F467256

General Info

Members Datasets Scaffolds Average Seq Length
593 254 1186 356

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0139457|Ga0451577_0139457_966_2156
Length 396
Sequence MPLRRSAFRRSAVKPAIHASPVETAVQSRKIRRKIRAAMKITSIETCLLTVPTPRPMSTEWPHHKFVVADIATDEGVSGHGYSMVFGGGGAEAVLAYLDTRLKGLLIGEDPLQVERLWDKMYRGDRGVRRVGIAGMAISALDIALWDLAGKAAGLPLYKLWGGFTDRVSAYGSGGWGKYSEAELVAEAQRYAAAGCKYYKMKIHHPDPKVNRARVEAVRKAVGPGMRMMVDVNQKLDLEGNRRQAALLEDFDLVWYEEPVLSDDLAACEEVARAIRIPVATGENNYTRYEFRELIQRRAARYLMPDVCRANGYSETLKIGHLAAAHGIAVSPHVVHELSLQVCGALSNGFLVEYMDWAPKDLFEELPECKDGEFRIPAKPGHGIAMTKEALKKYRV

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
3 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
172 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
173 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
184 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
185 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
186 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
187 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
188 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
189 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.67
Rhizosphere 99.16
Stem 0
Stem Tuber 0
Unclassified 3.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0139457 3300042876 Bacteria 2178
2 JGI26128J50194_1000894 3300003347 Bacteria 1808
3 JGI26141J51220_1000826 3300003503 Bacteria 1802
4 Ga0065715_10114096 3300005293 Bacteria 2463
5 Ga0070676_10001199 3300005328 Bacteria 12991
6 Ga0070683_100063983 3300005329 Bacteria 3423
7 Ga0070690_100004007 3300005330 Bacteria 8148
8 Ga0070690_100015226 3300005330 Bacteria 4583
9 Ga0068869_100003166 3300005334 Bacteria 10041
10 Ga0068869_100003313 3300005334 Bacteria 9842
11 Ga0070666_10091539 3300005335 Bacteria 2089
12 Ga0070680_100000149 3300005336 Bacteria 43060
13 Ga0070680_100010180 3300005336 Bacteria 7252
14 Ga0070680_100065485 3300005336 Bacteria 2978
15 Ga0070682_100003456 3300005337 Bacteria 8738
16 Ga0070682_100004482 3300005337 Bacteria 7759
17 Ga0068868_100000056 3300005338 Bacteria 63982
18 Ga0070660_100001484 3300005339 Bacteria 16063
19 Ga0070689_100000200 3300005340 Bacteria 35886
20 Ga0070689_100054730 3300005340 Bacteria 3090
21 Ga0070689_100295474 3300005340 Bacteria 1347
22 Ga0070691_10002484 3300005341 Bacteria 8201
23 Ga0070691_10003669 3300005341 Bacteria 6933
24 Ga0070691_10008969 3300005341 Bacteria 4575
25 Ga0070687_100000052 3300005343 Bacteria 37327
26 Ga0070687_100040762 3300005343 Bacteria 2342
27 Ga0070661_100001482 3300005344 Bacteria 16294
28 Ga0070692_10000237 3300005345 Bacteria 15137
29 Ga0070669_100157823 3300005353 Bacteria 1760
30 Ga0070688_100033852 3300005365 Bacteria 3090
31 Ga0070659_100001725 3300005366 Bacteria 15702
32 Ga0070667_100054095 3300005367 Bacteria 3389
33 Ga0070701_10003888 3300005438 Bacteria 5964
34 Ga0070701_10098173 3300005438 Bacteria 1617
35 Ga0070705_100000638 3300005440 Bacteria 20069
36 Ga0070705_100008127 3300005440 Bacteria 5190
37 Ga0070705_100009236 3300005440 Bacteria 4898
38 Ga0070705_100093941 3300005440 Bacteria 1876
39 Ga0070700_100000211 3300005441 Bacteria 32522
40 Ga0070694_100012825 3300005444 Bacteria 5223
41 Ga0070694_100014905 3300005444 Bacteria 4871
42 Ga0070694_100019179 3300005444 Bacteria 4349
43 Ga0070694_100202874 3300005444 Bacteria 1479
44 Ga0070708_100197938 3300005445 Bacteria 1880
45 Ga0070663_100067992 3300005455 Bacteria 2586
46 Ga0070662_100001423 3300005457 Bacteria 14758
47 Ga0070681_10000525 3300005458 Bacteria 31394
48 Ga0070681_10040330 3300005458 Bacteria 4678
49 Ga0068867_100006487 3300005459 Bacteria 8266
50 Ga0068867_100012689 3300005459 Bacteria 5960
51 Ga0068867_100014336 3300005459 Bacteria 5614
52 Ga0068867_100236697 3300005459 Bacteria 1479
53 Ga0070706_100149877 3300005467 Bacteria 2177
54 Ga0070706_100166342 3300005467 Unclassified 2059
55 Ga0070706_100246353 3300005467 Bacteria 1669
56 Ga0070706_100364510 3300005467 Bacteria 1346
57 Ga0070707_100027164 3300005468 Bacteria 5442
58 Ga0070707_100034501 3300005468 Bacteria 4825
59 Ga0070707_100182361 3300005468 Unclassified 2047
60 Ga0070698_100002031 3300005471 Bacteria 22500
61 Ga0070698_100018091 3300005471 Bacteria 7420
62 Ga0070698_100042807 3300005471 Bacteria 4645
63 Ga0070698_100165087 3300005471 Bacteria 2157
64 Ga0070699_100005247 3300005518 Bacteria 11376
65 Ga0070699_100008860 3300005518 Bacteria 8711
66 Ga0070699_100013971 3300005518 Bacteria 6907
67 Ga0070699_100031566 3300005518 Bacteria 4573
68 Ga0070699_100063401 3300005518 Bacteria 3205
69 Ga0070699_100070352 3300005518 Bacteria 3042
70 Ga0070699_100196508 3300005518 Unclassified 1793
71 Ga0070679_100022523 3300005530 Bacteria 6158
72 Ga0070679_100027284 3300005530 Bacteria 5619
73 Ga0070679_100095686 3300005530 Bacteria 2957
74 Ga0070684_100008881 3300005535 Bacteria 7883
75 Ga0070684_100070340 3300005535 Bacteria 3079
76 Ga0070697_100029077 3300005536 Bacteria 4429
77 Ga0070697_100215992 3300005536 Bacteria 1634
78 Ga0068853_100001823 3300005539 Bacteria 15670
79 Ga0070672_100246796 3300005543 Bacteria 1503
80 Ga0070686_100000545 3300005544 Bacteria 22498
81 Ga0070686_100010212 3300005544 Bacteria 5285
82 Ga0070695_100001651 3300005545 Bacteria 12528
83 Ga0070695_100004303 3300005545 Bacteria 8339
84 Ga0070695_100012905 3300005545 Bacteria 5016
85 Ga0070695_100037942 3300005545 Bacteria 3038
86 Ga0070695_100049167 3300005545 Bacteria 2699
87 Ga0070696_100000012 3300005546 Bacteria 79388
88 Ga0070696_100002298 3300005546 Bacteria 12607
89 Ga0070696_100033450 3300005546 Bacteria 3532
90 Ga0070696_100046429 3300005546 Bacteria 3012
91 Ga0070696_100096985 3300005546 Bacteria 2107
92 Ga0070693_100000579 3300005547 Bacteria 16207
93 Ga0070693_100003873 3300005547 Bacteria 7017
94 Ga0070693_100146810 3300005547 Bacteria 1490
95 Ga0070704_100001021 3300005549 Bacteria 14388
96 Ga0070704_100003341 3300005549 Bacteria 9183
97 Ga0070704_100090289 3300005549 Bacteria 2281
98 Ga0068855_100005123 3300005563 Bacteria 15980
99 Ga0068855_100045041 3300005563 Bacteria 5219
100 Ga0070664_100019414 3300005564 Bacteria 5593
101 Ga0068854_100075964 3300005578 Bacteria 2468
102 Ga0068856_100046268 3300005614 Bacteria 4286
103 Ga0068856_100106739 3300005614 Bacteria 2795
104 Ga0070702_100000225 3300005615 Bacteria 19043
105 Ga0070702_100013212 3300005615 Bacteria 4163
106 Ga0070702_100110666 3300005615 Bacteria 1702
107 Ga0068852_100038813 3300005616 Bacteria 4005
108 Ga0068859_100015807 3300005617 Bacteria 7582
109 Ga0068859_100059404 3300005617 Bacteria 3852
110 Ga0068859_100074965 3300005617 Bacteria 3423
111 Ga0068859_100547624 3300005617 Unclassified 1252
112 Ga0068864_100048082 3300005618 Bacteria 3666
113 Ga0068864_100128262 3300005618 Bacteria 2275
114 Ga0068866_10000850 3300005718 Bacteria 13518
115 Ga0068861_100000033 3300005719 Bacteria 64659
116 Ga0068861_100131639 3300005719 Bacteria 2031
117 Ga0068870_10000437 3300005840 Bacteria 15814
118 Ga0068870_10047180 3300005840 Unclassified 2263
119 Ga0068863_100230438 3300005841 Bacteria 1786
120 Ga0068858_100001425 3300005842 Bacteria 24575
121 Ga0068858_100012686 3300005842 Bacteria 7940
122 Ga0068860_100007436 3300005843 Bacteria 10953
123 Ga0068860_100057420 3300005843 Bacteria 3700
124 Ga0068860_100139938 3300005843 Bacteria 2326
125 Ga0068860_100370308 3300005843 Bacteria 1413
126 Ga0068862_100000735 3300005844 Bacteria 32926
127 Ga0068862_100002850 3300005844 Bacteria 15162
128 Ga0068862_100015430 3300005844 Bacteria 6346
129 Ga0068862_100481446 3300005844 Unclassified 1175
130 Ga0081540_1061624 3300005983 Bacteria 1787
131 Ga0081539_10000462 3300005985 Bacteria 86060
132 Ga0070716_100021860 3300006173 Bacteria 3374
133 Ga0097621_100000939 3300006237 Bacteria 20422
134 Ga0068871_100001863 3300006358 Bacteria 14259
135 Ga0068871_100003056 3300006358 Bacteria 11486
136 Ga0075428_100009686 3300006844 Bacteria 10701
137 Ga0075428_100010456 3300006844 Bacteria 10308
138 Ga0075428_100024711 3300006844 Bacteria 6648
139 Ga0075430_100000086 3300006846 Bacteria 52815
140 Ga0075431_100016749 3300006847 Bacteria 7443
141 Ga0075431_100020018 3300006847 Bacteria 6833
142 Ga0075431_100191257 3300006847 Bacteria 2097
143 Ga0075433_10000500 3300006852 Bacteria 25544
144 Ga0075433_10001084 3300006852 Bacteria 19620
145 Ga0075433_10004787 3300006852 Bacteria 10563
146 Ga0075433_10051178 3300006852 Bacteria 3596
147 Ga0075434_100003449 3300006871 Bacteria 14136
148 Ga0075434_100022012 3300006871 Bacteria 6204
149 Ga0075434_100068637 3300006871 Bacteria 3532
150 Ga0075429_100000259 3300006880 Bacteria 36776
151 Ga0075429_100003089 3300006880 Bacteria 14125
152 Ga0075429_100077207 3300006880 Bacteria 2902
153 Ga0075429_100164001 3300006880 Bacteria 1946
154 Ga0075429_100273463 3300006880 Unclassified 1479
155 Ga0068865_100000844 3300006881 Bacteria 17310
156 Ga0068865_100142418 3300006881 Bacteria 1809
157 Ga0075436_100000428 3300006914 Bacteria 26958
158 Ga0075436_100000874 3300006914 Bacteria 20002
159 Ga0075436_100002996 3300006914 Bacteria 11564
160 Ga0075436_100007399 3300006914 Bacteria 7512
161 Ga0075436_100038875 3300006914 Bacteria 3283
162 Ga0097620_100015807 3300006931 Bacteria 7582
163 Ga0097620_100059402 3300006931 Bacteria 3852
164 Ga0097620_100074965 3300006931 Bacteria 3423
165 Ga0097620_100547630 3300006931 Unclassified 1252
166 Ga0075435_100000047 3300007076 Bacteria 60782
167 Ga0075435_100005084 3300007076 Bacteria 9141
168 Ga0075435_100016888 3300007076 Bacteria 5510
169 Ga0075435_100019309 3300007076 Bacteria 5203
170 Ga0075435_100032594 3300007076 Bacteria 4115
171 Ga0075435_100071354 3300007076 Bacteria 2836
172 Ga0099794_10002556 3300007265 Bacteria 6741
173 Ga0099794_10089567 3300007265 Bacteria 1526
174 Ga0111539_10001693 3300009094 Bacteria 29397
175 Ga0111539_10006843 3300009094 Bacteria 14647
176 Ga0111539_10009904 3300009094 Bacteria 12026
177 Ga0111539_10017117 3300009094 Bacteria 8973
178 Ga0111539_10030292 3300009094 Bacteria 6578
179 Ga0111539_10117642 3300009094 Bacteria 3115
180 Ga0105245_10027918 3300009098 Bacteria 4974
181 Ga0105245_10050484 3300009098 Bacteria 3728
182 Ga0114129_10000430 3300009147 Bacteria 49930
183 Ga0114129_10002283 3300009147 Bacteria 26550
184 Ga0114129_10003662 3300009147 Bacteria 21610
185 Ga0114129_10004826 3300009147 Bacteria 19052
186 Ga0114129_10039602 3300009147 Bacteria 6645
187 Ga0114129_10055532 3300009147 Bacteria 5549
188 Ga0114129_10088122 3300009147 Bacteria 4304
189 Ga0114129_10292403 3300009147 Unclassified 2174
190 Ga0105243_10000374 3300009148 Bacteria 48005
191 Ga0105241_10000133 3300009174 Bacteria 53690
192 Ga0105241_10101271 3300009174 Bacteria 2290
193 Ga0105242_10000192 3300009176 Bacteria 47321
194 Ga0105242_10067713 3300009176 Bacteria 2952
195 Ga0105242_10388307 3300009176 Bacteria 1299
196 Ga0105248_10238643 3300009177 Bacteria 2046
197 Ga0105248_10356588 3300009177 Bacteria 1647
198 Ga0105237_10207698 3300009545 Bacteria 1958
199 Ga0105249_10122917 3300009553 Bacteria 2469
200 Ga0105249_10242318 3300009553 Bacteria 1783
201 Ga0105239_10051262 3300010375 Bacteria 4525
202 Ga0105246_10297936 3300011119 Bacteria 1301
203 Ga0157373_10013951 3300013100 Bacteria 5893
204 Ga0157371_10085185 3300013102 Bacteria 2239
205 Ga0157369_10062664 3300013105 Bacteria 4007
206 Ga0157378_10004115 3300013297 Bacteria 12844
207 Ga0157378_10448598 3300013297 Unclassified 1280
208 Ga0157372_10006881 3300013307 Bacteria 12099
209 Ga0157372_10037276 3300013307 Bacteria 5361
210 Ga0157375_10139004 3300013308 Bacteria 2554
211 Ga0157379_10470163 3300014968 Bacteria 1163
212 Ga0157376_10033953 3300014969 Bacteria 4114
213 Ga0207653_10007379 3300025885 Bacteria 3427
214 Ga0207642_10000362 3300025899 Bacteria 13648
215 Ga0207688_10008520 3300025901 Bacteria 5583
216 Ga0207647_10146962 3300025904 Unclassified 1379
217 Ga0207699_10127321 3300025906 Bacteria 1656
218 Ga0207645_10002226 3300025907 Bacteria 15461
219 Ga0207643_10001163 3300025908 Bacteria 15640
220 Ga0207684_10001116 3300025910 Bacteria 29985
221 Ga0207684_10040381 3300025910 Bacteria 3955
222 Ga0207684_10044522 3300025910 Bacteria 3764
223 Ga0207684_10069708 3300025910 Unclassified 2988
224 Ga0207654_10089814 3300025911 Bacteria 1870
225 Ga0207707_10000556 3300025912 Bacteria 37797
226 Ga0207707_10161410 3300025912 Bacteria 1959
227 Ga0207707_10263395 3300025912 Bacteria 1495
228 Ga0207671_10115518 3300025914 Bacteria 2046
229 Ga0207660_10002844 3300025917 Bacteria 11320
230 Ga0207660_10231122 3300025917 Bacteria 1454
231 Ga0207662_10000126 3300025918 Bacteria 36663
232 Ga0207662_10060764 3300025918 Bacteria 2267
233 Ga0207657_10003869 3300025919 Bacteria 15892
234 Ga0207649_10005083 3300025920 Bacteria 7111
235 Ga0207652_10016524 3300025921 Bacteria 6027
236 Ga0207652_10024890 3300025921 Bacteria 4969
237 Ga0207652_10110452 3300025921 Bacteria 2438
238 Ga0207646_10015141 3300025922 Bacteria 7295
239 Ga0207646_10075464 3300025922 Bacteria 3012
240 Ga0207646_10089324 3300025922 Bacteria 2758
241 Ga0207646_10113168 3300025922 Unclassified 2436
242 Ga0207659_10146765 3300025926 Bacteria 1838
243 Ga0207687_10000739 3300025927 Bacteria 22162
244 Ga0207690_10025096 3300025932 Bacteria 3738
245 Ga0207706_10045328 3300025933 Bacteria 3897
246 Ga0207706_10120940 3300025933 Bacteria 2302
247 Ga0207686_10000564 3300025934 Bacteria 23601
248 Ga0207709_10000444 3300025935 Bacteria 38874
249 Ga0207709_10032445 3300025935 Bacteria 3058
250 Ga0207670_10004733 3300025936 Bacteria 7380
251 Ga0207670_10050653 3300025936 Bacteria 2784
252 Ga0207704_10018655 3300025938 Bacteria 3627
253 Ga0207711_10320237 3300025941 Bacteria 1433
254 Ga0207689_10000240 3300025942 Bacteria 48953
255 Ga0207689_10001708 3300025942 Bacteria 20783
256 Ga0207689_10067886 3300025942 Bacteria 2930
257 Ga0207689_10377772 3300025942 Bacteria 1180
258 Ga0207661_10083813 3300025944 Bacteria 2639
259 Ga0207679_10050632 3300025945 Bacteria 3036
260 Ga0207667_10005121 3300025949 Bacteria 16007
261 Ga0207667_10289484 3300025949 Bacteria 1674
262 Ga0207651_10103011 3300025960 Bacteria 2123
263 Ga0207712_10023431 3300025961 Bacteria 4073
264 Ga0207712_10289797 3300025961 Bacteria 1339
265 Ga0207640_10284003 3300025981 Bacteria 1301
266 Ga0207658_10179278 3300025986 Bacteria 1752
267 Ga0207677_10000680 3300026023 Bacteria 20127
268 Ga0207703_10011438 3300026035 Bacteria 6901
269 Ga0207703_10012196 3300026035 Bacteria 6701
270 Ga0207639_10006287 3300026041 Bacteria 8066
271 Ga0207639_10042416 3300026041 Bacteria 3410
272 Ga0207678_10021293 3300026067 Bacteria 5684
273 Ga0207708_10000153 3300026075 Bacteria 54987
274 Ga0207708_10235093 3300026075 Bacteria 1472
275 Ga0207702_10037222 3300026078 Bacteria 4072
276 Ga0207702_10173553 3300026078 Bacteria 1979
277 Ga0207641_10204174 3300026088 Bacteria 1824
278 Ga0207648_10000130 3300026089 Bacteria 74342
279 Ga0207648_10064265 3300026089 Bacteria 3199
280 Ga0207648_10064672 3300026089 Bacteria 3188
281 Ga0207648_10066485 3300026089 Bacteria 3144
282 Ga0207676_10156850 3300026095 Bacteria 1967
283 Ga0207674_10005434 3300026116 Bacteria 15131
284 Ga0207674_10008790 3300026116 Bacteria 11628
285 Ga0207674_10239562 3300026116 Unclassified 1761
286 Ga0207675_100000253 3300026118 Bacteria 51284
287 Ga0207675_100018522 3300026118 Bacteria 6494
288 Ga0207683_10178537 3300026121 Bacteria 1925
289 Ga0207698_10236381 3300026142 Bacteria 1662
290 Ga0207698_10264687 3300026142 Bacteria 1581
291 Ga0209967_1000731 3300027364 Bacteria 4223
292 Ga0209981_1001009 3300027378 Bacteria 3550
293 Ga0209984_1000948 3300027424 Bacteria 3099
294 Ga0209995_1002532 3300027471 Bacteria 2894
295 Ga0209968_1001882 3300027526 Bacteria 3183
296 Ga0209999_1000956 3300027543 Bacteria 4865
297 Ga0209983_1000928 3300027665 Bacteria 6438
298 Ga0209588_1044431 3300027671 Bacteria 1437
299 Ga0209971_1004436 3300027682 Bacteria 3332
300 Ga0209966_1000256 3300027695 Bacteria 19430
301 Ga0209998_10000070 3300027717 Bacteria 40919
302 Ga0209974_10000099 3300027876 Bacteria 24483
303 Ga0207428_10000721 3300027907 Bacteria 38142
304 Ga0207428_10000794 3300027907 Bacteria 35722
305 Ga0207428_10006425 3300027907 Bacteria 10856
306 Ga0268265_10028859 3300028380 Bacteria 3976
307 Ga0268265_10038678 3300028380 Bacteria 3510
308 Ga0268264_10037504 3300028381 Bacteria 3996
309 Ga0268264_10042535 3300028381 Bacteria 3761
310 Ga0268264_10143371 3300028381 Bacteria 2133
311 Ga0268264_10149836 3300028381 Bacteria 2090
312 Ga0307408_100004301 3300031548 Bacteria 9666
313 Ga0307408_100160785 3300031548 Bacteria 1784
314 Ga0307405_10031779 3300031731 Bacteria 3112
315 Ga0307405_10242940 3300031731 Bacteria 1335
316 Ga0307412_10222407 3300031911 Unclassified 1448
317 Ga0307416_100047136 3300032002 Bacteria 3408
318 Ga0307416_100232448 3300032002 Unclassified 1779
319 Ga0373948_0003581 3300034817 Bacteria 2398
320 Ga0373940_0003844 3300035088 Bacteria 3114
321 Ga0373944_0010354 3300035089 Bacteria 2540
322 Ga0373936_0000959 3300035113 Bacteria 10286
323 Ga0373939_0001857 3300035114 Bacteria 5063
324 Ga0373941_0020213 3300035115 Bacteria 1864
325 Ga0373941_0073687 3300035115 Bacteria 1139
326 Ga0373945_0002992 3300035116 Bacteria 5312
327 Ga0373946_0006410 3300035171 Bacteria 4265
328 Ga0373955_0012841 3300035172 Bacteria 4037
329 Ga0373942_0004845 3300035207 Bacteria 3125
330 Ga0373942_0006378 3300035207 Bacteria 2723
331 Ga0373961_0010146 3300035241 Bacteria 2318
332 Ga0373961_0033438 3300035241 Bacteria 1448
333 Ga0373962_0021994 3300035242 Bacteria 1687
334 Ga0373924_0008820 3300035410 Bacteria 3678
335 Ga0373931_0004555 3300035691 Bacteria 6342
336 Ga0373931_0141349 3300035691 Bacteria 1394
337 Ga0373935_0011964 3300035692 Bacteria 5212
338 Ga0373927_0082726 3300035695 Bacteria 2081
339 Ga0373933_0001569 3300035724 Bacteria 13375
340 Ga0373947_0067326 3300035725 Bacteria 2187
341 Ga0373937_0001440 3300036401 Bacteria 19895
342 Ga0395900_0374052 3300037418 Unclassified 1394
343 Ga0436360_1309494 3300039438 Bacteria 2197
344 Ga0439461_0001446 3300041410 Bacteria 3670
345 Ga0451839_0456736 3300041496 Bacteria 1689
346 Ga0439441_002359 3300042001 Bacteria 2651
347 Ga0439455_0000404 3300042012 Bacteria 5727
348 Ga0439446_0005070 3300042156 Bacteria 3372
349 Ga0439434_0007668 3300042435 Bacteria 3162
350 Ga0439459_0001683 3300042438 Bacteria 3293
351 Ga0439460_0000467 3300042461 Bacteria 8757
352 Ga0451577_0030057 3300042876 Bacteria 4909
353 Ga0451577_0064436 3300042876 Bacteria 3268
354 Ga0453683_0038018 3300044673 Unclassified 3026
355 Ga0453684_0053783 3300044712 Bacteria 5252
356 Ga0453684_0187883 3300044712 Bacteria 2419
357 Ga0453684_0377246 3300044712 Bacteria 1593
358 Ga0451576_0003101 3300045051 Bacteria 23314
359 Ga0451576_0014943 3300045051 Bacteria 8622
360 Ga0451576_0024911 3300045051 Bacteria 6456
361 Ga0451576_0073051 3300045051 Bacteria 3569
362 Ga0451576_0098988 3300045051 Bacteria 3033
363 Ga0451576_0101156 3300045051 Bacteria 2997
364 Ga0451576_0252735 3300045051 Bacteria 1842
365 Ga0451576_0400865 3300045051 Bacteria 1438
366 Ga0451576_0510050 3300045051 Bacteria 1263
367 Ga0466967_0010071 3300045976 Bacteria 7065
368 Ga0495603_0044154 3300046455 Bacteria 2660
369 Ga0495580_0000845 3300046472 Bacteria 26536
370 Ga0495580_0004779 3300046472 Bacteria 11342
371 Ga0495580_0031006 3300046472 Bacteria 3867
372 Ga0495582_0046060 3300046473 Bacteria 2402
373 Ga0495662_0016646 3300046476 Bacteria 3562
374 Ga0495630_0046766 3300046517 Bacteria 3235
375 Ga0495630_0130107 3300046517 Bacteria 1911
376 Ga0495666_0008044 3300046526 Bacteria 5285
377 Ga0495642_0015060 3300046528 Bacteria 3003
378 Ga0495586_0007966 3300046535 Bacteria 5650
379 Ga0495586_0077795 3300046535 Bacteria 1819
380 Ga0495598_0004441 3300046537 Bacteria 3037
381 Ga0495621_0060717 3300046539 Bacteria 1372
382 Ga0495656_0016044 3300046615 Bacteria 2838
383 Ga0495659_0006510 3300046664 Bacteria 3688
384 Ga0495588_0046765 3300046674 Bacteria 2220
385 Ga0495647_0001586 3300046681 Bacteria 7024
386 Ga0495669_0045474 3300046684 Bacteria 1957
387 Ga0495669_0074494 3300046684 Bacteria 1552
388 Ga0495676_0060585 3300047321 Bacteria 2965
389 Ga0496102_0049341 3300048905 Bacteria 3829
390 Ga0496102_0084015 3300048905 Bacteria 2938
391 Ga0496106_0029604 3300048909 Bacteria 4082
392 Ga0496106_0164325 3300048909 Bacteria 1757
393 Ga0501031_0042967 3300049568 Bacteria 2950
394 Ga0501033_0215223 3300049570 Unclassified 1369
395 Ga0501033_0292380 3300049570 Bacteria 1148
396 Ga0501036_0000338 3300049572 Bacteria 32764
397 Ga0501036_0061415 3300049572 Bacteria 3183
398 Ga0501036_0120391 3300049572 Bacteria 2217
399 Ga0501036_0211346 3300049572 Bacteria 1630
400 Ga0501036_0291388 3300049572 Bacteria 1366
401 Ga0501037_0019615 3300049573 Bacteria 4989
402 Ga0501038_0000401 3300049574 Bacteria 37613
403 Ga0501038_0029223 3300049574 Bacteria 4887
404 Ga0501039_0001876 3300049575 Bacteria 15542
405 Ga0501039_0016881 3300049575 Bacteria 5596
406 Ga0501039_0152677 3300049575 Bacteria 1814
407 Ga0501039_0240421 3300049575 Bacteria 1423
408 Ga0501040_0000653 3300049576 Bacteria 21332
409 Ga0501040_0018245 3300049576 Bacteria 4658
410 Ga0501040_0039044 3300049576 Bacteria 3228
411 Ga0501041_0029253 3300049577 Bacteria 3323
412 Ga0501041_0029519 3300049577 Bacteria 3308
413 Ga0501041_0040148 3300049577 Bacteria 2840
414 Ga0501041_0058507 3300049577 Bacteria 2358
415 Ga0501041_0166326 3300049577 Bacteria 1379
416 Ga0501042_0000024 3300049578 Bacteria 49123
417 Ga0501042_0008169 3300049578 Bacteria 6896
418 Ga0501042_0008561 3300049578 Bacteria 6765
419 Ga0501042_0022252 3300049578 Bacteria 4428
420 Ga0501042_0038801 3300049578 Bacteria 3382
421 Ga0501042_0100646 3300049578 Bacteria 2078
422 Ga0501042_0127340 3300049578 Bacteria 1834
423 Ga0501042_0157118 3300049578 Bacteria 1640
424 Ga0501042_0315331 3300049578 Bacteria 1130
425 Ga0501043_0180170 3300049579 Bacteria 1646
426 Ga0501043_0218129 3300049579 Bacteria 1477
427 Ga0501046_0019373 3300049580 Bacteria 5646
428 Ga0501046_0026823 3300049580 Bacteria 4705
429 Ga0501046_0079126 3300049580 Bacteria 2542
430 Ga0501046_0092413 3300049580 Bacteria 2326
431 Ga0501046_0102816 3300049580 Bacteria 2190
432 Ga0501046_0112287 3300049580 Bacteria 2081
433 Ga0501046_0181946 3300049580 Unclassified 1571
434 Ga0501046_0281945 3300049580 Bacteria 1217
435 Ga0501047_0065762 3300049581 Bacteria 3495
436 Ga0501048_0074683 3300049582 Bacteria 2392
437 Ga0501048_0083980 3300049582 Bacteria 2245
438 Ga0501048_0199881 3300049582 Bacteria 1417
439 Ga0501048_0235441 3300049582 Bacteria 1299
440 Ga0501068_0004340 3300049584 Bacteria 7710
441 Ga0501068_0008331 3300049584 Bacteria 5766
442 Ga0501068_0062093 3300049584 Bacteria 2271
443 Ga0501068_0154447 3300049584 Bacteria 1444
444 Ga0501069_0046821 3300049585 Bacteria 2400
445 Ga0501070_0018693 3300049586 Bacteria 5814
446 Ga0501070_0250805 3300049586 Bacteria 1448
447 Ga0501071_0000232 3300049587 Bacteria 25461
448 Ga0501071_0024558 3300049587 Bacteria 4217
449 Ga0501071_0028572 3300049587 Bacteria 3932
450 Ga0501071_0071686 3300049587 Bacteria 2526
451 Ga0501071_0086989 3300049587 Bacteria 2292
452 Ga0501072_0000370 3300049588 Bacteria 32057
453 Ga0501072_0004162 3300049588 Bacteria 10950
454 Ga0501072_0015729 3300049588 Bacteria 5799
455 Ga0501072_0030484 3300049588 Bacteria 4219
456 Ga0501072_0031056 3300049588 Bacteria 4180
457 Ga0501072_0053905 3300049588 Bacteria 3168
458 Ga0501072_0053974 3300049588 Bacteria 3166
459 Ga0501072_0065072 3300049588 Bacteria 2875
460 Ga0501072_0099823 3300049588 Bacteria 2307
461 Ga0501072_0405545 3300049588 Bacteria 1081
462 Ga0501073_0258382 3300049589 Unclassified 1202
463 Ga0501074_0000394 3300049590 Bacteria 25979
464 Ga0501074_0032635 3300049590 Bacteria 3771
465 Ga0501074_0066239 3300049590 Bacteria 2598
466 Ga0501075_0000149 3300049591 Bacteria 34951
467 Ga0501075_0004311 3300049591 Bacteria 9623
468 Ga0501075_0007147 3300049591 Bacteria 7726
469 Ga0501075_0028294 3300049591 Bacteria 4137
470 Ga0501075_0202367 3300049591 Bacteria 1514
471 Ga0501076_0000439 3300049592 Bacteria 26304
472 Ga0501076_0011961 3300049592 Bacteria 6483
473 Ga0501076_0041425 3300049592 Bacteria 3623
474 Ga0501076_0049814 3300049592 Bacteria 3313
475 Ga0501076_0076927 3300049592 Bacteria 2676
476 Ga0501076_0094939 3300049592 Bacteria 2401
477 Ga0501076_0104025 3300049592 Bacteria 2290
478 Ga0501077_0000816 3300049593 Bacteria 18915
479 Ga0501077_0002050 3300049593 Bacteria 12146
480 Ga0501077_0007869 3300049593 Bacteria 6583
481 Ga0501077_0036174 3300049593 Bacteria 3145
482 Ga0501077_0057739 3300049593 Bacteria 2464
483 Ga0501077_0117814 3300049593 Bacteria 1683
484 Ga0501077_0155896 3300049593 Bacteria 1449
485 Ga0501079_0000446 3300049741 Bacteria 26915
486 Ga0501079_0001113 3300049741 Bacteria 18689
487 Ga0501079_0012858 3300049741 Bacteria 6390
488 Ga0501079_0022654 3300049741 Bacteria 4819
489 Ga0501079_0028656 3300049741 Bacteria 4273
490 Ga0501079_0046601 3300049741 Bacteria 3345
491 Ga0501079_0046826 3300049741 Bacteria 3337
492 Ga0501079_0132011 3300049741 Bacteria 1944
493 Ga0501079_0169389 3300049741 Bacteria 1703
494 Ga0501079_0180845 3300049741 Bacteria 1645
495 Ga0501080_0001577 3300049742 Bacteria 19304
496 Ga0501080_0075763 3300049742 Bacteria 3129
497 Ga0501080_0087287 3300049742 Bacteria 2898
498 Ga0501080_0088973 3300049742 Bacteria 2868
499 Ga0501080_0242657 3300049742 Bacteria 1644
500 Ga0501081_0000028 3300049743 Bacteria 52926
501 Ga0501081_0000106 3300049743 Bacteria 35374
502 Ga0501081_0005345 3300049743 Bacteria 8287
503 Ga0501081_0007059 3300049743 Bacteria 7303
504 Ga0501081_0013904 3300049743 Bacteria 5298
505 Ga0501081_0031757 3300049743 Bacteria 3579
506 Ga0501081_0034418 3300049743 Bacteria 3447
507 Ga0501081_0038501 3300049743 Bacteria 3267
508 Ga0501081_0084412 3300049743 Bacteria 2227
509 Ga0501081_0145869 3300049743 Bacteria 1698
510 Ga0501081_0164993 3300049743 Bacteria 1597
511 Ga0501081_0268891 3300049743 Bacteria 1247
512 Ga0501083_0181252 3300049744 Bacteria 1375
513 Ga0501035_0027904 3300049822 Bacteria 5157
514 Ga0501045_0000638 3300049824 Bacteria 22176
515 Ga0501045_0005728 3300049824 Bacteria 8603
516 Ga0501045_0019214 3300049824 Bacteria 4868
517 Ga0501045_0019403 3300049824 Bacteria 4846
518 Ga0501045_0070859 3300049824 Bacteria 2565
519 Ga0501045_0087471 3300049824 Unclassified 2301
520 nmdc:mga05p37_1829_c1 3300050507 Bacteria 24804
521 nmdc:mga05p37_21830_c1 3300050507 Bacteria 7755
522 nmdc:mga05p37_294_c1 3300050507 Bacteria 52291
523 nmdc:mga05p37_3428_c1 3300050507 Bacteria 18492
524 nmdc:mga05p37_473_c2 3300050507 Bacteria 29340
525 nmdc:mga05p37_503_c1 3300050507 Bacteria 43030
526 nmdc:mga05p37_53958_c1 3300050507 Bacteria 4945
527 nmdc:mga05p37_585385_c1 3300050507 Bacteria 1263
528 nmdc:mga05p37_76679_c1 3300050507 Bacteria 4115
529 nmdc:mga09592_15367_c1 3300050508 Bacteria 6252
530 nmdc:mga09592_169697_c1 3300050508 Bacteria 1886
531 nmdc:mga09592_217838_c1 3300050508 Bacteria 1654
532 nmdc:mga09592_241929_c1 3300050508 Bacteria 1564
533 nmdc:mga09592_41545_c1 3300050508 Bacteria 3867
534 nmdc:mga09592_5141_c1 3300050508 Bacteria 10626
535 nmdc:mga09592_665_c1 3300050508 Bacteria 26260
536 nmdc:mga09592_67117_c1 3300050508 Bacteria 3042
537 nmdc:mga0qj67_11455_c1 3300050509 Bacteria 6645
538 nmdc:mga0qj67_14675_c1 3300050509 Bacteria 5924
539 nmdc:mga0qj67_341873_c1 3300050509 Bacteria 1210
540 nmdc:mga06r32_11384_c1 3300050510 Bacteria 8012
541 nmdc:mga06r32_22246_c1 3300050510 Bacteria 5859
542 nmdc:mga06r32_280039_c1 3300050510 Bacteria 1655
543 nmdc:mga06r32_35082_c1 3300050510 Bacteria 4732
544 nmdc:mga06r32_73362_c1 3300050510 Bacteria 3315
545 nmdc:mga06r32_89647_c1 3300050510 Bacteria 3003
546 nmdc:mga08y16_14006_c1 3300050511 Bacteria 8441
547 nmdc:mga08y16_185763_c1 3300050511 Bacteria 2157
548 nmdc:mga08y16_19421_c1 3300050511 Bacteria 7165
549 nmdc:mga08y16_21631_c1 3300050511 Bacteria 6791
550 nmdc:mga08y16_217486_c1 3300050511 Bacteria 1978
551 nmdc:mga08y16_3197_c1 3300050511 Bacteria 16953
552 nmdc:mga08y16_8586_c1 3300050511 Bacteria 10705
553 nmdc:mga0n895_14201_c1 3300050512 Bacteria 7223
554 nmdc:mga0n895_1662_c1 3300050512 Bacteria 16791
555 nmdc:mga0n895_197695_c1 3300050512 Unclassified 2042
556 nmdc:mga0n895_212762_c1 3300050512 Bacteria 1963
557 nmdc:mga0n895_216569_c1 3300050512 Bacteria 1944
558 nmdc:mga0rr50_15230_c1 3300050513 Bacteria 5071
559 nmdc:mga0rr50_359_c1 3300050513 Bacteria 24852
560 nmdc:mga0rr50_38092_c1 3300050513 Bacteria 3476
561 nmdc:mga0rr50_67721_c1 3300050513 Bacteria 2713
562 nmdc:mga08x19_1000_c1 3300050514 Bacteria 17670
563 nmdc:mga08x19_11181_c1 3300050514 Bacteria 5403
564 nmdc:mga08x19_13829_c1 3300050514 Bacteria 4889
565 nmdc:mga08x19_19389_c1 3300050514 Bacteria 4173
566 nmdc:mga08x19_261_c1 3300050514 Bacteria 40081
567 nmdc:mga08x19_9220_c1 3300050514 Bacteria 5895
568 nmdc:mga0a205_16365_c1 3300050515 Bacteria 6948
569 nmdc:mga0a205_26940_c1 3300050515 Bacteria 5487
570 nmdc:mga0a205_337085_c1 3300050515 Bacteria 1377
571 nmdc:mga0a205_5345_c1 3300050515 Bacteria 11575
572 nmdc:mga0a205_75_c1 3300050515 Bacteria 54682
573 Ga0501084_0000525 3300054114 Bacteria 29296
574 Ga0501084_0008168 3300054114 Bacteria 8632
575 Ga0501084_0067064 3300054114 Bacteria 3003
576 Ga0501084_0107357 3300054114 Bacteria 2345
577 Ga0501084_0208227 3300054114 Bacteria 1650
578 Ga0590077_018466 3300059426 Bacteria 1472
579 Ga0501082_0000626 3300060353 Bacteria 31129
580 Ga0501082_0001643 3300060353 Bacteria 19706
581 Ga0501082_0022459 3300060353 Bacteria 5434
582 Ga0501082_0030033 3300060353 Bacteria 4683
583 Ga0501082_0041252 3300060353 Bacteria 3979
584 Ga0501082_0131080 3300060353 Bacteria 2175
585 Ga0530510_0000071 3300061734 Bacteria 51658
586 Ga0530510_0000932 3300061734 Bacteria 19326
587 Ga0530510_0002497 3300061734 Bacteria 12634
588 Ga0530510_0009032 3300061734 Bacteria 6985
589 Ga0530510_0024049 3300061734 Bacteria 4345
590 Ga0530510_0066451 3300061734 Bacteria 2614
591 Ga0530510_0080163 3300061734 Bacteria 2375
592 Ga0530510_0116679 3300061734 Bacteria 1957
593 Ga0530510_0152760 3300061734 Bacteria 1705
594 Ga0451577_0139457
595 JGI26128J50194_1000894
596 JGI26141J51220_1000826
597 Ga0065715_10114096
598 Ga0070676_10001199
599 Ga0070683_100063983
600 Ga0070690_100004007
601 Ga0070690_100015226
602 Ga0068869_100003166
603 Ga0068869_100003313
604 Ga0070666_10091539
605 Ga0070680_100000149
606 Ga0070680_100010180
607 Ga0070680_100065485
608 Ga0070682_100003456
609 Ga0070682_100004482
610 Ga0068868_100000056
611 Ga0070660_100001484
612 Ga0070689_100000200
613 Ga0070689_100054730
614 Ga0070689_100295474
615 Ga0070691_10002484
616 Ga0070691_10003669
617 Ga0070691_10008969
618 Ga0070687_100000052
619 Ga0070687_100040762
620 Ga0070661_100001482
621 Ga0070692_10000237
622 Ga0070669_100157823
623 Ga0070688_100033852
624 Ga0070659_100001725
625 Ga0070667_100054095
626 Ga0070701_10003888
627 Ga0070701_10098173
628 Ga0070705_100000638
629 Ga0070705_100008127
630 Ga0070705_100009236
631 Ga0070705_100093941
632 Ga0070700_100000211
633 Ga0070694_100012825
634 Ga0070694_100014905
635 Ga0070694_100019179
636 Ga0070694_100202874
637 Ga0070708_100197938
638 Ga0070663_100067992
639 Ga0070662_100001423
640 Ga0070681_10000525
641 Ga0070681_10040330
642 Ga0068867_100006487
643 Ga0068867_100012689
644 Ga0068867_100014336
645 Ga0068867_100236697
646 Ga0070706_100149877
647 Ga0070706_100166342
648 Ga0070706_100246353
649 Ga0070706_100364510
650 Ga0070707_100027164
651 Ga0070707_100034501
652 Ga0070707_100182361
653 Ga0070698_100002031
654 Ga0070698_100018091
655 Ga0070698_100042807
656 Ga0070698_100165087
657 Ga0070699_100005247
658 Ga0070699_100008860
659 Ga0070699_100013971
660 Ga0070699_100031566
661 Ga0070699_100063401
662 Ga0070699_100070352
663 Ga0070699_100196508
664 Ga0070679_100022523
665 Ga0070679_100027284
666 Ga0070679_100095686
667 Ga0070684_100008881
668 Ga0070684_100070340
669 Ga0070697_100029077
670 Ga0070697_100215992
671 Ga0068853_100001823
672 Ga0070672_100246796
673 Ga0070686_100000545
674 Ga0070686_100010212
675 Ga0070695_100001651
676 Ga0070695_100004303
677 Ga0070695_100012905
678 Ga0070695_100037942
679 Ga0070695_100049167
680 Ga0070696_100000012
681 Ga0070696_100002298
682 Ga0070696_100033450
683 Ga0070696_100046429
684 Ga0070696_100096985
685 Ga0070693_100000579
686 Ga0070693_100003873
687 Ga0070693_100146810
688 Ga0070704_100001021
689 Ga0070704_100003341
690 Ga0070704_100090289
691 Ga0068855_100005123
692 Ga0068855_100045041
693 Ga0070664_100019414
694 Ga0068854_100075964
695 Ga0068856_100046268
696 Ga0068856_100106739
697 Ga0070702_100000225
698 Ga0070702_100013212
699 Ga0070702_100110666
700 Ga0068852_100038813
701 Ga0068859_100015807
702 Ga0068859_100059404
703 Ga0068859_100074965
704 Ga0068859_100547624
705 Ga0068864_100048082
706 Ga0068864_100128262
707 Ga0068866_10000850
708 Ga0068861_100000033
709 Ga0068861_100131639
710 Ga0068870_10000437
711 Ga0068870_10047180
712 Ga0068863_100230438
713 Ga0068858_100001425
714 Ga0068858_100012686
715 Ga0068860_100007436
716 Ga0068860_100057420
717 Ga0068860_100139938
718 Ga0068860_100370308
719 Ga0068862_100000735
720 Ga0068862_100002850
721 Ga0068862_100015430
722 Ga0068862_100481446
723 Ga0081540_1061624
724 Ga0081539_10000462
725 Ga0070716_100021860
726 Ga0097621_100000939
727 Ga0068871_100001863
728 Ga0068871_100003056
729 Ga0075428_100009686
730 Ga0075428_100010456
731 Ga0075428_100024711
732 Ga0075430_100000086
733 Ga0075431_100016749
734 Ga0075431_100020018
735 Ga0075431_100191257
736 Ga0075433_10000500
737 Ga0075433_10001084
738 Ga0075433_10004787
739 Ga0075433_10051178
740 Ga0075434_100003449
741 Ga0075434_100022012
742 Ga0075434_100068637
743 Ga0075429_100000259
744 Ga0075429_100003089
745 Ga0075429_100077207
746 Ga0075429_100164001
747 Ga0075429_100273463
748 Ga0068865_100000844
749 Ga0068865_100142418
750 Ga0075436_100000428
751 Ga0075436_100000874
752 Ga0075436_100002996
753 Ga0075436_100007399
754 Ga0075436_100038875
755 Ga0097620_100015807
756 Ga0097620_100059402
757 Ga0097620_100074965
758 Ga0097620_100547630
759 Ga0075435_100000047
760 Ga0075435_100005084
761 Ga0075435_100016888
762 Ga0075435_100019309
763 Ga0075435_100032594
764 Ga0075435_100071354
765 Ga0099794_10002556
766 Ga0099794_10089567
767 Ga0111539_10001693
768 Ga0111539_10006843
769 Ga0111539_10009904
770 Ga0111539_10017117
771 Ga0111539_10030292
772 Ga0111539_10117642
773 Ga0105245_10027918
774 Ga0105245_10050484
775 Ga0114129_10000430
776 Ga0114129_10002283
777 Ga0114129_10003662
778 Ga0114129_10004826
779 Ga0114129_10039602
780 Ga0114129_10055532
781 Ga0114129_10088122
782 Ga0114129_10292403
783 Ga0105243_10000374
784 Ga0105241_10000133
785 Ga0105241_10101271
786 Ga0105242_10000192
787 Ga0105242_10067713
788 Ga0105242_10388307
789 Ga0105248_10238643
790 Ga0105248_10356588
791 Ga0105237_10207698
792 Ga0105249_10122917
793 Ga0105249_10242318
794 Ga0105239_10051262
795 Ga0105246_10297936
796 Ga0157373_10013951
797 Ga0157371_10085185
798 Ga0157369_10062664
799 Ga0157378_10004115
800 Ga0157378_10448598
801 Ga0157372_10006881
802 Ga0157372_10037276
803 Ga0157375_10139004
804 Ga0157379_10470163
805 Ga0157376_10033953
806 Ga0207653_10007379
807 Ga0207642_10000362
808 Ga0207688_10008520
809 Ga0207647_10146962
810 Ga0207699_10127321
811 Ga0207645_10002226
812 Ga0207643_10001163
813 Ga0207684_10001116
814 Ga0207684_10040381
815 Ga0207684_10044522
816 Ga0207684_10069708
817 Ga0207654_10089814
818 Ga0207707_10000556
819 Ga0207707_10161410
820 Ga0207707_10263395
821 Ga0207671_10115518
822 Ga0207660_10002844
823 Ga0207660_10231122
824 Ga0207662_10000126
825 Ga0207662_10060764
826 Ga0207657_10003869
827 Ga0207649_10005083
828 Ga0207652_10016524
829 Ga0207652_10024890
830 Ga0207652_10110452
831 Ga0207646_10015141
832 Ga0207646_10075464
833 Ga0207646_10089324
834 Ga0207646_10113168
835 Ga0207659_10146765
836 Ga0207687_10000739
837 Ga0207690_10025096
838 Ga0207706_10045328
839 Ga0207706_10120940
840 Ga0207686_10000564
841 Ga0207709_10000444
842 Ga0207709_10032445
843 Ga0207670_10004733
844 Ga0207670_10050653
845 Ga0207704_10018655
846 Ga0207711_10320237
847 Ga0207689_10000240
848 Ga0207689_10001708
849 Ga0207689_10067886
850 Ga0207689_10377772
851 Ga0207661_10083813
852 Ga0207679_10050632
853 Ga0207667_10005121
854 Ga0207667_10289484
855 Ga0207651_10103011
856 Ga0207712_10023431
857 Ga0207712_10289797
858 Ga0207640_10284003
859 Ga0207658_10179278
860 Ga0207677_10000680
861 Ga0207703_10011438
862 Ga0207703_10012196
863 Ga0207639_10006287
864 Ga0207639_10042416
865 Ga0207678_10021293
866 Ga0207708_10000153
867 Ga0207708_10235093
868 Ga0207702_10037222
869 Ga0207702_10173553
870 Ga0207641_10204174
871 Ga0207648_10000130
872 Ga0207648_10064265
873 Ga0207648_10064672
874 Ga0207648_10066485
875 Ga0207676_10156850
876 Ga0207674_10005434
877 Ga0207674_10008790
878 Ga0207674_10239562
879 Ga0207675_100000253
880 Ga0207675_100018522
881 Ga0207683_10178537
882 Ga0207698_10236381
883 Ga0207698_10264687
884 Ga0209967_1000731
885 Ga0209981_1001009
886 Ga0209984_1000948
887 Ga0209995_1002532
888 Ga0209968_1001882
889 Ga0209999_1000956
890 Ga0209983_1000928
891 Ga0209588_1044431
892 Ga0209971_1004436
893 Ga0209966_1000256
894 Ga0209998_10000070
895 Ga0209974_10000099
896 Ga0207428_10000721
897 Ga0207428_10000794
898 Ga0207428_10006425
899 Ga0268265_10028859
900 Ga0268265_10038678
901 Ga0268264_10037504
902 Ga0268264_10042535
903 Ga0268264_10143371
904 Ga0268264_10149836
905 Ga0307408_100004301
906 Ga0307408_100160785
907 Ga0307405_10031779
908 Ga0307405_10242940
909 Ga0307412_10222407
910 Ga0307416_100047136
911 Ga0307416_100232448
912 Ga0373948_0003581
913 Ga0373940_0003844
914 Ga0373944_0010354
915 Ga0373936_0000959
916 Ga0373939_0001857
917 Ga0373941_0020213
918 Ga0373941_0073687
919 Ga0373945_0002992
920 Ga0373946_0006410
921 Ga0373955_0012841
922 Ga0373942_0004845
923 Ga0373942_0006378
924 Ga0373961_0010146
925 Ga0373961_0033438
926 Ga0373962_0021994
927 Ga0373924_0008820
928 Ga0373931_0004555
929 Ga0373931_0141349
930 Ga0373935_0011964
931 Ga0373927_0082726
932 Ga0373933_0001569
933 Ga0373947_0067326
934 Ga0373937_0001440
935 Ga0395900_0374052
936 Ga0436360_1309494
937 Ga0439461_0001446
938 Ga0451839_0456736
939 Ga0439441_002359
940 Ga0439455_0000404
941 Ga0439446_0005070
942 Ga0439434_0007668
943 Ga0439459_0001683
944 Ga0439460_0000467
945 Ga0451577_0030057
946 Ga0451577_0064436
947 Ga0453683_0038018
948 Ga0453684_0053783
949 Ga0453684_0187883
950 Ga0453684_0377246
951 Ga0451576_0003101
952 Ga0451576_0014943
953 Ga0451576_0024911
954 Ga0451576_0073051
955 Ga0451576_0098988
956 Ga0451576_0101156
957 Ga0451576_0252735
958 Ga0451576_0400865
959 Ga0451576_0510050
960 Ga0466967_0010071
961 Ga0495603_0044154
962 Ga0495580_0000845
963 Ga0495580_0004779
964 Ga0495580_0031006
965 Ga0495582_0046060
966 Ga0495662_0016646
967 Ga0495630_0046766
968 Ga0495630_0130107
969 Ga0495666_0008044
970 Ga0495642_0015060
971 Ga0495586_0007966
972 Ga0495586_0077795
973 Ga0495598_0004441
974 Ga0495621_0060717
975 Ga0495656_0016044
976 Ga0495659_0006510
977 Ga0495588_0046765
978 Ga0495647_0001586
979 Ga0495669_0045474
980 Ga0495669_0074494
981 Ga0495676_0060585
982 Ga0496102_0049341
983 Ga0496102_0084015
984 Ga0496106_0029604
985 Ga0496106_0164325
986 Ga0501031_0042967
987 Ga0501033_0215223
988 Ga0501033_0292380
989 Ga0501036_0000338
990 Ga0501036_0061415
991 Ga0501036_0120391
992 Ga0501036_0211346
993 Ga0501036_0291388
994 Ga0501037_0019615
995 Ga0501038_0000401
996 Ga0501038_0029223
997 Ga0501039_0001876
998 Ga0501039_0016881
999 Ga0501039_0152677
1000 Ga0501039_0240421
1001 Ga0501040_0000653
1002 Ga0501040_0018245
1003 Ga0501040_0039044
1004 Ga0501041_0029253
1005 Ga0501041_0029519
1006 Ga0501041_0040148
1007 Ga0501041_0058507
1008 Ga0501041_0166326
1009 Ga0501042_0000024
1010 Ga0501042_0008169
1011 Ga0501042_0008561
1012 Ga0501042_0022252
1013 Ga0501042_0038801
1014 Ga0501042_0100646
1015 Ga0501042_0127340
1016 Ga0501042_0157118
1017 Ga0501042_0315331
1018 Ga0501043_0180170
1019 Ga0501043_0218129
1020 Ga0501046_0019373
1021 Ga0501046_0026823
1022 Ga0501046_0079126
1023 Ga0501046_0092413
1024 Ga0501046_0102816
1025 Ga0501046_0112287
1026 Ga0501046_0181946
1027 Ga0501046_0281945
1028 Ga0501047_0065762
1029 Ga0501048_0074683
1030 Ga0501048_0083980
1031 Ga0501048_0199881
1032 Ga0501048_0235441
1033 Ga0501068_0004340
1034 Ga0501068_0008331
1035 Ga0501068_0062093
1036 Ga0501068_0154447
1037 Ga0501069_0046821
1038 Ga0501070_0018693
1039 Ga0501070_0250805
1040 Ga0501071_0000232
1041 Ga0501071_0024558
1042 Ga0501071_0028572
1043 Ga0501071_0071686
1044 Ga0501071_0086989
1045 Ga0501072_0000370
1046 Ga0501072_0004162
1047 Ga0501072_0015729
1048 Ga0501072_0030484
1049 Ga0501072_0031056
1050 Ga0501072_0053905
1051 Ga0501072_0053974
1052 Ga0501072_0065072
1053 Ga0501072_0099823
1054 Ga0501072_0405545
1055 Ga0501073_0258382
1056 Ga0501074_0000394
1057 Ga0501074_0032635
1058 Ga0501074_0066239
1059 Ga0501075_0000149
1060 Ga0501075_0004311
1061 Ga0501075_0007147
1062 Ga0501075_0028294
1063 Ga0501075_0202367
1064 Ga0501076_0000439
1065 Ga0501076_0011961
1066 Ga0501076_0041425
1067 Ga0501076_0049814
1068 Ga0501076_0076927
1069 Ga0501076_0094939
1070 Ga0501076_0104025
1071 Ga0501077_0000816
1072 Ga0501077_0002050
1073 Ga0501077_0007869
1074 Ga0501077_0036174
1075 Ga0501077_0057739
1076 Ga0501077_0117814
1077 Ga0501077_0155896
1078 Ga0501079_0000446
1079 Ga0501079_0001113
1080 Ga0501079_0012858
1081 Ga0501079_0022654
1082 Ga0501079_0028656
1083 Ga0501079_0046601
1084 Ga0501079_0046826
1085 Ga0501079_0132011
1086 Ga0501079_0169389
1087 Ga0501079_0180845
1088 Ga0501080_0001577
1089 Ga0501080_0075763
1090 Ga0501080_0087287
1091 Ga0501080_0088973
1092 Ga0501080_0242657
1093 Ga0501081_0000028
1094 Ga0501081_0000106
1095 Ga0501081_0005345
1096 Ga0501081_0007059
1097 Ga0501081_0013904
1098 Ga0501081_0031757
1099 Ga0501081_0034418
1100 Ga0501081_0038501
1101 Ga0501081_0084412
1102 Ga0501081_0145869
1103 Ga0501081_0164993
1104 Ga0501081_0268891
1105 Ga0501083_0181252
1106 Ga0501035_0027904
1107 Ga0501045_0000638
1108 Ga0501045_0005728
1109 Ga0501045_0019214
1110 Ga0501045_0019403
1111 Ga0501045_0070859
1112 Ga0501045_0087471
1113 nmdc:mga05p37_1829_c1
1114 nmdc:mga05p37_21830_c1
1115 nmdc:mga05p37_294_c1
1116 nmdc:mga05p37_3428_c1
1117 nmdc:mga05p37_473_c2
1118 nmdc:mga05p37_503_c1
1119 nmdc:mga05p37_53958_c1
1120 nmdc:mga05p37_585385_c1
1121 nmdc:mga05p37_76679_c1
1122 nmdc:mga09592_15367_c1
1123 nmdc:mga09592_169697_c1
1124 nmdc:mga09592_217838_c1
1125 nmdc:mga09592_241929_c1
1126 nmdc:mga09592_41545_c1
1127 nmdc:mga09592_5141_c1
1128 nmdc:mga09592_665_c1
1129 nmdc:mga09592_67117_c1
1130 nmdc:mga0qj67_11455_c1
1131 nmdc:mga0qj67_14675_c1
1132 nmdc:mga0qj67_341873_c1
1133 nmdc:mga06r32_11384_c1
1134 nmdc:mga06r32_22246_c1
1135 nmdc:mga06r32_280039_c1
1136 nmdc:mga06r32_35082_c1
1137 nmdc:mga06r32_73362_c1
1138 nmdc:mga06r32_89647_c1
1139 nmdc:mga08y16_14006_c1
1140 nmdc:mga08y16_185763_c1
1141 nmdc:mga08y16_19421_c1
1142 nmdc:mga08y16_21631_c1
1143 nmdc:mga08y16_217486_c1
1144 nmdc:mga08y16_3197_c1
1145 nmdc:mga08y16_8586_c1
1146 nmdc:mga0n895_14201_c1
1147 nmdc:mga0n895_1662_c1
1148 nmdc:mga0n895_197695_c1
1149 nmdc:mga0n895_212762_c1
1150 nmdc:mga0n895_216569_c1
1151 nmdc:mga0rr50_15230_c1
1152 nmdc:mga0rr50_359_c1
1153 nmdc:mga0rr50_38092_c1
1154 nmdc:mga0rr50_67721_c1
1155 nmdc:mga08x19_1000_c1
1156 nmdc:mga08x19_11181_c1
1157 nmdc:mga08x19_13829_c1
1158 nmdc:mga08x19_19389_c1
1159 nmdc:mga08x19_261_c1
1160 nmdc:mga08x19_9220_c1
1161 nmdc:mga0a205_16365_c1
1162 nmdc:mga0a205_26940_c1
1163 nmdc:mga0a205_337085_c1
1164 nmdc:mga0a205_5345_c1
1165 nmdc:mga0a205_75_c1
1166 Ga0501084_0000525
1167 Ga0501084_0008168
1168 Ga0501084_0067064
1169 Ga0501084_0107357
1170 Ga0501084_0208227
1171 Ga0590077_018466
1172 Ga0501082_0000626
1173 Ga0501082_0001643
1174 Ga0501082_0022459
1175 Ga0501082_0030033
1176 Ga0501082_0041252
1177 Ga0501082_0131080
1178 Ga0530510_0000071
1179 Ga0530510_0000932
1180 Ga0530510_0002497
1181 Ga0530510_0009032
1182 Ga0530510_0024049
1183 Ga0530510_0066451
1184 Ga0530510_0080163
1185 Ga0530510_0116679
1186 Ga0530510_0152760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13378

MR_MLE_C

Enolase C-terminal domain-like

183

390

0.97

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

43

162

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hnc-assembly1.cif.gz_B p. putida c92s/k166c/c264s mandelate racemase co-crystallized with benzilic acid 0.9477 2 358
5xd8-assembly1.cif.gz_A crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase 0.946 2 359
3ck5-assembly2.cif.gz_D crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium 0.9424 3 348
5xd7-assembly1.cif.gz_A-2 crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase 0.9418 2 359
4hnc-assembly1.cif.gz_B p. putida c92s/k166c/c264s mandelate racemase co-crystallized with benzilic acid 0.9399 2 358
ID Description Score Start End Superfamily
3uxlA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9373 118 348 3.20.20.120
3ck5D02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9348 118 348 3.20.20.120
5xd9A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9298 117 348 3.20.20.120
4mggG01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9291 1 116 3.30.390.10
4h19A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9278 118 348 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A1P8Y012-F1-model_v4 deleted 0.9509 2 359
AF-A0A6B1EAD3-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme family protein 0.9493 2 359 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-A0A6N8YX23-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme family protein 0.9482 2 359 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-A0A848W4B3-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme N-terminal domain-containing protein 0.9478 1 167 GO:0000287
GO:0016052
GO:0016836
AF-A0A2K8QTU7-F1-model_v4 deleted 0.9459 122 316

Map