1064 |
| 432 | Ga0501036_0936996 | 3300049572 | Bacteria | 710 |
| 433 | Ga0501037_0010290 | 3300049573 | Bacteria | 6865 |
| 434 | Ga0501037_0014152 | 3300049573 | Bacteria | 5873 |
| 435 | Ga0501037_0035288 | 3300049573 | Bacteria | 3689 |
| 436 | Ga0501037_0047155 | 3300049573 | Bacteria | 3159 |
| 437 | Ga0501038_0015032 | 3300049574 | Bacteria | 7050 |
| 438 | Ga0501038_0020331 | 3300049574 | Bacteria | 5970 |
| 439 | Ga0501038_0051388 | 3300049574 | Bacteria | 3557 |
| 440 | Ga0501038_0392985 | 3300049574 | Bacteria | 1074 |
| 441 | Ga0501039_0001301 | 3300049575 | Bacteria | 18242 |
| 442 | Ga0501039_0224310 | 3300049575 | Bacteria | 1477 |
| 443 | Ga0501039_0308118 | 3300049575 | Bacteria | 1245 |
| 444 | Ga0501039_0753831 | 3300049575 | Bacteria | 760 |
| 445 | Ga0501041_0297230 | 3300049577 | Bacteria | 1017 |
| 446 | Ga0501042_0083688 | 3300049578 | Bacteria | 2287 |
| 447 | Ga0501042_0141123 | 3300049578 | Bacteria | 1737 |
| 448 | Ga0501043_0002203 | 3300049579 | Bacteria | 16610 |
| 449 | Ga0501043_0041913 | 3300049579 | Bacteria | 3596 |
| 450 | Ga0501043_0087832 | 3300049579 | Bacteria | 2443 |
| 451 | Ga0501043_0326893 | 3300049579 | Bacteria | 1168 |
| 452 | Ga0501043_0379603 | 3300049579 | Bacteria | 1070 |
| 453 | Ga0501043_1176741 | 3300049579 | Bacteria | 539 |
| 454 | Ga0501046_0012154 | 3300049580 | Bacteria | 7338 |
| 455 | Ga0501046_0407519 | 3300049580 | Bacteria | 981 |
| 456 | Ga0501046_0436931 | 3300049580 | Bacteria | 942 |
| 457 | Ga0501046_0732728 | 3300049580 | Bacteria | 695 |
| 458 | Ga0501047_0005496 | 3300049581 | Bacteria | 11927 |
| 459 | Ga0501047_0016792 | 3300049581 | Bacteria | 6994 |
| 460 | Ga0501047_0135752 | 3300049581 | Bacteria | 2340 |
| 461 | Ga0501047_0159507 | 3300049581 | Bacteria | 2128 |
| 462 | Ga0501047_0507416 | 3300049581 | Bacteria | 1032 |
| 463 | Ga0501047_0526369 | 3300049581 | Bacteria | 1008 |
| 464 | Ga0501047_0784139 | 3300049581 | Bacteria | 768 |
| 465 | Ga0501048_0000886 | 3300049582 | Bacteria | 22125 |
| 466 | Ga0501048_0251496 | 3300049582 | Bacteria | 1255 |
| 467 | Ga0501048_0302179 | 3300049582 | Bacteria | 1139 |
| 468 | Ga0501067_0033707 | 3300049583 | Bacteria | 2841 |
| 469 | Ga0501068_0012080 | 3300049584 | Bacteria | 4887 |
| 470 | Ga0501068_0034753 | 3300049584 | Bacteria | 3008 |
| 471 | Ga0501068_0143614 | 3300049584 | Bacteria | 1497 |
| 472 | Ga0501068_0838650 | 3300049584 | Bacteria | 604 |
| 473 | Ga0501068_1208047 | 3300049584 | Bacteria | 501 |
| 474 | Ga0501069_0000437 | 3300049585 | Bacteria | 18980 |
| 475 | Ga0501069_0088479 | 3300049585 | Bacteria | 1750 |
| 476 | Ga0501069_0364034 | 3300049585 | Bacteria | 853 |
| 477 | Ga0501070_0002038 | 3300049586 | Bacteria | 17765 |
| 478 | Ga0501070_0011845 | 3300049586 | Bacteria | 7362 |
| 479 | Ga0501070_0026855 | 3300049586 | Bacteria | 4829 |
| 480 | Ga0501070_0122036 | 3300049586 | Bacteria | 2153 |
| 481 | Ga0501070_0399194 | 3300049586 | Bacteria | 1112 |
| 482 | Ga0501070_0608936 | 3300049586 | Bacteria | 870 |
| 483 | Ga0501070_1034397 | 3300049586 | Bacteria | 636 |
| 484 | Ga0501071_0005718 | 3300049587 | Bacteria | 8021 |
| 485 | Ga0501071_0096456 | 3300049587 | Bacteria | 2176 |
| 486 | Ga0501071_1061781 | 3300049587 | Bacteria | 626 |
| 487 | Ga0501072_0010471 | 3300049588 | Bacteria | 7063 |
| 488 | Ga0501072_0756562 | 3300049588 | Bacteria | 762 |
| 489 | Ga0501073_0006839 | 3300049589 | Bacteria | 8478 |
| 490 | Ga0501073_0007850 | 3300049589 | Bacteria | 7921 |
| 491 | Ga0501073_0016521 | 3300049589 | Bacteria | 5350 |
| 492 | Ga0501073_0028970 | 3300049589 | Bacteria | 3956 |
| 493 | Ga0501073_0455653 | 3300049589 | Bacteria | 884 |
| 494 | Ga0501073_0530836 | 3300049589 | Bacteria | 813 |
| 495 | Ga0501073_0832642 | 3300049589 | Bacteria | 636 |
| 496 | Ga0501073_0858167 | 3300049589 | Bacteria | 625 |
| 497 | Ga0501074_0003168 | 3300049590 | Bacteria | 11602 |
| 498 | Ga0501074_0028988 | 3300049590 | Bacteria | 4010 |
| 499 | Ga0501074_0030900 | 3300049590 | Bacteria | 3881 |
| 500 | Ga0501075_0004711 | 3300049591 | Bacteria | 9262 |
| 501 | Ga0501075_0604168 | 3300049591 | Bacteria | 837 |
| 502 | Ga0501076_0014561 | 3300049592 | Bacteria | 5928 |
| 503 | Ga0501076_0035062 | 3300049592 | Bacteria | 3925 |
| 504 | Ga0501076_0084946 | 3300049592 | Bacteria | 2543 |
| 505 | Ga0501077_0059772 | 3300049593 | Bacteria | 2419 |
| 506 | Ga0501077_0086240 | 3300049593 | Bacteria | 1990 |
| 507 | Ga0501077_0475960 | 3300049593 | Bacteria | 800 |
| 508 | Ga0501079_0009707 | 3300049741 | Bacteria | 7297 |
| 509 | Ga0501079_0046836 | 3300049741 | Bacteria | 3337 |
| 510 | Ga0501079_0088682 | 3300049741 | Bacteria | 2395 |
| 511 | Ga0501079_0529243 | 3300049741 | Bacteria | 927 |
| 512 | Ga0501080_0010101 | 3300049742 | Bacteria | 8632 |
| 513 | Ga0501080_0040450 | 3300049742 | Bacteria | 4348 |
| 514 | Ga0501080_0060516 | 3300049742 | Bacteria | 3525 |
| 515 | Ga0501080_0492287 | 3300049742 | Bacteria | 1096 |
| 516 | Ga0501081_0015721 | 3300049743 | Bacteria | 4995 |
| 517 | Ga0501081_0127376 | 3300049743 | Bacteria | 1817 |
| 518 | Ga0501081_0682676 | 3300049743 | Bacteria | 771 |
| 519 | Ga0501083_0011452 | 3300049744 | Bacteria | 6221 |
| 520 | Ga0501083_0153165 | 3300049744 | Bacteria | 1509 |
| 521 | Ga0501083_0194569 | 3300049744 | Bacteria | 1323 |
| 522 | Ga0501035_0001764 | 3300049822 | Bacteria | 21833 |
| 523 | Ga0501035_0004712 | 3300049822 | Bacteria | 12950 |
| 524 | Ga0501035_0016845 | 3300049822 | Bacteria | 6737 |
| 525 | Ga0501035_0027344 | 3300049822 | Bacteria | 5214 |
| 526 | Ga0501035_0085797 | 3300049822 | Bacteria | 2774 |
| 527 | Ga0501035_0499219 | 3300049822 | Bacteria | 1002 |
| 528 | Ga0501035_1408471 | 3300049822 | Bacteria | 534 |
| 529 | Ga0501044_0010691 | 3300049823 | Bacteria | 9958 |
| 530 | Ga0501044_0018487 | 3300049823 | Bacteria | 7467 |
| 531 | Ga0501044_0025958 | 3300049823 | Bacteria | 6206 |
| 532 | Ga0501044_0044749 | 3300049823 | Bacteria | 4591 |
| 533 | Ga0501044_0110800 | 3300049823 | Bacteria | 2753 |
| 534 | Ga0501045_0018183 | 3300049824 | Bacteria | 4996 |
| 535 | Ga0501045_0707539 | 3300049824 | Bacteria | 743 |
| 536 | nmdc:mga00v17_351574_c1 | 3300050491 | Bacteria | 958 |
| 537 | nmdc:mga0yw44_1064017_c1 | 3300050492 | Bacteria | 547 |
| 538 | nmdc:mga0yw44_485620_c1 | 3300050492 | Bacteria | 838 |
| 539 | nmdc:mga0yw44_914399_c1 | 3300050492 | Bacteria | 595 |
| 540 | nmdc:mga0yw44_937_c1 | 3300050492 | Bacteria | 7973 |
| 541 | nmdc:mga0k408_26602_c1 | 3300050493 | Bacteria | 3281 |
| 542 | nmdc:mga05p37_1492059_c1 | 3300050507 | Bacteria | 674 |
| 543 | nmdc:mga05p37_334227_c1 | 3300050507 | Bacteria | 1788 |
| 544 | nmdc:mga05p37_35_c1 | 3300050507 | Bacteria | 110751 |
| 545 | nmdc:mga05p37_6170_c1 | 3300050507 | Bacteria | 14110 |
| 546 | nmdc:mga05p37_890095_c1 | 3300050507 | Bacteria | 961 |
| 547 | nmdc:mga09592_163_c1 | 3300050508 | Bacteria | 46620 |
| 548 | nmdc:mga09592_41900_c1 | 3300050508 | Bacteria | 3851 |
| 549 | nmdc:mga0qj67_143_c1 | 3300050509 | Bacteria | 48269 |
| 550 | nmdc:mga0qj67_154190_c1 | 3300050509 | Bacteria | 1864 |
| 551 | nmdc:mga06r32_34027_c1 | 3300050510 | Bacteria | 4803 |
| 552 | nmdc:mga06r32_936_c1 | 3300050510 | Bacteria | 25964 |
| 553 | nmdc:mga08y16_1040379_c1 | 3300050511 | Bacteria | 797 |
| 554 | nmdc:mga08y16_1688624_c1 | 3300050511 | Bacteria | 589 |
| 555 | nmdc:mga08y16_231052_c1 | 3300050511 | Bacteria | 1913 |
| 556 | nmdc:mga08y16_2671_c1 | 3300050511 | Bacteria | 18327 |
| 557 | nmdc:mga08y16_6719_c1 | 3300050511 | Bacteria | 12057 |
| 558 | nmdc:mga0n895_33593_c1 | 3300050512 | Bacteria | 4932 |
| 559 | nmdc:mga0n895_356672_c1 | 3300050512 | Bacteria | 1481 |
| 560 | nmdc:mga0n895_457589_c1 | 3300050512 | Bacteria | 1288 |
| 561 | nmdc:mga0rr50_1301_c1 | 3300050513 | Bacteria | 13614 |
| 562 | nmdc:mga0rr50_3039_c1 | 3300050513 | Bacteria | 9598 |
| 563 | nmdc:mga08x19_1012080_c1 | 3300050514 | Bacteria | 590 |
| 564 | nmdc:mga08x19_437774_c1 | 3300050514 | Bacteria | 919 |
| 565 | nmdc:mga0a205_2132_c1 | 3300050515 | Bacteria | 17371 |
| 566 | nmdc:mga0a205_38040_c1 | 3300050515 | Bacteria | 4628 |
| 567 | nmdc:mga0a205_63150_c1 | 3300050515 | Bacteria | 3578 |
| 568 | nmdc:mga0sz30_511555_c1 | 3300050516 | Bacteria | 540 |
| 569 | Ga0495601_0000485 | 3300053077 | Bacteria | 20919 |
| 570 | Ga0495612_0000714 | 3300053078 | Bacteria | 13470 |
| 571 | Ga0495595_0321732 | 3300053084 | Bacteria | 779 |
| 572 | Ga0495595_0336146 | 3300053084 | Bacteria | 761 |
| 573 | Ga0495619_0000487 | 3300053085 | Bacteria | 26605 |
| 574 | Ga0495619_0465601 | 3300053085 | Bacteria | 871 |
| 575 | Ga0500651_0328894 | 3300053093 | Bacteria | 871 |
| 576 | Ga0500569_267146 | 3300053109 | Bacteria | 579 |
| 577 | Ga0500608_254464 | 3300053122 | Bacteria | 683 |
| 578 | Ga0500642_0229223 | 3300053130 | Bacteria | 859 |
| 579 | Ga0500568_0039859 | 3300053139 | Bacteria | 1894 |
| 580 | Ga0500586_272472 | 3300053145 | Bacteria | 521 |
| 581 | Ga0500616_0109020 | 3300053153 | Bacteria | 1340 |
| 582 | Ga0500636_0011757 | 3300053177 | Bacteria | 5124 |
| 583 | Ga0501084_0018001 | 3300054114 | Bacteria | 5883 |
| 584 | Ga0501084_0272197 | 3300054114 | Bacteria | 1430 |
| 585 | Ga0501084_0457801 | 3300054114 | Bacteria | 1078 |
| 586 | Ga0590075_111010 | 3300059424 | Bacteria | 716 |
| 587 | Ga0501082_0029163 | 3300060353 | Bacteria | 4754 |
| 588 | Ga0501082_0057648 | 3300060353 | Bacteria | 3346 |
| 589 | Ga0501082_0227049 | 3300060353 | Bacteria | 1625 |
| 590 | Ga0501082_0338044 | 3300060353 | Bacteria | 1312 |
| 591 | Ga0501082_1331741 | 3300060353 | Bacteria | 627 |
| 592 | Ga0530510_0064349 | 3300061734 | Bacteria | 2656 |
| 593 | Ga0530510_0524342 | 3300061734 | Bacteria | 899 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046665 | Ga0495661_0453549 | Ga0495661_0453549_66_311 | 76 |
| 2 | 3300005347 | Ga0070668_100347040 | Ga0070668_1003470402 | 79 |
| 3 | 3300006051 | Ga0075364_10108738 | Ga0075364_101087383 | 79 |
| 4 | 3300002987 | JGI25159J45721_1021639 | JGI25159J45721_10216392 | 80 |
| 5 | 3300003187 | JGI25151J46595_10000018 | JGI25151J46595_1000001828 | 80 |
| 6 | 3300003187 | JGI25151J46595_10034061 | JGI25151J46595_100340613 | 80 |
| 7 | 3300003771 | Ga0055526_1000362 | Ga0055526_100036224 | 80 |
| 8 | 3300003771 | Ga0055526_1000571 | Ga0055526_10005718 | 80 |
| 9 | 3300003775 | Ga0055524_1000048 | Ga0055524_1000048101 | 80 |
| 10 | 3300003775 | Ga0055524_1027828 | Ga0055524_10278282 | 80 |
| 11 | 3300003784 | Ga0055534_1008656 | Ga0055534_10086563 | 80 |
| 12 | 3300005262 | Ga0065165_1000337 | Ga0065165_100033726 | 80 |
| 13 | 3300006038 | Ga0075365_10029225 | Ga0075365_100292253 | 80 |
| 14 | 3300006042 | Ga0075368_10514054 | Ga0075368_105140541 | 80 |
| 15 | 3300006051 | Ga0075364_10469646 | Ga0075364_104696462 | 80 |
| 16 | 3300006186 | Ga0075369_10189743 | Ga0075369_101897432 | 80 |
| 17 | 3300013250 | Ga0171462_1009 | Ga0171462_100997 | 80 |
| 18 | 3300025273 | Ga0209673_1008228 | Ga0209673_10082284 | 80 |
| 19 | 3300025284 | Ga0209130_1001417 | Ga0209130_100141719 | 80 |
| 20 | 3300025291 | Ga0209675_1000799 | Ga0209675_100079915 | 80 |
| 21 | 3300025292 | Ga0209676_1038968 | Ga0209676_10389682 | 80 |
| 22 | 3300025294 | Ga0209025_1000010 | Ga0209025_100001037 | 80 |
| 23 | 3300025294 | Ga0209025_1001591 | Ga0209025_100159122 | 80 |
| 24 | 3300025294 | Ga0209025_1040973 | Ga0209025_10409733 | 80 |
| 25 | 3300025295 | Ga0209564_1000019 | Ga0209564_1000019207 | 80 |
| 26 | 3300025295 | Ga0209564_1000034 | Ga0209564_1000034204 | 80 |
| 27 | 3300025299 | Ga0209256_1000026 | Ga0209256_1000026192 | 80 |
| 28 | 3300025299 | Ga0209256_1000232 | Ga0209256_100023225 | 80 |
| 29 | 3300025299 | Ga0209256_1029369 | Ga0209256_10293692 | 80 |
| 30 | 3300025302 | Ga0207426_1013477 | Ga0207426_10134772 | 80 |
| 31 | 3300025304 | Ga0209257_1031090 | Ga0209257_10310902 | 80 |
| 32 | 3300025972 | Ga0207668_10039219 | Ga0207668_100392192 | 80 |
| 33 | 3300031901 | Ga0307406_10039922 | Ga0307406_100399224 | 80 |
| 34 | 3300032004 | Ga0307414_11704598 | Ga0307414_117045982 | 80 |
| 35 | 3300039145 | Ga0237816_09314 | Ga0237816_09314_220_462 | 80 |
| 36 | 3300041413 | Ga0439465_0236842 | Ga0439465_0236842_84_326 | 80 |
| 37 | 3300048913 | Ga0496110_1104756 | Ga0496110_1104756_163_405 | 80 |
| 38 | 3300048917 | Ga0496114_0290353 | Ga0496114_0290353_18_260 | 80 |
| 39 | 3300048920 | Ga0496117_0043257 | Ga0496117_0043257_1742_1996 | 80 |
| 40 | 3300048920 | Ga0496117_0267218 | Ga0496117_0267218_19_261 | 80 |
| 41 | 3300048921 | Ga0496118_0328944 | Ga0496118_0328944_460_714 | 80 |
| 42 | 3300048922 | Ga0496119_0534602 | Ga0496119_0534602_104_358 | 80 |
| 43 | 3300048923 | Ga0496120_0285480 | Ga0496120_0285480_427_681 | 80 |
| 44 | 3300048924 | Ga0496121_0307134 | Ga0496121_0307134_172_414 | 80 |
| 45 | 3300048925 | Ga0496122_0064755 | Ga0496122_0064755_2248_2502 | 80 |
| 46 | 3300048925 | Ga0496122_0219051 | Ga0496122_0219051_357_599 | 80 |
| 47 | 3300048926 | Ga0496123_0041361 | Ga0496123_0041361_2185_2427 | 80 |
| 48 | 3300048926 | Ga0496123_0173110 | Ga0496123_0173110_218_472 | 80 |
| 49 | 3300048926 | Ga0496123_0183946 | Ga0496123_0183946_400_642 | 80 |
| 50 | 3300048928 | Ga0496125_0160216 | Ga0496125_0160216_1276_1518 | 80 |
| 51 | 3300048928 | Ga0496125_0331699 | Ga0496125_0331699_240_482 | 80 |
| 52 | 3300048929 | Ga0496126_0064126 | Ga0496126_0064126_2566_2841 | 80 |
| 53 | 3300048929 | Ga0496126_0660466 | Ga0496126_0660466_26_268 | 80 |
| 54 | 3300049571 | Ga0501034_0025138 | Ga0501034_0025138_846_1091 | 80 |
| 55 | 3300049575 | Ga0501039_0224310 | Ga0501039_0224310_1185_1430 | 80 |
| 56 | 3300049581 | Ga0501047_0784139 | Ga0501047_0784139_22_282 | 80 |
| 57 | 3300049586 | Ga0501070_1034397 | Ga0501070_1034397_293_538 | 80 |
| 58 | 3300050491 | nmdc:mga00v17_351574_c1 | nmdc:mga00v17_351574_c1_472_714 | 80 |
| 59 | 3300050492 | nmdc:mga0yw44_1064017_c1 | nmdc:mga0yw44_1064017_c1_193_435 | 80 |
| 60 | 3300050492 | nmdc:mga0yw44_914399_c1 | nmdc:mga0yw44_914399_c1_202_444 | 80 |
| 61 | 3300050492 | nmdc:mga0yw44_937_c1 | nmdc:mga0yw44_937_c1_6119_6361 | 80 |
| 62 | 3300053109 | Ga0500569_267146 | Ga0500569_267146_58_312 | 80 |
| 63 | 3300053122 | Ga0500608_254464 | Ga0500608_254464_28_282 | 80 |
| 64 | 3300053177 | Ga0500636_0011757 | Ga0500636_0011757_2701_2955 | 80 |
| 65 | 3300003215 | JGI25153J46596_10004251 | JGI25153J46596_100042512 | 81 |
| 66 | 3300005459 | Ga0068867_101644605 | Ga0068867_1016446051 | 81 |
| 67 | 3300006042 | Ga0075368_10135504 | Ga0075368_101355042 | 81 |
| 68 | 3300006051 | Ga0075364_10571059 | Ga0075364_105710592 | 81 |
| 69 | 3300006177 | Ga0075362_10157543 | Ga0075362_101575432 | 81 |
| 70 | 3300006177 | Ga0075362_10298600 | Ga0075362_102986001 | 81 |
| 71 | 3300006178 | Ga0075367_10243956 | Ga0075367_102439562 | 81 |
| 72 | 3300006195 | Ga0075366_10005461 | Ga0075366_100054613 | 81 |
| 73 | 3300009094 | Ga0111539_11882510 | Ga0111539_118825102 | 81 |
| 74 | 3300009147 | Ga0114129_11684597 | Ga0114129_116845972 | 81 |
| 75 | 3300009177 | Ga0105248_12359944 | Ga0105248_123599442 | 81 |
| 76 | 3300013100 | Ga0157373_10991369 | Ga0157373_109913692 | 81 |
| 77 | 3300025297 | Ga0209758_1000251 | Ga0209758_100025114 | 81 |
| 78 | 3300025302 | Ga0207426_1031206 | Ga0207426_10312063 | 81 |
| 79 | 3300025916 | Ga0207663_10317991 | Ga0207663_103179912 | 81 |
| 80 | 3300031247 | Ga0265340_10391574 | Ga0265340_103915742 | 81 |
| 81 | 3300031249 | Ga0265339_10560887 | Ga0265339_105608872 | 81 |
| 82 | 3300031711 | Ga0265314_10017614 | Ga0265314_100176142 | 81 |
| 83 | 3300031901 | Ga0307406_10285464 | Ga0307406_102854642 | 81 |
| 84 | 3300032004 | Ga0307414_10106706 | Ga0307414_101067063 | 81 |
| 85 | 3300035241 | Ga0373961_0162518 | Ga0373961_0162518_131_418 | 81 |
| 86 | 3300041486 | Ga0451807_0706480 | Ga0451807_0706480_47_292 | 81 |
| 87 | 3300042001 | Ga0439441_108094 | Ga0439441_108094_295_546 | 81 |
| 88 | 3300042011 | Ga0439454_051245 | Ga0439454_051245_410_661 | 81 |
| 89 | 3300044901 | Ga0466960_0376935 | Ga0466960_0376935_377_628 | 81 |
| 90 | 3300046519 | Ga0495632_0003225 | Ga0495632_0003225_6154_6399 | 81 |
| 91 | 3300046674 | Ga0495588_0445882 | Ga0495588_0445882_342_587 | 81 |
| 92 | 3300047472 | Ga0495686_0252318 | Ga0495686_0252318_220_465 | 81 |
| 93 | 3300048913 | Ga0496110_1194275 | Ga0496110_1194275_232_477 | 81 |
| 94 | 3300048914 | Ga0496111_0150935 | Ga0496111_0150935_884_1129 | 81 |
| 95 | 3300048919 | Ga0496116_0064701 | Ga0496116_0064701_1202_1447 | 81 |
| 96 | 3300048928 | Ga0496125_0000282 | Ga0496125_0000282_97723_97968 | 81 |
| 97 | 3300049569 | Ga0501032_0022549 | Ga0501032_0022549_3624_3887 | 81 |
| 98 | 3300049570 | Ga0501033_0008967 | Ga0501033_0008967_2065_2328 | 81 |
| 99 | 3300049571 | Ga0501034_0255410 | Ga0501034_0255410_654_917 | 81 |
| 100 | 3300049571 | Ga0501034_0262862 | Ga0501034_0262862_833_1084 | 81 |
| 101 | 3300049572 | Ga0501036_0033397 | Ga0501036_0033397_1440_1703 | 81 |
| 102 | 3300049572 | Ga0501036_0440571 | Ga0501036_0440571_553_807 | 81 |
| 103 | 3300049573 | Ga0501037_0014152 | Ga0501037_0014152_3879_4142 | 81 |
| 104 | 3300049574 | Ga0501038_0020331 | Ga0501038_0020331_1721_1984 | 81 |
| 105 | 3300049574 | Ga0501038_0392985 | Ga0501038_0392985_219_473 | 81 |
| 106 | 3300049577 | Ga0501041_0297230 | Ga0501041_0297230_326_580 | 81 |
| 107 | 3300049578 | Ga0501042_0083688 | Ga0501042_0083688_200_454 | 81 |
| 108 | 3300049579 | Ga0501043_0087832 | Ga0501043_0087832_1395_1658 | 81 |
| 109 | 3300049579 | Ga0501043_0326893 | Ga0501043_0326893_684_932 | 81 |
| 110 | 3300049580 | Ga0501046_0407519 | Ga0501046_0407519_633_887 | 81 |
| 111 | 3300049580 | Ga0501046_0732728 | Ga0501046_0732728_153_416 | 81 |
| 112 | 3300049581 | Ga0501047_0507416 | Ga0501047_0507416_654_917 | 81 |
| 113 | 3300049582 | Ga0501048_0302179 | Ga0501048_0302179_194_448 | 81 |
| 114 | 3300049584 | Ga0501068_0143614 | Ga0501068_0143614_476_730 | 81 |
| 115 | 3300049586 | Ga0501070_0026855 | Ga0501070_0026855_1206_1469 | 81 |
| 116 | 3300049586 | Ga0501070_0608936 | Ga0501070_0608936_611_859 | 81 |
| 117 | 3300049587 | Ga0501071_0005718 | Ga0501071_0005718_5363_5617 | 81 |
| 118 | 3300049588 | Ga0501072_0010471 | Ga0501072_0010471_3320_3574 | 81 |
| 119 | 3300049589 | Ga0501073_0530836 | Ga0501073_0530836_198_452 | 81 |
| 120 | 3300049589 | Ga0501073_0858167 | Ga0501073_0858167_115_378 | 81 |
| 121 | 3300049590 | Ga0501074_0030900 | Ga0501074_0030900_1950_2204 | 81 |
| 122 | 3300049591 | Ga0501075_0004711 | Ga0501075_0004711_4137_4391 | 81 |
| 123 | 3300049592 | Ga0501076_0035062 | Ga0501076_0035062_3583_3837 | 81 |
| 124 | 3300049593 | Ga0501077_0059772 | Ga0501077_0059772_2135_2389 | 81 |
| 125 | 3300049741 | Ga0501079_0046836 | Ga0501079_0046836_411_665 | 81 |
| 126 | 3300049741 | Ga0501079_0529243 | Ga0501079_0529243_470_742 | 81 |
| 127 | 3300049743 | Ga0501081_0127376 | Ga0501081_0127376_757_1011 | 81 |
| 128 | 3300049822 | Ga0501035_0027344 | Ga0501035_0027344_1232_1480 | 81 |
| 129 | 3300049822 | Ga0501035_0085797 | Ga0501035_0085797_786_1049 | 81 |
| 130 | 3300049822 | Ga0501035_0499219 | Ga0501035_0499219_188_451 | 81 |
| 131 | 3300049823 | Ga0501044_0018487 | Ga0501044_0018487_5561_5824 | 81 |
| 132 | 3300049823 | Ga0501044_0044749 | Ga0501044_0044749_885_1133 | 81 |
| 133 | 3300049824 | Ga0501045_0018183 | Ga0501045_0018183_1855_2109 | 81 |
| 134 | 3300050493 | nmdc:mga0k408_26602_c1 | nmdc:mga0k408_26602_c1_1541_1801 | 81 |
| 135 | 3300050516 | nmdc:mga0sz30_511555_c1 | nmdc:mga0sz30_511555_c1_268_519 | 81 |
| 136 | 3300053093 | Ga0500651_0328894 | Ga0500651_0328894_207_455 | 81 |
| 137 | 3300053130 | Ga0500642_0229223 | Ga0500642_0229223_302_553 | 81 |
| 138 | 3300053139 | Ga0500568_0039859 | Ga0500568_0039859_675_926 | 81 |
| 139 | 3300053145 | Ga0500586_272472 | Ga0500586_272472_108_353 | 81 |
| 140 | 3300053153 | Ga0500616_0109020 | Ga0500616_0109020_734_985 | 81 |
| 141 | 3300054114 | Ga0501084_0457801 | Ga0501084_0457801_434_688 | 81 |
| 142 | 3300059424 | Ga0590075_111010 | Ga0590075_111010_374_628 | 81 |
| 143 | 3300060353 | Ga0501082_0057648 | Ga0501082_0057648_2163_2417 | 81 |
| 144 | 3300060353 | Ga0501082_1331741 | Ga0501082_1331741_223_495 | 81 |
| 145 | 3300061734 | Ga0530510_0064349 | Ga0530510_0064349_1860_2114 | 81 |
| 146 | 3300005329 | Ga0070683_102352263 | Ga0070683_1023522632 | 82 |
| 147 | 3300005336 | Ga0070680_101874744 | Ga0070680_1018747441 | 82 |
| 148 | 3300005339 | Ga0070660_100171040 | Ga0070660_1001710403 | 82 |
| 149 | 3300005339 | Ga0070660_101105022 | Ga0070660_1011050222 | 82 |
| 150 | 3300005340 | Ga0070689_100132519 | Ga0070689_1001325192 | 82 |
| 151 | 3300005441 | Ga0070700_100229568 | Ga0070700_1002295681 | 82 |
| 152 | 3300005459 | Ga0068867_100190787 | Ga0068867_1001907872 | 82 |
| 153 | 3300005530 | Ga0070679_101737760 | Ga0070679_1017377602 | 82 |
| 154 | 3300005549 | Ga0070704_100774390 | Ga0070704_1007743902 | 82 |
| 155 | 3300005563 | Ga0068855_100109516 | Ga0068855_1001095162 | 82 |
| 156 | 3300005564 | Ga0070664_101830047 | Ga0070664_1018300472 | 82 |
| 157 | 3300005577 | Ga0068857_100329950 | Ga0068857_1003299502 | 82 |
| 158 | 3300005577 | Ga0068857_101536523 | Ga0068857_1015365232 | 82 |
| 159 | 3300005578 | Ga0068854_100134111 | Ga0068854_1001341112 | 82 |
| 160 | 3300005614 | Ga0068856_101829695 | Ga0068856_1018296952 | 82 |
| 161 | 3300005617 | Ga0068859_100636361 | Ga0068859_1006363612 | 82 |
| 162 | 3300005719 | Ga0068861_100723613 | Ga0068861_1007236132 | 82 |
| 163 | 3300005844 | Ga0068862_100930873 | Ga0068862_1009308731 | 82 |
| 164 | 3300005983 | Ga0081540_1161839 | Ga0081540_11618392 | 82 |
| 165 | 3300005985 | Ga0081539_10181037 | Ga0081539_101810372 | 82 |
| 166 | 3300006237 | Ga0097621_100649154 | Ga0097621_1006491542 | 82 |
| 167 | 3300006931 | Ga0097620_100636467 | Ga0097620_1006364672 | 82 |
| 168 | 3300009093 | Ga0105240_10519814 | Ga0105240_105198142 | 82 |
| 169 | 3300009147 | Ga0114129_10045728 | Ga0114129_100457286 | 82 |
| 170 | 3300009147 | Ga0114129_11023613 | Ga0114129_110236132 | 82 |
| 171 | 3300009174 | Ga0105241_11941110 | Ga0105241_119411102 | 82 |
| 172 | 3300013104 | Ga0157370_10262131 | Ga0157370_102621312 | 82 |
| 173 | 3300013297 | Ga0157378_11068503 | Ga0157378_110685032 | 82 |
| 174 | 3300013307 | Ga0157372_10564395 | Ga0157372_105643952 | 82 |
| 175 | 3300014497 | Ga0182008_10058838 | Ga0182008_100588382 | 82 |
| 176 | 3300014969 | Ga0157376_11750332 | Ga0157376_117503322 | 82 |
| 177 | 3300015262 | Ga0182007_10058694 | Ga0182007_100586942 | 82 |
| 178 | 3300025908 | Ga0207643_10067655 | Ga0207643_100676553 | 82 |
| 179 | 3300025909 | Ga0207705_10724240 | Ga0207705_107242402 | 82 |
| 180 | 3300025921 | Ga0207652_11883961 | Ga0207652_118839611 | 82 |
| 181 | 3300025936 | Ga0207670_10174202 | Ga0207670_101742022 | 82 |
| 182 | 3300025936 | Ga0207670_10603344 | Ga0207670_106033442 | 82 |
| 183 | 3300026067 | Ga0207678_10009958 | Ga0207678_100099586 | 82 |
| 184 | 3300026075 | Ga0207708_10137241 | Ga0207708_101372412 | 82 |
| 185 | 3300026078 | Ga0207702_11582907 | Ga0207702_115829072 | 82 |
| 186 | 3300026089 | Ga0207648_10407107 | Ga0207648_104071072 | 82 |
| 187 | 3300026116 | Ga0207674_10372230 | Ga0207674_103722302 | 82 |
| 188 | 3300026116 | Ga0207674_12045640 | Ga0207674_120456402 | 82 |
| 189 | 3300031548 | Ga0307408_101105023 | Ga0307408_1011050231 | 82 |
| 190 | 3300031595 | Ga0265313_10256165 | Ga0265313_102561652 | 82 |
| 191 | 3300031711 | Ga0265314_10300922 | Ga0265314_103009222 | 82 |
| 192 | 3300032002 | Ga0307416_103263642 | Ga0307416_1032636422 | 82 |
| 193 | 3300036401 | Ga0373937_0705245 | Ga0373937_0705245_92_346 | 82 |
| 194 | 3300037068 | Ga0373925_0649790 | Ga0373925_0649790_251_505 | 82 |
| 195 | 3300041408 | Ga0439453_0155854 | Ga0439453_0155854_145_432 | 82 |
| 196 | 3300046536 | Ga0495587_0841355 | Ga0495587_0841355_156_410 | 82 |
| 197 | 3300046537 | Ga0495598_0069656 | Ga0495598_0069656_360_614 | 82 |
| 198 | 3300048908 | Ga0496105_0089474 | Ga0496105_0089474_1490_1744 | 82 |
| 199 | 3300048912 | Ga0496109_1175757 | Ga0496109_1175757_253_507 | 82 |
| 200 | 3300048913 | Ga0496110_1206768 | Ga0496110_1206768_175_429 | 82 |
| 201 | 3300048914 | Ga0496111_0197082 | Ga0496111_0197082_156_410 | 82 |
| 202 | 3300048914 | Ga0496111_1012095 | Ga0496111_1012095_185_439 | 82 |
| 203 | 3300048916 | Ga0496113_1034548 | Ga0496113_1034548_195_443 | 82 |
| 204 | 3300048917 | Ga0496114_0065824 | Ga0496114_0065824_2107_2361 | 82 |
| 205 | 3300048918 | Ga0496115_0031869 | Ga0496115_0031869_1877_2131 | 82 |
| 206 | 3300048918 | Ga0496115_0305513 | Ga0496115_0305513_799_1053 | 82 |
| 207 | 3300048928 | Ga0496125_0360107 | Ga0496125_0360107_336_584 | 82 |
| 208 | 3300049568 | Ga0501031_0056956 | Ga0501031_0056956_1597_1848 | 82 |
| 209 | 3300049569 | Ga0501032_0005814 | Ga0501032_0005814_2017_2316 | 82 |
| 210 | 3300049569 | Ga0501032_0080309 | Ga0501032_0080309_1875_2126 | 82 |
| 211 | 3300049569 | Ga0501032_0583771 | Ga0501032_0583771_109_360 | 82 |
| 212 | 3300049570 | Ga0501033_0003939 | Ga0501033_0003939_7972_8223 | 82 |
| 213 | 3300049570 | Ga0501033_0012798 | Ga0501033_0012798_1512_1811 | 82 |
| 214 | 3300049570 | Ga0501033_0105529 | Ga0501033_0105529_614_865 | 82 |
| 215 | 3300049571 | Ga0501034_0017011 | Ga0501034_0017011_6105_6404 | 82 |
| 216 | 3300049571 | Ga0501034_0235966 | Ga0501034_0235966_1302_1553 | 82 |
| 217 | 3300049571 | Ga0501034_0274917 | Ga0501034_0274917_440_691 | 82 |
| 218 | 3300049571 | Ga0501034_0365764 | Ga0501034_0365764_726_977 | 82 |
| 219 | 3300049572 | Ga0501036_0008301 | Ga0501036_0008301_5772_6071 | 82 |
| 220 | 3300049572 | Ga0501036_0036040 | Ga0501036_0036040_3485_3736 | 82 |
| 221 | 3300049572 | Ga0501036_0936996 | Ga0501036_0936996_313_564 | 82 |
| 222 | 3300049573 | Ga0501037_0010290 | Ga0501037_0010290_5515_5814 | 82 |
| 223 | 3300049573 | Ga0501037_0035288 | Ga0501037_0035288_3170_3421 | 82 |
| 224 | 3300049573 | Ga0501037_0047155 | Ga0501037_0047155_1210_1461 | 82 |
| 225 | 3300049574 | Ga0501038_0015032 | Ga0501038_0015032_5295_5594 | 82 |
| 226 | 3300049574 | Ga0501038_0051388 | Ga0501038_0051388_1523_1774 | 82 |
| 227 | 3300049575 | Ga0501039_0001301 | Ga0501039_0001301_7502_7801 | 82 |
| 228 | 3300049575 | Ga0501039_0308118 | Ga0501039_0308118_67_318 | 82 |
| 229 | 3300049578 | Ga0501042_0141123 | Ga0501042_0141123_714_1013 | 82 |
| 230 | 3300049579 | Ga0501043_0002203 | Ga0501043_0002203_5730_6029 | 82 |
| 231 | 3300049579 | Ga0501043_0041913 | Ga0501043_0041913_802_1053 | 82 |
| 232 | 3300049580 | Ga0501046_0012154 | Ga0501046_0012154_2056_2355 | 82 |
| 233 | 3300049580 | Ga0501046_0436931 | Ga0501046_0436931_681_932 | 82 |
| 234 | 3300049581 | Ga0501047_0005496 | Ga0501047_0005496_11105_11356 | 82 |
| 235 | 3300049581 | Ga0501047_0016792 | Ga0501047_0016792_5772_6071 | 82 |
| 236 | 3300049581 | Ga0501047_0135752 | Ga0501047_0135752_1660_1911 | 82 |
| 237 | 3300049581 | Ga0501047_0526369 | Ga0501047_0526369_32_283 | 82 |
| 238 | 3300049582 | Ga0501048_0000886 | Ga0501048_0000886_10885_11184 | 82 |
| 239 | 3300049582 | Ga0501048_0251496 | Ga0501048_0251496_444_695 | 82 |
| 240 | 3300049583 | Ga0501067_0033707 | Ga0501067_0033707_1744_2043 | 82 |
| 241 | 3300049584 | Ga0501068_0012080 | Ga0501068_0012080_3138_3437 | 82 |
| 242 | 3300049584 | Ga0501068_0034753 | Ga0501068_0034753_610_861 | 82 |
| 243 | 3300049584 | Ga0501068_0838650 | Ga0501068_0838650_201_455 | 82 |
| 244 | 3300049584 | Ga0501068_1208047 | Ga0501068_1208047_196_447 | 82 |
| 245 | 3300049585 | Ga0501069_0000437 | Ga0501069_0000437_10885_11184 | 82 |
| 246 | 3300049585 | Ga0501069_0088479 | Ga0501069_0088479_239_490 | 82 |
| 247 | 3300049585 | Ga0501069_0364034 | Ga0501069_0364034_16_267 | 82 |
| 248 | 3300049586 | Ga0501070_0002038 | Ga0501070_0002038_12193_12444 | 82 |
| 249 | 3300049586 | Ga0501070_0011845 | Ga0501070_0011845_6012_6311 | 82 |
| 250 | 3300049586 | Ga0501070_0122036 | Ga0501070_0122036_861_1112 | 82 |
| 251 | 3300049586 | Ga0501070_0399194 | Ga0501070_0399194_541_792 | 82 |
| 252 | 3300049587 | Ga0501071_0096456 | Ga0501071_0096456_775_1074 | 82 |
| 253 | 3300049587 | Ga0501071_1061781 | Ga0501071_1061781_113_364 | 82 |
| 254 | 3300049589 | Ga0501073_0006839 | Ga0501073_0006839_2017_2316 | 82 |
| 255 | 3300049589 | Ga0501073_0016521 | Ga0501073_0016521_1969_2220 | 82 |
| 256 | 3300049589 | Ga0501073_0832642 | Ga0501073_0832642_175_426 | 82 |
| 257 | 3300049590 | Ga0501074_0003168 | Ga0501074_0003168_10732_11031 | 82 |
| 258 | 3300049590 | Ga0501074_0028988 | Ga0501074_0028988_345_596 | 82 |
| 259 | 3300049592 | Ga0501076_0084946 | Ga0501076_0084946_826_1125 | 82 |
| 260 | 3300049741 | Ga0501079_0009707 | Ga0501079_0009707_4716_5015 | 82 |
| 261 | 3300049742 | Ga0501080_0010101 | Ga0501080_0010101_5642_5941 | 82 |
| 262 | 3300049742 | Ga0501080_0040450 | Ga0501080_0040450_1326_1577 | 82 |
| 263 | 3300049742 | Ga0501080_0060516 | Ga0501080_0060516_2419_2670 | 82 |
| 264 | 3300049742 | Ga0501080_0492287 | Ga0501080_0492287_516_767 | 82 |
| 265 | 3300049744 | Ga0501083_0011452 | Ga0501083_0011452_5550_5849 | 82 |
| 266 | 3300049744 | Ga0501083_0153165 | Ga0501083_0153165_227_478 | 82 |
| 267 | 3300049822 | Ga0501035_0001764 | Ga0501035_0001764_12141_12392 | 82 |
| 268 | 3300049822 | Ga0501035_0004712 | Ga0501035_0004712_4694_4945 | 82 |
| 269 | 3300049822 | Ga0501035_0016845 | Ga0501035_0016845_924_1223 | 82 |
| 270 | 3300049823 | Ga0501044_0010691 | Ga0501044_0010691_4037_4288 | 82 |
| 271 | 3300049823 | Ga0501044_0025958 | Ga0501044_0025958_924_1223 | 82 |
| 272 | 3300049823 | Ga0501044_0110800 | Ga0501044_0110800_357_608 | 82 |
| 273 | 3300050507 | nmdc:mga05p37_1492059_c1 | nmdc:mga05p37_1492059_c1_285_539 | 82 |
| 274 | 3300050507 | nmdc:mga05p37_334227_c1 | nmdc:mga05p37_334227_c1_814_1068 | 82 |
| 275 | 3300050514 | nmdc:mga08x19_1012080_c1 | nmdc:mga08x19_1012080_c1_96_350 | 82 |
| 276 | 3300053084 | Ga0495595_0321732 | Ga0495595_0321732_77_331 | 82 |
| 277 | 3300053085 | Ga0495619_0465601 | Ga0495619_0465601_433_687 | 82 |
| 278 | 3300054114 | Ga0501084_0018001 | Ga0501084_0018001_1690_1989 | 82 |
| 279 | 3300060353 | Ga0501082_0029163 | Ga0501082_0029163_2338_2637 | 82 |
| 280 | 3300060353 | Ga0501082_0227049 | Ga0501082_0227049_711_962 | 82 |
| 281 | 3300005330 | Ga0070690_100353756 | Ga0070690_1003537562 | 83 |
| 282 | 3300005333 | Ga0070677_10222450 | Ga0070677_102224501 | 83 |
| 283 | 3300005340 | Ga0070689_100418910 | Ga0070689_1004189101 | 83 |
| 284 | 3300005347 | Ga0070668_100110155 | Ga0070668_1001101553 | 83 |
| 285 | 3300005354 | Ga0070675_100372984 | Ga0070675_1003729842 | 83 |
| 286 | 3300005355 | Ga0070671_100923777 | Ga0070671_1009237772 | 83 |
| 287 | 3300005356 | Ga0070674_100106760 | Ga0070674_1001067602 | 83 |
| 288 | 3300005365 | Ga0070688_100196206 | Ga0070688_1001962062 | 83 |
| 289 | 3300005441 | Ga0070700_100879773 | Ga0070700_1008797731 | 83 |
| 290 | 3300005456 | Ga0070678_102311431 | Ga0070678_1023114311 | 83 |
| 291 | 3300005457 | Ga0070662_101043268 | Ga0070662_1010432681 | 83 |
| 292 | 3300005543 | Ga0070672_100651401 | Ga0070672_1006514012 | 83 |
| 293 | 3300005544 | Ga0070686_101131385 | Ga0070686_1011313852 | 83 |
| 294 | 3300005615 | Ga0070702_100358261 | Ga0070702_1003582612 | 83 |
| 295 | 3300005618 | Ga0068864_101185269 | Ga0068864_1011852692 | 83 |
| 296 | 3300005718 | Ga0068866_10194266 | Ga0068866_101942662 | 83 |
| 297 | 3300005834 | Ga0068851_10521056 | Ga0068851_105210562 | 83 |
| 298 | 3300006058 | Ga0075432_10028305 | Ga0075432_100283051 | 83 |
| 299 | 3300006194 | Ga0075427_10003863 | Ga0075427_100038633 | 83 |
| 300 | 3300006237 | Ga0097621_100840131 | Ga0097621_1008401312 | 83 |
| 301 | 3300006237 | Ga0097621_101781068 | Ga0097621_1017810682 | 83 |
| 302 | 3300006358 | Ga0068871_101419230 | Ga0068871_1014192302 | 83 |
| 303 | 3300006844 | Ga0075428_100002521 | Ga0075428_1000025213 | 83 |
| 304 | 3300006846 | Ga0075430_100000128 | Ga0075430_1000001289 | 83 |
| 305 | 3300006847 | Ga0075431_100018884 | Ga0075431_1000188845 | 83 |
| 306 | 3300006852 | Ga0075433_10000103 | Ga0075433_1000010337 | 83 |
| 307 | 3300006871 | Ga0075434_100014461 | Ga0075434_1000144613 | 83 |
| 308 | 3300006871 | Ga0075434_100022954 | Ga0075434_1000229544 | 83 |
| 309 | 3300006880 | Ga0075429_100000381 | Ga0075429_1000003818 | 83 |
| 310 | 3300006880 | Ga0075429_100812865 | Ga0075429_1008128651 | 83 |
| 311 | 3300006881 | Ga0068865_101632313 | Ga0068865_1016323132 | 83 |
| 312 | 3300006881 | Ga0068865_101712111 | Ga0068865_1017121112 | 83 |
| 313 | 3300006914 | Ga0075436_100477998 | Ga0075436_1004779981 | 83 |
| 314 | 3300007076 | Ga0075435_100006161 | Ga0075435_1000061617 | 83 |
| 315 | 3300007076 | Ga0075435_100011373 | Ga0075435_1000113735 | 83 |
| 316 | 3300009094 | Ga0111539_10000787 | Ga0111539_1000078726 | 83 |
| 317 | 3300009094 | Ga0111539_13457124 | Ga0111539_134571242 | 83 |
| 318 | 3300011119 | Ga0105246_10130138 | Ga0105246_101301382 | 83 |
| 319 | 3300013306 | Ga0163162_10476111 | Ga0163162_104761112 | 83 |
| 320 | 3300025893 | Ga0207682_10173496 | Ga0207682_101734962 | 83 |
| 321 | 3300025899 | Ga0207642_10465215 | Ga0207642_104652152 | 83 |
| 322 | 3300025903 | Ga0207680_10638948 | Ga0207680_106389482 | 83 |
| 323 | 3300025918 | Ga0207662_10588867 | Ga0207662_105888672 | 83 |
| 324 | 3300025926 | Ga0207659_10345391 | Ga0207659_103453912 | 83 |
| 325 | 3300025926 | Ga0207659_10553011 | Ga0207659_105530112 | 83 |
| 326 | 3300025931 | Ga0207644_10829296 | Ga0207644_108292962 | 83 |
| 327 | 3300025933 | Ga0207706_10456056 | Ga0207706_104560562 | 83 |
| 328 | 3300025937 | Ga0207669_10061980 | Ga0207669_100619803 | 83 |
| 329 | 3300025940 | Ga0207691_10608380 | Ga0207691_106083802 | 83 |
| 330 | 3300025945 | Ga0207679_11214043 | Ga0207679_112140432 | 83 |
| 331 | 3300025972 | Ga0207668_10116212 | Ga0207668_101162123 | 83 |
| 332 | 3300026023 | Ga0207677_10385858 | Ga0207677_103858582 | 83 |
| 333 | 3300026067 | Ga0207678_10348036 | Ga0207678_103480362 | 83 |
| 334 | 3300026075 | Ga0207708_10583907 | Ga0207708_105839072 | 83 |
| 335 | 3300026089 | Ga0207648_11456304 | Ga0207648_114563042 | 83 |
| 336 | 3300026121 | Ga0207683_10274075 | Ga0207683_102740751 | 83 |
| 337 | 3300027671 | Ga0209588_1104131 | Ga0209588_11041312 | 83 |
| 338 | 3300027907 | Ga0207428_10000058 | Ga0207428_1000005849 | 83 |
| 339 | 3300032133 | Ga0316583_10321810 | Ga0316583_103218102 | 83 |
| 340 | 3300048903 | Ga0496100_0520869 | Ga0496100_0520869_289_546 | 83 |
| 341 | 3300048911 | Ga0496108_0440528 | Ga0496108_0440528_619_876 | 83 |
| 342 | 3300048912 | Ga0496109_0439229 | Ga0496109_0439229_660_917 | 83 |
| 343 | 3300048913 | Ga0496110_0927345 | Ga0496110_0927345_277_558 | 83 |
| 344 | 3300048917 | Ga0496114_1287127 | Ga0496114_1287127_17_298 | 83 |
| 345 | 3300049579 | Ga0501043_1176741 | Ga0501043_1176741_136_387 | 83 |
| 346 | 3300049589 | Ga0501073_0007850 | Ga0501073_0007850_4376_4633 | 83 |
| 347 | 3300049593 | Ga0501077_0475960 | Ga0501077_0475960_50_301 | 83 |
| 348 | 3300049744 | Ga0501083_0194569 | Ga0501083_0194569_556_813 | 83 |
| 349 | 3300050492 | nmdc:mga0yw44_485620_c1 | nmdc:mga0yw44_485620_c1_570_827 | 83 |
| 350 | 3300050507 | nmdc:mga05p37_35_c1 | nmdc:mga05p37_35_c1_69847_70098 | 83 |
| 351 | 3300050507 | nmdc:mga05p37_6170_c1 | nmdc:mga05p37_6170_c1_8580_8831 | 83 |
| 352 | 3300050508 | nmdc:mga09592_163_c1 | nmdc:mga09592_163_c1_17536_17787 | 83 |
| 353 | 3300050509 | nmdc:mga0qj67_143_c1 | nmdc:mga0qj67_143_c1_17535_17786 | 83 |
| 354 | 3300050510 | nmdc:mga06r32_936_c1 | nmdc:mga06r32_936_c1_15823_16074 | 83 |
| 355 | 3300050511 | nmdc:mga08y16_2671_c1 | nmdc:mga08y16_2671_c1_16647_16898 | 83 |
| 356 | 3300050512 | nmdc:mga0n895_33593_c1 | nmdc:mga0n895_33593_c1_3252_3503 | 83 |
| 357 | 3300050513 | nmdc:mga0rr50_1301_c1 | nmdc:mga0rr50_1301_c1_7629_7880 | 83 |
| 358 | 3300050513 | nmdc:mga0rr50_3039_c1 | nmdc:mga0rr50_3039_c1_5037_5288 | 83 |
| 359 | 3300050514 | nmdc:mga08x19_437774_c1 | nmdc:mga08x19_437774_c1_137_388 | 83 |
| 360 | 3300050515 | nmdc:mga0a205_2132_c1 | nmdc:mga0a205_2132_c1_16472_16723 | 83 |
| 361 | 3300050515 | nmdc:mga0a205_38040_c1 | nmdc:mga0a205_38040_c1_3060_3311 | 83 |
| 362 | 3300027717 | Ga0209998_10075583 | Ga0209998_100755831 | 84 |
| 363 | 3300027876 | Ga0209974_10024452 | Ga0209974_100244523 | 84 |
| 364 | 3300031711 | Ga0265314_10186209 | Ga0265314_101862092 | 84 |
| 365 | 3300049569 | Ga0501032_0128223 | Ga0501032_0128223_1067_1339 | 84 |
| 366 | 3300049571 | Ga0501034_0161102 | Ga0501034_0161102_1711_1983 | 84 |
| 367 | 3300049571 | Ga0501034_0281175 | Ga0501034_0281175_259_531 | 84 |
| 368 | 3300049572 | Ga0501036_0456638 | Ga0501036_0456638_498_770 | 84 |
| 369 | 3300049575 | Ga0501039_0753831 | Ga0501039_0753831_341_613 | 84 |
| 370 | 3300049579 | Ga0501043_0379603 | Ga0501043_0379603_218_490 | 84 |
| 371 | 3300049581 | Ga0501047_0159507 | Ga0501047_0159507_1258_1530 | 84 |
| 372 | 3300049589 | Ga0501073_0028970 | Ga0501073_0028970_2612_2884 | 84 |
| 373 | 3300049589 | Ga0501073_0455653 | Ga0501073_0455653_84_356 | 84 |
| 374 | 3300049822 | Ga0501035_1408471 | Ga0501035_1408471_43_315 | 84 |
| 375 | 2162886007 | SwRhRL2b_contig_1015587 | SwRhRL2b_0059.00001500 | 85 |
| 376 | 2209111006 | 2214767426 | 2213785232 | 85 |
| 377 | 3300000041 | ARcpr5oldR_c000253 | ARcpr5oldR_00025310 | 85 |
| 378 | 3300000042 | ARSoilYngRDRAFT_c00281 | ARSoilYngRDRAFT_002812 | 85 |
| 379 | 3300000043 | ARcpr5yngRDRAFT_c002660 | ARcpr5yngRDRAFT_0026603 | 85 |
| 380 | 3300000044 | ARSoilOldRDRAFT_c000231 | ARSoilOldRDRAFT_00023110 | 85 |
| 381 | 3300000045 | ARCol0oldRDRAFT_c00994 | ARCol0oldRDRAFT_009942 | 85 |
| 382 | 3300000652 | ARCol0yngRDRAFT_1000260 | ARCol0yngRDRAFT_10002602 | 85 |
| 383 | 3300001990 | JGI24737J22298_10020391 | JGI24737J22298_100203913 | 85 |
| 384 | 3300002070 | JGI24750J21931_1004571 | JGI24750J21931_10045713 | 85 |
| 385 | 3300002126 | JGI24035J26624_1001130 | JGI24035J26624_10011302 | 85 |
| 386 | 3300002239 | JGI24034J26672_10029907 | JGI24034J26672_100299071 | 85 |
| 387 | 3300002459 | JGI24751J29686_10073052 | JGI24751J29686_100730522 | 85 |
| 388 | 3300003503 | JGI26141J51220_1016149 | JGI26141J51220_10161492 | 85 |
| 389 | 3300003911 | JGI25405J52794_10051040 | JGI25405J52794_100510402 | 85 |
| 390 | 3300005276 | Ga0065717_1002397 | Ga0065717_10023972 | 85 |
| 391 | 3300005277 | Ga0065716_1001908 | Ga0065716_10019082 | 85 |
| 392 | 3300005288 | Ga0065714_10369378 | Ga0065714_103693782 | 85 |
| 393 | 3300005289 | Ga0065704_10109412 | Ga0065704_101094122 | 85 |
| 394 | 3300005290 | Ga0065712_10078300 | Ga0065712_100783002 | 85 |
| 395 | 3300005293 | Ga0065715_10001249 | Ga0065715_1000124913 | 85 |
| 396 | 3300005295 | Ga0065707_10126362 | Ga0065707_101263622 | 85 |
| 397 | 3300005335 | Ga0070666_10499724 | Ga0070666_104997242 | 85 |
| 398 | 3300005340 | Ga0070689_100005511 | Ga0070689_1000055113 | 85 |
| 399 | 3300005341 | Ga0070691_10738551 | Ga0070691_107385511 | 85 |
| 400 | 3300005436 | Ga0070713_100803507 | Ga0070713_1008035071 | 85 |
| 401 | 3300005437 | Ga0070710_10723997 | Ga0070710_107239972 | 85 |
| 402 | 3300005437 | Ga0070710_11139953 | Ga0070710_111399531 | 85 |
| 403 | 3300005439 | Ga0070711_100645935 | Ga0070711_1006459352 | 85 |
| 404 | 3300005444 | Ga0070694_100259073 | Ga0070694_1002590731 | 85 |
| 405 | 3300005445 | Ga0070708_100032775 | Ga0070708_1000327756 | 85 |
| 406 | 3300005455 | Ga0070663_101606501 | Ga0070663_1016065011 | 85 |
| 407 | 3300005458 | Ga0070681_10737194 | Ga0070681_107371942 | 85 |
| 408 | 3300005459 | Ga0068867_100312173 | Ga0068867_1003121732 | 85 |
| 409 | 3300005466 | Ga0070685_10083256 | Ga0070685_100832563 | 85 |
| 410 | 3300005507 | Ga0074259_11049951 | Ga0074259_110499512 | 85 |
| 411 | 3300005530 | Ga0070679_100160756 | Ga0070679_1001607562 | 85 |
| 412 | 3300005530 | Ga0070679_100219484 | Ga0070679_1002194841 | 85 |
| 413 | 3300005530 | Ga0070679_100755994 | Ga0070679_1007559942 | 85 |
| 414 | 3300005539 | Ga0068853_100088489 | Ga0068853_1000884893 | 85 |
| 415 | 3300005617 | Ga0068859_100026561 | Ga0068859_1000265613 | 85 |
| 416 | 3300005842 | Ga0068858_100017088 | Ga0068858_1000170883 | 85 |
| 417 | 3300005937 | Ga0081455_10000110 | Ga0081455_1000011071 | 85 |
| 418 | 3300006058 | Ga0075432_10201207 | Ga0075432_102012072 | 85 |
| 419 | 3300006175 | Ga0070712_100086102 | Ga0070712_1000861023 | 85 |
| 420 | 3300006852 | Ga0075433_10259258 | Ga0075433_102592583 | 85 |
| 421 | 3300006871 | Ga0075434_100794325 | Ga0075434_1007943252 | 85 |
| 422 | 3300006931 | Ga0097620_100026564 | Ga0097620_1000265643 | 85 |
| 423 | 3300009094 | Ga0111539_10002989 | Ga0111539_1000298911 | 85 |
| 424 | 3300009094 | Ga0111539_11186417 | Ga0111539_111864172 | 85 |
| 425 | 3300009147 | Ga0114129_10018046 | Ga0114129_100180462 | 85 |
| 426 | 3300009148 | Ga0105243_10001716 | Ga0105243_100017168 | 85 |
| 427 | 3300009174 | Ga0105241_10151490 | Ga0105241_101514903 | 85 |
| 428 | 3300009177 | Ga0105248_10393153 | Ga0105248_103931532 | 85 |
| 429 | 3300009545 | Ga0105237_10661721 | Ga0105237_106617211 | 85 |
| 430 | 3300009553 | Ga0105249_10064225 | Ga0105249_100642254 | 85 |
| 431 | 3300010375 | Ga0105239_10022754 | Ga0105239_100227546 | 85 |
| 432 | 3300012488 | Ga0157343_1000395 | Ga0157343_10003951 | 85 |
| 433 | 3300012490 | Ga0157322_1000394 | Ga0157322_10003943 | 85 |
| 434 | 3300012491 | Ga0157329_1006681 | Ga0157329_10066812 | 85 |
| 435 | 3300012494 | Ga0157341_1000469 | Ga0157341_10004693 | 85 |
| 436 | 3300012495 | Ga0157323_1002712 | Ga0157323_10027122 | 85 |
| 437 | 3300012515 | Ga0157338_1000826 | Ga0157338_10008262 | 85 |
| 438 | 3300013102 | Ga0157371_10012581 | Ga0157371_100125813 | 85 |
| 439 | 3300013296 | Ga0157374_10162264 | Ga0157374_101622643 | 85 |
| 440 | 3300013306 | Ga0163162_10064822 | Ga0163162_100648224 | 85 |
| 441 | 3300013308 | Ga0157375_10035488 | Ga0157375_100354884 | 85 |
| 442 | 3300014326 | Ga0157380_10206239 | Ga0157380_102062393 | 85 |
| 443 | 3300014968 | Ga0157379_10134584 | Ga0157379_101345843 | 85 |
| 444 | 3300014968 | Ga0157379_11906609 | Ga0157379_119066091 | 85 |
| 445 | 3300025315 | Ga0207697_10022213 | Ga0207697_100222133 | 85 |
| 446 | 3300025899 | Ga0207642_10130969 | Ga0207642_101309692 | 85 |
| 447 | 3300025900 | Ga0207710_10254166 | Ga0207710_102541662 | 85 |
| 448 | 3300025901 | Ga0207688_10147917 | Ga0207688_101479171 | 85 |
| 449 | 3300025903 | Ga0207680_10366719 | Ga0207680_103667192 | 85 |
| 450 | 3300025904 | Ga0207647_10017565 | Ga0207647_100175652 | 85 |
| 451 | 3300025911 | Ga0207654_10142866 | Ga0207654_101428663 | 85 |
| 452 | 3300025914 | Ga0207671_10401647 | Ga0207671_104016471 | 85 |
| 453 | 3300025915 | Ga0207693_10156646 | Ga0207693_101566461 | 85 |
| 454 | 3300025916 | Ga0207663_10489512 | Ga0207663_104895122 | 85 |
| 455 | 3300025917 | Ga0207660_10140596 | Ga0207660_101405962 | 85 |
| 456 | 3300025917 | Ga0207660_10515773 | Ga0207660_105157732 | 85 |
| 457 | 3300025917 | Ga0207660_10553604 | Ga0207660_105536042 | 85 |
| 458 | 3300025919 | Ga0207657_10028997 | Ga0207657_100289974 | 85 |
| 459 | 3300025921 | Ga0207652_10116402 | Ga0207652_101164023 | 85 |
| 460 | 3300025921 | Ga0207652_10539149 | Ga0207652_105391492 | 85 |
| 461 | 3300025921 | Ga0207652_10576024 | Ga0207652_105760242 | 85 |
| 462 | 3300025923 | Ga0207681_10278335 | Ga0207681_102783352 | 85 |
| 463 | 3300025928 | Ga0207700_10919898 | Ga0207700_109198981 | 85 |
| 464 | 3300025932 | Ga0207690_10060890 | Ga0207690_100608903 | 85 |
| 465 | 3300025933 | Ga0207706_10034755 | Ga0207706_100347553 | 85 |
| 466 | 3300025936 | Ga0207670_10212125 | Ga0207670_102121252 | 85 |
| 467 | 3300025938 | Ga0207704_11960263 | Ga0207704_119602632 | 85 |
| 468 | 3300025940 | Ga0207691_10083746 | Ga0207691_100837464 | 85 |
| 469 | 3300025941 | Ga0207711_11344942 | Ga0207711_113449422 | 85 |
| 470 | 3300025944 | Ga0207661_10382489 | Ga0207661_103824892 | 85 |
| 471 | 3300025961 | Ga0207712_10606258 | Ga0207712_106062582 | 85 |
| 472 | 3300025972 | Ga0207668_10200609 | Ga0207668_102006091 | 85 |
| 473 | 3300025972 | Ga0207668_11289945 | Ga0207668_112899452 | 85 |
| 474 | 3300026035 | Ga0207703_10041007 | Ga0207703_100410073 | 85 |
| 475 | 3300026041 | Ga0207639_10020651 | Ga0207639_100206513 | 85 |
| 476 | 3300026067 | Ga0207678_11599693 | Ga0207678_115996932 | 85 |
| 477 | 3300026075 | Ga0207708_10035615 | Ga0207708_100356154 | 85 |
| 478 | 3300026118 | Ga0207675_100121622 | Ga0207675_1001216222 | 85 |
| 479 | 3300026142 | Ga0207698_11750292 | Ga0207698_117502922 | 85 |
| 480 | 3300027395 | Ga0209996_1014313 | Ga0209996_10143132 | 85 |
| 481 | 3300027462 | Ga0210000_1008868 | Ga0210000_10088682 | 85 |
| 482 | 3300027682 | Ga0209971_1004899 | Ga0209971_10048994 | 85 |
| 483 | 3300027695 | Ga0209966_1015359 | Ga0209966_10153593 | 85 |
| 484 | 3300027695 | Ga0209966_1116157 | Ga0209966_11161572 | 85 |
| 485 | 3300027717 | Ga0209998_10005564 | Ga0209998_100055643 | 85 |
| 486 | 3300027876 | Ga0209974_10012884 | Ga0209974_100128841 | 85 |
| 487 | 3300027876 | Ga0209974_10091804 | Ga0209974_100918042 | 85 |
| 488 | 3300027907 | Ga0207428_10001877 | Ga0207428_1000187710 | 85 |
| 489 | 3300027907 | Ga0207428_10576386 | Ga0207428_105763861 | 85 |
| 490 | 3300028379 | Ga0268266_11034283 | Ga0268266_110342832 | 85 |
| 491 | 3300028380 | Ga0268265_10076997 | Ga0268265_100769974 | 85 |
| 492 | 3300028381 | Ga0268264_10063477 | Ga0268264_100634772 | 85 |
| 493 | 3300031691 | Ga0316579_10002736 | Ga0316579_100027364 | 85 |
| 494 | 3300034816 | Ga0373930_0000227 | Ga0373930_0000227_1493_1750 | 85 |
| 495 | 3300034817 | Ga0373948_0021808 | Ga0373948_0021808_381_638 | 85 |
| 496 | 3300034818 | Ga0373950_0000785 | Ga0373950_0000785_3571_3828 | 85 |
| 497 | 3300034820 | Ga0373959_0000278 | Ga0373959_0000278_6458_6715 | 85 |
| 498 | 3300034957 | Ga0373938_0000185 | Ga0373938_0000185_4760_5017 | 85 |
| 499 | 3300035084 | Ga0373928_0000509 | Ga0373928_0000509_4713_4970 | 85 |
| 500 | 3300035085 | Ga0373929_0000347 | Ga0373929_0000347_6333_6590 | 85 |
| 501 | 3300035086 | Ga0373934_0033195 | Ga0373934_0033195_999_1256 | 85 |
| 502 | 3300035088 | Ga0373940_0000033 | Ga0373940_0000033_10225_10482 | 85 |
| 503 | 3300035090 | Ga0373949_0007020 | Ga0373949_0007020_1686_1943 | 85 |
| 504 | 3300035091 | Ga0373951_0002035 | Ga0373951_0002035_1336_1593 | 85 |
| 505 | 3300035092 | Ga0373952_0000067 | Ga0373952_0000067_6816_7073 | 85 |
| 506 | 3300035112 | Ga0373932_0011835 | Ga0373932_0011835_196_453 | 85 |
| 507 | 3300035114 | Ga0373939_0005595 | Ga0373939_0005595_2146_2403 | 85 |
| 508 | 3300035115 | Ga0373941_0000055 | Ga0373941_0000055_7365_7622 | 85 |
| 509 | 3300035117 | Ga0373953_0139227 | Ga0373953_0139227_705_962 | 85 |
| 510 | 3300035118 | Ga0373954_0034924 | Ga0373954_0034924_533_790 | 85 |
| 511 | 3300035120 | Ga0373957_0013363 | Ga0373957_0013363_688_945 | 85 |
| 512 | 3300035121 | Ga0373960_0000621 | Ga0373960_0000621_3724_3981 | 85 |
| 513 | 3300035170 | Ga0373943_0962013 | Ga0373943_0962013_225_482 | 85 |
| 514 | 3300035172 | Ga0373955_0008944 | Ga0373955_0008944_3681_3938 | 85 |
| 515 | 3300035207 | Ga0373942_0000604 | Ga0373942_0000604_2669_2926 | 85 |
| 516 | 3300035241 | Ga0373961_0006501 | Ga0373961_0006501_1052_1309 | 85 |
| 517 | 3300035410 | Ga0373924_0275174 | Ga0373924_0275174_474_731 | 85 |
| 518 | 3300035692 | Ga0373935_0146333 | Ga0373935_0146333_1031_1288 | 85 |
| 519 | 3300035724 | Ga0373933_0053701 | Ga0373933_0053701_330_587 | 85 |
| 520 | 3300035725 | Ga0373947_0058636 | Ga0373947_0058636_1159_1416 | 85 |
| 521 | 3300036401 | Ga0373937_0051826 | Ga0373937_0051826_830_1087 | 85 |
| 522 | 3300037068 | Ga0373925_0008196 | Ga0373925_0008196_5580_5837 | 85 |
| 523 | 3300038698 | Ga0242419_012888 | Ga0242419_012888_106_363 | 85 |
| 524 | 3300038996 | Ga0242420_046149 | Ga0242420_046149_234_491 | 85 |
| 525 | 3300042008 | Ga0439450_026365 | Ga0439450_026365_201_458 | 85 |
| 526 | 3300042016 | Ga0439463_064797 | Ga0439463_064797_596_853 | 85 |
| 527 | 3300042157 | Ga0439458_0030570 | Ga0439458_0030570_299_556 | 85 |
| 528 | 3300042436 | Ga0439435_0278045 | Ga0439435_0278045_15_272 | 85 |
| 529 | 3300042439 | Ga0439464_0106588 | Ga0439464_0106588_468_725 | 85 |
| 530 | 3300042461 | Ga0439460_0119991 | Ga0439460_0119991_450_707 | 85 |
| 531 | 3300042993 | Ga0439440_0139702 | Ga0439440_0139702_378_635 | 85 |
| 532 | 3300044673 | Ga0453683_1148553 | Ga0453683_1148553_34_291 | 85 |
| 533 | 3300044712 | Ga0453684_0205388 | Ga0453684_0205388_601_858 | 85 |
| 534 | 3300045051 | Ga0451576_0178747 | Ga0451576_0178747_1318_1575 | 85 |
| 535 | 3300046454 | Ga0495592_0004712 | Ga0495592_0004712_3853_4110 | 85 |
| 536 | 3300046461 | Ga0495641_0042436 | Ga0495641_0042436_99_356 | 85 |
| 537 | 3300046462 | Ga0495651_0272279 | Ga0495651_0272279_313_570 | 85 |
| 538 | 3300046463 | Ga0495653_0154010 | Ga0495653_0154010_233_490 | 85 |
| 539 | 3300046477 | Ga0495664_0148765 | Ga0495664_0148765_642_899 | 85 |
| 540 | 3300046516 | Ga0495628_0005498 | Ga0495628_0005498_9191_9448 | 85 |
| 541 | 3300046517 | Ga0495630_0117327 | Ga0495630_0117327_1013_1270 | 85 |
| 542 | 3300046529 | Ga0495652_0033641 | Ga0495652_0033641_2410_2667 | 85 |
| 543 | 3300046533 | Ga0495640_0378965 | Ga0495640_0378965_182_439 | 85 |
| 544 | 3300046536 | Ga0495587_0020754 | Ga0495587_0020754_1752_2009 | 85 |
| 545 | 3300046559 | Ga0495667_0014419 | Ga0495667_0014419_2501_2758 | 85 |
| 546 | 3300046663 | Ga0495635_0109072 | Ga0495635_0109072_829_1086 | 85 |
| 547 | 3300046675 | Ga0495657_0027025 | Ga0495657_0027025_3585_3842 | 85 |
| 548 | 3300046678 | Ga0495599_0004339 | Ga0495599_0004339_1739_1996 | 85 |
| 549 | 3300046680 | Ga0495646_0097491 | Ga0495646_0097491_875_1132 | 85 |
| 550 | 3300046684 | Ga0495669_0531215 | Ga0495669_0531215_34_291 | 85 |
| 551 | 3300046690 | Ga0495624_0176158 | Ga0495624_0176158_139_396 | 85 |
| 552 | 3300046809 | Ga0495600_0088393 | Ga0495600_0088393_206_463 | 85 |
| 553 | 3300047317 | Ga0495604_0025651 | Ga0495604_0025651_1976_2233 | 85 |
| 554 | 3300047319 | Ga0495674_0058374 | Ga0495674_0058374_1537_1794 | 85 |
| 555 | 3300047322 | Ga0495680_0069720 | Ga0495680_0069720_1153_1410 | 85 |
| 556 | 3300047471 | Ga0495684_0097041 | Ga0495684_0097041_1563_1820 | 85 |
| 557 | 3300047673 | Ga0495593_0383433 | Ga0495593_0383433_21_278 | 85 |
| 558 | 3300048088 | Ga0495602_0008977 | Ga0495602_0008977_4089_4346 | 85 |
| 559 | 3300048088 | Ga0495602_0456574 | Ga0495602_0456574_122_379 | 85 |
| 560 | 3300048905 | Ga0496102_0044569 | Ga0496102_0044569_190_447 | 85 |
| 561 | 3300048909 | Ga0496106_0012821 | Ga0496106_0012821_5495_5752 | 85 |
| 562 | 3300048910 | Ga0496107_0087659 | Ga0496107_0087659_1879_2136 | 85 |
| 563 | 3300048911 | Ga0496108_0105128 | Ga0496108_0105128_1146_1403 | 85 |
| 564 | 3300048912 | Ga0496109_0496861 | Ga0496109_0496861_164_421 | 85 |
| 565 | 3300048913 | Ga0496110_0013167 | Ga0496110_0013167_6182_6439 | 85 |
| 566 | 3300048914 | Ga0496111_0127704 | Ga0496111_0127704_728_985 | 85 |
| 567 | 3300048916 | Ga0496113_0081004 | Ga0496113_0081004_1502_1759 | 85 |
| 568 | 3300049588 | Ga0501072_0756562 | Ga0501072_0756562_473_730 | 85 |
| 569 | 3300049591 | Ga0501075_0604168 | Ga0501075_0604168_423_680 | 85 |
| 570 | 3300049592 | Ga0501076_0014561 | Ga0501076_0014561_3451_3708 | 85 |
| 571 | 3300049593 | Ga0501077_0086240 | Ga0501077_0086240_359_616 | 85 |
| 572 | 3300049741 | Ga0501079_0088682 | Ga0501079_0088682_210_467 | 85 |
| 573 | 3300049743 | Ga0501081_0015721 | Ga0501081_0015721_2714_2971 | 85 |
| 574 | 3300049743 | Ga0501081_0682676 | Ga0501081_0682676_318_614 | 85 |
| 575 | 3300049824 | Ga0501045_0707539 | Ga0501045_0707539_150_407 | 85 |
| 576 | 3300050507 | nmdc:mga05p37_890095_c1 | nmdc:mga05p37_890095_c1_357_623 | 85 |
| 577 | 3300050508 | nmdc:mga09592_41900_c1 | nmdc:mga09592_41900_c1_66_332 | 85 |
| 578 | 3300050509 | nmdc:mga0qj67_154190_c1 | nmdc:mga0qj67_154190_c1_706_972 | 85 |
| 579 | 3300050510 | nmdc:mga06r32_34027_c1 | nmdc:mga06r32_34027_c1_535_801 | 85 |
| 580 | 3300050511 | nmdc:mga08y16_1040379_c1 | nmdc:mga08y16_1040379_c1_264_530 | 85 |
| 581 | 3300050511 | nmdc:mga08y16_1688624_c1 | nmdc:mga08y16_1688624_c1_57_314 | 85 |
| 582 | 3300050511 | nmdc:mga08y16_231052_c1 | nmdc:mga08y16_231052_c1_263_529 | 85 |
| 583 | 3300050511 | nmdc:mga08y16_6719_c1 | nmdc:mga08y16_6719_c1_1191_1448 | 85 |
| 584 | 3300050512 | nmdc:mga0n895_356672_c1 | nmdc:mga0n895_356672_c1_1108_1365 | 85 |
| 585 | 3300050512 | nmdc:mga0n895_457589_c1 | nmdc:mga0n895_457589_c1_22_279 | 85 |
| 586 | 3300050515 | nmdc:mga0a205_63150_c1 | nmdc:mga0a205_63150_c1_1360_1617 | 85 |
| 587 | 3300053077 | Ga0495601_0000485 | Ga0495601_0000485_17352_17609 | 85 |
| 588 | 3300053078 | Ga0495612_0000714 | Ga0495612_0000714_7107_7364 | 85 |
| 589 | 3300053084 | Ga0495595_0336146 | Ga0495595_0336146_167_424 | 85 |
| 590 | 3300053085 | Ga0495619_0000487 | Ga0495619_0000487_25466_25723 | 85 |
| 591 | 3300054114 | Ga0501084_0272197 | Ga0501084_0272197_949_1206 | 85 |
| 592 | 3300060353 | Ga0501082_0338044 | Ga0501082_0338044_142_399 | 85 |
| 593 | 3300061734 | Ga0530510_0524342 | Ga0530510_0524342_116_373 | 85 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2mhe-assembly1.cif.gz_B | nmr structure of the protein np_419126.1 from caulobacter crescentus | 0.7565 | 1 | 77 |
| 2mhe-assembly1.cif.gz_B | nmr structure of the protein np_419126.1 from caulobacter crescentus | 0.7217 | 1 | 77 |
| 3o2h-assembly1.cif.gz_A | e. coli clps in complex with a leu n-end rule peptide | 0.6408 | 7 | 71 |
| 7wq5-assembly2.cif.gz_B | crystal structure of arabidopsis transcriptional factor wrinkled1 with dsdna | 0.6374 | 18 | 57 |
| 1mg9-assembly1.cif.gz_A | the structural basis of clps-mediated switch in clpa substrate recognition | 0.6368 | 9 | 71 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7UQ19_118_172_3.30.730.10 | Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain | 0.8179 | 32 | 60 | 3.30.730.10 |
| af_Q2TQ39_75_158_3.30.730.10 | Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain | 0.7982 | 34 | 57 | 3.30.730.10 |
| af_Q9SGJ6_29_87_3.30.730.10 | Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain | 0.7818 | 30 | 57 | 3.30.730.10 |
| af_C0P9B0_100_150_3.30.730.10 | Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain | 0.7594 | 29 | 59 | 3.30.730.10 |
| af_B4FET9_33_90_3.30.730.10 | Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain | 0.7568 | 34 | 63 | 3.30.730.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D4F2C3-F1-model_v4 | deleted | 0.9745 | 13 | 69 |
|
| AF-A0A1Q3JIW1-F1-model_v4 | Inositol monophosphatase | 0.9391 | 8 | 77 |
|
| AF-A0A258DDP0-F1-model_v4 | Inositol monophosphatase | 0.9377 | 8 | 77 |
|
| AF-A0A2E1RWQ1-F1-model_v4 | Inositol monophosphatase | 0.9377 | 9 | 77 |
|
| AF-C6XHY3-F1-model_v4 | DUF4170 domain-containing protein | 0.9358 | 3 | 73 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar