F467261

General Info

Members Datasets Scaffolds Average Seq Length
593 218 1186 145

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0317603|Ga0466959_0317603_242_739
Length 165
Sequence VLEAPNEGSDCMKLAGIMTVTMGAAALLAGCSQIRQHKGVVLDPQLVSAIQPGVDNKDSVEKALGRPTFVGQFTPNDWYYVSRDVNAVAFRNPRVTRETVLLVRFDQKGNVASVQRTGKELVMNIAPAHRQTPTLGKKRSFFEELFGNIGSVGTGLPGQGGGPQQ

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
174 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
211 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
212 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
213 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
214 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
215 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
216 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 2.53
Rhizosphere 96.8
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0317603 3300045049 Bacteria 1065
2 JGI24741J21665_1005722 3300001915 Bacteria 2562
3 JGI24741J21665_1009891 3300001915 Bacteria 1730
4 JGI24740J21852_10000689 3300001979 Bacteria 14645
5 JGI24740J21852_10023179 3300001979 Bacteria 2124
6 JGI24740J21852_10045722 3300001979 Bacteria 1290
7 JGI24739J22299_10037335 3300001989 Bacteria 1637
8 JGI24737J22298_10009511 3300001990 Bacteria 3229
9 JGI24737J22298_10153634 3300001990 Bacteria 679
10 JGI24743J22301_10076821 3300001991 Bacteria 701
11 JGI24735J21928_10024602 3300002067 Bacteria 1820
12 JGI24735J21928_10030836 3300002067 Unclassified 1591
13 JGI24735J21928_10080007 3300002067 Bacteria 936
14 JGI24735J21928_10099473 3300002067 Bacteria 835
15 Ga0070658_10001056 3300005327 Bacteria 23556
16 Ga0070658_10038383 3300005327 Bacteria 3862
17 Ga0070658_10056174 3300005327 Bacteria 3199
18 Ga0070658_10065570 3300005327 Bacteria 2964
19 Ga0070676_10814991 3300005328 Bacteria 690
20 Ga0070683_100001823 3300005329 Bacteria 16621
21 Ga0070683_100037555 3300005329 Bacteria 4434
22 Ga0070683_100202837 3300005329 Bacteria 1883
23 Ga0070683_100221898 3300005329 Bacteria 1797
24 Ga0070690_100045693 3300005330 Bacteria 2782
25 Ga0070670_100039992 3300005331 Bacteria 4033
26 Ga0070670_100041927 3300005331 Bacteria 3934
27 Ga0070670_100069330 3300005331 Bacteria 3027
28 Ga0070677_10103269 3300005333 Bacteria 1260
29 Ga0070666_10003605 3300005335 Bacteria 9385
30 Ga0070666_10423900 3300005335 Bacteria 959
31 Ga0070680_100001306 3300005336 Bacteria 18035
32 Ga0070680_100010268 3300005336 Bacteria 7217
33 Ga0070680_100159130 3300005336 Bacteria 1897
34 Ga0070680_100228057 3300005336 Bacteria 1573
35 Ga0070680_100910860 3300005336 Bacteria 759
36 Ga0070682_100025357 3300005337 Bacteria 3537
37 Ga0070682_100038114 3300005337 Bacteria 2947
38 Ga0070682_100083432 3300005337 Bacteria 2074
39 Ga0070682_100211406 3300005337 Bacteria 1375
40 Ga0068868_100013821 3300005338 Bacteria 5933
41 Ga0068868_100074101 3300005338 Bacteria 2718
42 Ga0068868_100583276 3300005338 Bacteria 989
43 Ga0070660_100005078 3300005339 Bacteria 9095
44 Ga0070660_100012698 3300005339 Bacteria 6021
45 Ga0070660_100015172 3300005339 Bacteria 5558
46 Ga0070660_100043088 3300005339 Bacteria 3447
47 Ga0070660_100074881 3300005339 Bacteria 2650
48 Ga0070660_100143118 3300005339 Bacteria 1920
49 Ga0070660_100149535 3300005339 Bacteria 1877
50 Ga0070660_100462252 3300005339 Bacteria 1054
51 Ga0070660_101094165 3300005339 Bacteria 674
52 Ga0070660_101605540 3300005339 Bacteria 553
53 Ga0070689_100178716 3300005340 Bacteria 1723
54 Ga0070691_10000409 3300005341 Bacteria 15673
55 Ga0070661_100023146 3300005344 Bacteria 4451
56 Ga0070661_100059039 3300005344 Bacteria 2812
57 Ga0070661_100079676 3300005344 Bacteria 2417
58 Ga0070661_100154402 3300005344 Bacteria 1736
59 Ga0070661_100416303 3300005344 Bacteria 1064
60 Ga0070692_10017816 3300005345 Bacteria 3404
61 Ga0070668_100795434 3300005347 Unclassified 840
62 Ga0070669_101807382 3300005353 Bacteria 533
63 Ga0070671_100015612 3300005355 Bacteria 6136
64 Ga0070671_100064712 3300005355 Bacteria 3045
65 Ga0070671_100189545 3300005355 Bacteria 1743
66 Ga0070674_100006026 3300005356 Bacteria 7046
67 Ga0070674_100010882 3300005356 Bacteria 5518
68 Ga0070674_100104065 3300005356 Bacteria 2074
69 Ga0070673_100056434 3300005364 Bacteria 3099
70 Ga0070673_100218738 3300005364 Bacteria 1648
71 Ga0070673_100366082 3300005364 Bacteria 1282
72 Ga0070659_100008763 3300005366 Bacteria 7403
73 Ga0070659_100094828 3300005366 Bacteria 2397
74 Ga0070659_100108101 3300005366 Bacteria 2243
75 Ga0070659_100203699 3300005366 Bacteria 1629
76 Ga0070667_100048054 3300005367 Bacteria 3591
77 Ga0070667_100320778 3300005367 Bacteria 1398
78 Ga0070667_100759882 3300005367 Bacteria 899
79 Ga0070709_10093220 3300005434 Bacteria 1990
80 Ga0070714_100040081 3300005435 Bacteria 3947
81 Ga0070714_100240302 3300005435 Bacteria 1671
82 Ga0070714_100514803 3300005435 Unclassified 1142
83 Ga0070713_100037671 3300005436 Bacteria 3911
84 Ga0070713_100049332 3300005436 Bacteria 3472
85 Ga0070663_100000271 3300005455 Bacteria 26098
86 Ga0070663_100020171 3300005455 Bacteria 4409
87 Ga0070663_100057475 3300005455 Bacteria 2790
88 Ga0070663_100240885 3300005455 Bacteria 1427
89 Ga0070663_100278270 3300005455 Bacteria 1333
90 Ga0070663_100324641 3300005455 Bacteria 1239
91 Ga0070678_100000769 3300005456 Bacteria 16071
92 Ga0070678_100428592 3300005456 Bacteria 1154
93 Ga0070662_100023375 3300005457 Bacteria 4244
94 Ga0070662_100046059 3300005457 Bacteria 3133
95 Ga0070662_100055826 3300005457 Bacteria 2866
96 Ga0070662_100089620 3300005457 Bacteria 2307
97 Ga0070662_100097908 3300005457 Bacteria 2214
98 Ga0070662_100107032 3300005457 Bacteria 2125
99 Ga0070662_100111231 3300005457 Bacteria 2087
100 Ga0070662_100152877 3300005457 Bacteria 1798
101 Ga0070662_100302072 3300005457 Bacteria 1301
102 Ga0070662_100720030 3300005457 Unclassified 845
103 Ga0070681_10015737 3300005458 Bacteria 7540
104 Ga0070681_10267754 3300005458 Bacteria 1620
105 Ga0070681_10578927 3300005458 Bacteria 1036
106 Ga0068867_100037833 3300005459 Bacteria 3509
107 Ga0070679_100000346 3300005530 Bacteria 39334
108 Ga0070679_100042041 3300005530 Bacteria 4551
109 Ga0070679_100088397 3300005530 Bacteria 3085
110 Ga0070679_100242160 3300005530 Bacteria 1761
111 Ga0070679_100413868 3300005530 Bacteria 1294
112 Ga0070684_100029252 3300005535 Bacteria 4667
113 Ga0070684_100078595 3300005535 Bacteria 2915
114 Ga0070684_100099144 3300005535 Bacteria 2600
115 Ga0070684_100239135 3300005535 Bacteria 1659
116 Ga0068853_100016129 3300005539 Bacteria 6144
117 Ga0068853_100058406 3300005539 Bacteria 3330
118 Ga0068853_100226870 3300005539 Bacteria 1707
119 Ga0070672_100014410 3300005543 Bacteria 5603
120 Ga0070672_100098487 3300005543 Bacteria 2368
121 Ga0070672_100517225 3300005543 Bacteria 1034
122 Ga0070686_100088908 3300005544 Bacteria 2062
123 Ga0068855_100016546 3300005563 Bacteria 8871
124 Ga0068855_100078086 3300005563 Bacteria 3841
125 Ga0068855_100274112 3300005563 Bacteria 1875
126 Ga0068855_100627221 3300005563 Bacteria 1157
127 Ga0068855_100683712 3300005563 Bacteria 1099
128 Ga0070664_100005852 3300005564 Bacteria 9920
129 Ga0070664_100114874 3300005564 Bacteria 2352
130 Ga0070664_100152227 3300005564 Bacteria 2043
131 Ga0070664_100216283 3300005564 Bacteria 1713
132 Ga0068857_100046323 3300005577 Bacteria 3859
133 Ga0068857_100131197 3300005577 Bacteria 2260
134 Ga0068857_100139547 3300005577 Bacteria 2190
135 Ga0068857_100347285 3300005577 Bacteria 1373
136 Ga0068854_100014136 3300005578 Bacteria 5256
137 Ga0068854_100035932 3300005578 Bacteria 3471
138 Ga0068854_100164242 3300005578 Bacteria 1722
139 Ga0068854_100223921 3300005578 Bacteria 1489
140 Ga0068854_100450789 3300005578 Bacteria 1074
141 Ga0068854_100973588 3300005578 Bacteria 750
142 Ga0068856_100092775 3300005614 Bacteria 3005
143 Ga0068856_100124962 3300005614 Bacteria 2576
144 Ga0068856_100160446 3300005614 Bacteria 2259
145 Ga0068856_100463862 3300005614 Bacteria 1287
146 Ga0068852_100012196 3300005616 Bacteria 6513
147 Ga0068852_100049356 3300005616 Bacteria 3600
148 Ga0068852_100151250 3300005616 Bacteria 2158
149 Ga0068852_100334783 3300005616 Bacteria 1474
150 Ga0068852_100370249 3300005616 Bacteria 1403
151 Ga0068852_100388458 3300005616 Bacteria 1370
152 Ga0068859_100014107 3300005617 Bacteria 8014
153 Ga0068864_100109266 3300005618 Bacteria 2462
154 Ga0068866_10135258 3300005718 Bacteria 1408
155 Ga0068866_10572557 3300005718 Bacteria 758
156 Ga0068861_101549679 3300005719 Bacteria 651
157 Ga0068851_10006169 3300005834 Bacteria 5470
158 Ga0068851_10035563 3300005834 Bacteria 2490
159 Ga0068863_100051639 3300005841 Bacteria 3896
160 Ga0068863_100079457 3300005841 Bacteria 3106
161 Ga0068858_100173478 3300005842 Bacteria 2034
162 Ga0068860_100061450 3300005843 Bacteria 3570
163 Ga0081539_10046464 3300005985 Bacteria 2487
164 Ga0081539_10090383 3300005985 Bacteria 1583
165 Ga0070717_10049649 3300006028 Bacteria 3445
166 Ga0070716_100074970 3300006173 Bacteria 2001
167 Ga0070712_100154685 3300006175 Bacteria 1764
168 Ga0075369_10191248 3300006186 Bacteria 943
169 Ga0068871_100095208 3300006358 Bacteria 2486
170 Ga0068871_100423117 3300006358 Bacteria 1190
171 Ga0068871_101160003 3300006358 Bacteria 724
172 Ga0068865_100091166 3300006881 Bacteria 2211
173 Ga0097620_100014105 3300006931 Bacteria 8014
174 Ga0105240_10040700 3300009093 Bacteria 5941
175 Ga0105240_10282688 3300009093 Bacteria 1905
176 Ga0105240_10401458 3300009093 Unclassified 1544
177 Ga0105245_10029221 3300009098 Bacteria 4869
178 Ga0105245_10053647 3300009098 Bacteria 3619
179 Ga0105247_10433933 3300009101 Bacteria 943
180 Ga0105243_10166601 3300009148 Bacteria 1905
181 Ga0105243_11646984 3300009148 Bacteria 669
182 Ga0105241_10063792 3300009174 Bacteria 2844
183 Ga0105241_10093064 3300009174 Bacteria 2381
184 Ga0105242_10065877 3300009176 Bacteria 2990
185 Ga0105248_10138282 3300009177 Bacteria 2748
186 Ga0105248_10159406 3300009177 Bacteria 2545
187 Ga0105248_10383357 3300009177 Bacteria 1583
188 Ga0105248_10419049 3300009177 Bacteria 1508
189 Ga0105248_10660951 3300009177 Bacteria 1179
190 Ga0105237_10036590 3300009545 Bacteria 4968
191 Ga0105238_10017206 3300009551 Bacteria 7343
192 Ga0105238_10090623 3300009551 Bacteria 3045
193 Ga0105238_10635167 3300009551 Unclassified 1077
194 Ga0105249_10134792 3300009553 Bacteria 2362
195 Ga0105239_10168165 3300010375 Bacteria 2452
196 Ga0105239_10943681 3300010375 Bacteria 991
197 Ga0105246_10121185 3300011119 Bacteria 1938
198 Ga0157373_10009496 3300013100 Bacteria 7185
199 Ga0157373_10014195 3300013100 Bacteria 5842
200 Ga0157373_10022420 3300013100 Bacteria 4582
201 Ga0157373_10095330 3300013100 Bacteria 2094
202 Ga0157371_10023622 3300013102 Bacteria 4496
203 Ga0157371_10112923 3300013102 Bacteria 1929
204 Ga0157371_10119802 3300013102 Bacteria 1871
205 Ga0157371_10140855 3300013102 Bacteria 1718
206 Ga0157371_10143100 3300013102 Unclassified 1703
207 Ga0157371_10285992 3300013102 Bacteria 1192
208 Ga0157371_10751054 3300013102 Bacteria 733
209 Ga0157370_10041857 3300013104 Bacteria 4417
210 Ga0157370_10120097 3300013104 Bacteria 2454
211 Ga0157370_10285304 3300013104 Bacteria 1525
212 Ga0157370_10720652 3300013104 Bacteria 910
213 Ga0157369_10027719 3300013105 Bacteria 6276
214 Ga0157369_10067039 3300013105 Bacteria 3860
215 Ga0157369_10374297 3300013105 Bacteria 1478
216 Ga0157369_10481629 3300013105 Bacteria 1284
217 Ga0157369_11007549 3300013105 Bacteria 853
218 Ga0157374_10271812 3300013296 Bacteria 1671
219 Ga0157378_10287344 3300013297 Bacteria 1587
220 Ga0157378_10337823 3300013297 Bacteria 1468
221 Ga0157378_10499390 3300013297 Unclassified 1215
222 Ga0157378_10510346 3300013297 Bacteria 1202
223 Ga0163162_11014255 3300013306 Bacteria 939
224 Ga0157372_10009331 3300013307 Bacteria 10439
225 Ga0157372_10190333 3300013307 Bacteria 2377
226 Ga0157372_10229993 3300013307 Bacteria 2149
227 Ga0157375_12341738 3300013308 Bacteria 637
228 Ga0157375_12438379 3300013308 Bacteria 624
229 Ga0163163_10023665 3300014325 Bacteria 5832
230 Ga0163163_10171657 3300014325 Bacteria 2215
231 Ga0157377_10435701 3300014745 Bacteria 901
232 Ga0157379_10388586 3300014968 Bacteria 1281
233 Ga0157376_10160321 3300014969 Bacteria 2038
234 Ga0163161_10801591 3300017792 Bacteria 791
235 Ga0213876_10025219 3300021384 Bacteria 3137
236 Ga0207697_10135408 3300025315 Bacteria 1066
237 Ga0207656_10033306 3300025321 Bacteria 2145
238 Ga0207656_10087471 3300025321 Bacteria 1410
239 Ga0207656_10153645 3300025321 Bacteria 1091
240 Ga0207682_10110200 3300025893 Bacteria 1211
241 Ga0207642_10031911 3300025899 Bacteria 2212
242 Ga0207710_10120763 3300025900 Bacteria 1251
243 Ga0207688_10319324 3300025901 Bacteria 953
244 Ga0207680_10005893 3300025903 Bacteria 5885
245 Ga0207680_10250061 3300025903 Bacteria 1224
246 Ga0207680_10705191 3300025903 Bacteria 723
247 Ga0207647_10003739 3300025904 Bacteria 11377
248 Ga0207647_10014330 3300025904 Bacteria 5465
249 Ga0207647_10067658 3300025904 Bacteria 2164
250 Ga0207647_10098488 3300025904 Bacteria 1737
251 Ga0207647_10189479 3300025904 Bacteria 1192
252 Ga0207699_10375315 3300025906 Unclassified 1008
253 Ga0207705_10000270 3300025909 Bacteria 49639
254 Ga0207705_10001164 3300025909 Bacteria 21416
255 Ga0207705_10016806 3300025909 Bacteria 5239
256 Ga0207705_10029587 3300025909 Bacteria 3904
257 Ga0207705_10053870 3300025909 Bacteria 2899
258 Ga0207705_10220198 3300025909 Bacteria 1441
259 Ga0207705_10225197 3300025909 Bacteria 1425
260 Ga0207707_10015148 3300025912 Bacteria 6712
261 Ga0207707_10514813 3300025912 Unclassified 1019
262 Ga0207695_10016399 3300025913 Bacteria 8668
263 Ga0207695_10357387 3300025913 Bacteria 1347
264 Ga0207695_10849548 3300025913 Bacteria 793
265 Ga0207671_10068459 3300025914 Bacteria 2645
266 Ga0207693_10114256 3300025915 Bacteria 2119
267 Ga0207660_10054458 3300025917 Bacteria 2855
268 Ga0207660_10213089 3300025917 Bacteria 1513
269 Ga0207660_10392159 3300025917 Bacteria 1117
270 Ga0207660_10625855 3300025917 Bacteria 877
271 Ga0207657_10001091 3300025919 Bacteria 28769
272 Ga0207657_10005832 3300025919 Bacteria 12831
273 Ga0207657_10006264 3300025919 Bacteria 12367
274 Ga0207657_10014344 3300025919 Bacteria 7739
275 Ga0207657_10020199 3300025919 Bacteria 6301
276 Ga0207657_10044279 3300025919 Bacteria 3914
277 Ga0207657_10049588 3300025919 Bacteria 3657
278 Ga0207657_10129142 3300025919 Bacteria 2073
279 Ga0207657_10219045 3300025919 Bacteria 1525
280 Ga0207657_10252079 3300025919 Bacteria 1407
281 Ga0207649_10017659 3300025920 Bacteria 4044
282 Ga0207649_10082601 3300025920 Bacteria 2083
283 Ga0207649_10085153 3300025920 Bacteria 2056
284 Ga0207649_10160432 3300025920 Bacteria 1558
285 Ga0207649_10227690 3300025920 Bacteria 1331
286 Ga0207652_10000058 3300025921 Bacteria 113620
287 Ga0207652_10263361 3300025921 Bacteria 1555
288 Ga0207652_10277346 3300025921 Bacteria 1512
289 Ga0207652_10520250 3300025921 Bacteria 1070
290 Ga0207652_10674587 3300025921 Bacteria 923
291 Ga0207694_10016284 3300025924 Bacteria 5611
292 Ga0207694_10535245 3300025924 Bacteria 982
293 Ga0207650_10013001 3300025925 Bacteria 5757
294 Ga0207650_10316593 3300025925 Bacteria 1277
295 Ga0207650_10381033 3300025925 Bacteria 1165
296 Ga0207659_10214589 3300025926 Bacteria 1544
297 Ga0207687_10093417 3300025927 Bacteria 2199
298 Ga0207687_10094797 3300025927 Bacteria 2185
299 Ga0207700_10076130 3300025928 Bacteria 2603
300 Ga0207664_10069018 3300025929 Bacteria 2841
301 Ga0207664_10119157 3300025929 Bacteria 2206
302 Ga0207664_10207430 3300025929 Bacteria 1694
303 Ga0207664_10569920 3300025929 Bacteria 1016
304 Ga0207644_10000240 3300025931 Bacteria 37642
305 Ga0207644_10003730 3300025931 Bacteria 9879
306 Ga0207644_10018601 3300025931 Bacteria 4703
307 Ga0207644_10063018 3300025931 Bacteria 2691
308 Ga0207690_10022833 3300025932 Bacteria 3896
309 Ga0207690_10051701 3300025932 Bacteria 2749
310 Ga0207690_10155935 3300025932 Bacteria 1697
311 Ga0207706_10005424 3300025933 Bacteria 11885
312 Ga0207706_10011390 3300025933 Bacteria 8101
313 Ga0207706_10029785 3300025933 Bacteria 4871
314 Ga0207706_10063260 3300025933 Bacteria 3258
315 Ga0207706_10095623 3300025933 Bacteria 2613
316 Ga0207706_10146747 3300025933 Bacteria 2075
317 Ga0207706_10237012 3300025933 Bacteria 1595
318 Ga0207706_10732145 3300025933 Bacteria 843
319 Ga0207686_10051430 3300025934 Bacteria 2566
320 Ga0207670_10206936 3300025936 Bacteria 1494
321 Ga0207669_10004611 3300025937 Bacteria 6084
322 Ga0207669_10046403 3300025937 Bacteria 2567
323 Ga0207704_10110278 3300025938 Bacteria 1858
324 Ga0207665_10009130 3300025939 Bacteria 6508
325 Ga0207691_10001687 3300025940 Bacteria 21797
326 Ga0207691_10030408 3300025940 Bacteria 5046
327 Ga0207691_10172338 3300025940 Bacteria 1894
328 Ga0207691_10184212 3300025940 Bacteria 1823
329 Ga0207691_10729766 3300025940 Bacteria 835
330 Ga0207711_10101555 3300025941 Bacteria 2545
331 Ga0207711_10236499 3300025941 Bacteria 1674
332 Ga0207711_10345847 3300025941 Bacteria 1377
333 Ga0207711_10763811 3300025941 Bacteria 901
334 Ga0207689_10292848 3300025942 Bacteria 1348
335 Ga0207661_10002950 3300025944 Bacteria 11762
336 Ga0207661_10006156 3300025944 Bacteria 8479
337 Ga0207661_10177410 3300025944 Bacteria 1858
338 Ga0207679_10054901 3300025945 Bacteria 2935
339 Ga0207679_10173681 3300025945 Bacteria 1776
340 Ga0207667_10006485 3300025949 Bacteria 14155
341 Ga0207667_10007276 3300025949 Bacteria 13348
342 Ga0207667_10067036 3300025949 Bacteria 3739
343 Ga0207667_10340594 3300025949 Bacteria 1530
344 Ga0207651_10017127 3300025960 Bacteria 4271
345 Ga0207651_10025946 3300025960 Bacteria 3651
346 Ga0207712_10108441 3300025961 Bacteria 2078
347 Ga0207640_10156367 3300025981 Bacteria 1681
348 Ga0207658_10329170 3300025986 Bacteria 1324
349 Ga0207677_10110564 3300026023 Bacteria 2045
350 Ga0207677_10151616 3300026023 Bacteria 1789
351 Ga0207677_10392753 3300026023 Bacteria 1174
352 Ga0207677_10570996 3300026023 Bacteria 989
353 Ga0207703_10195283 3300026035 Bacteria 1795
354 Ga0207639_10011524 3300026041 Bacteria 6142
355 Ga0207639_10596669 3300026041 Bacteria 1018
356 Ga0207639_11366950 3300026041 Bacteria 665
357 Ga0207678_10000217 3300026067 Bacteria 51179
358 Ga0207678_10013399 3300026067 Bacteria 7196
359 Ga0207678_10042492 3300026067 Bacteria 3937
360 Ga0207678_10084913 3300026067 Bacteria 2707
361 Ga0207678_10093023 3300026067 Bacteria 2576
362 Ga0207678_10295579 3300026067 Bacteria 1391
363 Ga0207678_10507791 3300026067 Bacteria 1051
364 Ga0207702_10006826 3300026078 Bacteria 9788
365 Ga0207702_10034448 3300026078 Bacteria 4233
366 Ga0207702_10060193 3300026078 Bacteria 3237
367 Ga0207702_10073485 3300026078 Bacteria 2948
368 Ga0207702_10175767 3300026078 Bacteria 1967
369 Ga0207702_10364042 3300026078 Unclassified 1386
370 Ga0207641_10051016 3300026088 Bacteria 3502
371 Ga0207641_10063930 3300026088 Bacteria 3144
372 Ga0207648_10005651 3300026089 Bacteria 12555
373 Ga0207676_10065741 3300026095 Bacteria 2889
374 Ga0207676_10069060 3300026095 Bacteria 2828
375 Ga0207676_10707793 3300026095 Bacteria 976
376 Ga0207674_10001184 3300026116 Bacteria 33891
377 Ga0207674_10006941 3300026116 Bacteria 13262
378 Ga0207674_10010273 3300026116 Bacteria 10623
379 Ga0207674_10106556 3300026116 Bacteria 2780
380 Ga0207683_10002053 3300026121 Bacteria 17819
381 Ga0207683_10005631 3300026121 Bacteria 10745
382 Ga0207698_10006959 3300026142 Bacteria 7076
383 Ga0207698_10023171 3300026142 Bacteria 4332
384 Ga0207698_10168180 3300026142 Bacteria 1927
385 Ga0207698_10175620 3300026142 Bacteria 1891
386 Ga0207698_10488571 3300026142 Bacteria 1196
387 Ga0207698_10494380 3300026142 Bacteria 1189
388 Ga0207698_11143095 3300026142 Bacteria 792
389 Ga0268264_10331502 3300028381 Bacteria 1442
390 Ga0307408_100396767 3300031548 Bacteria 1183
391 Ga0307405_10009277 3300031731 Bacteria 5035
392 Ga0307405_11077271 3300031731 Bacteria 689
393 Ga0307410_10006341 3300031852 Bacteria 6375
394 Ga0307410_10233451 3300031852 Bacteria 1421
395 Ga0307406_10012050 3300031901 Bacteria 4918
396 Ga0307406_10411101 3300031901 Bacteria 1075
397 Ga0307406_10883956 3300031901 Bacteria 760
398 Ga0307407_10286762 3300031903 Bacteria 1142
399 Ga0307409_100008784 3300031995 Bacteria 6159
400 Ga0307409_101146130 3300031995 Unclassified 800
401 Ga0307416_100013572 3300032002 Bacteria 5544
402 Ga0307416_100934603 3300032002 Bacteria 968
403 Ga0307416_101116038 3300032002 Bacteria 893
404 Ga0307414_10403296 3300032004 Bacteria 1188
405 Ga0307414_10417713 3300032004 Bacteria 1169
406 Ga0307414_10610117 3300032004 Bacteria 979
407 Ga0307411_10016424 3300032005 Bacteria 4188
408 Ga0307415_100014029 3300032126 Bacteria 4695
409 Ga0307415_100063510 3300032126 Bacteria 2566
410 Ga0373939_0086062 3300035114 Bacteria 1054
411 Ga0373941_0236957 3300035115 Unclassified 707
412 Ga0373941_0419144 3300035115 Bacteria 557
413 Ga0373960_0047296 3300035121 Bacteria 1265
414 Ga0373942_0027819 3300035207 Bacteria 1474
415 Ga0373931_0073121 3300035691 Bacteria 1876
416 Ga0373935_0006082 3300035692 Bacteria 7177
417 Ga0373937_0892496 3300036401 Bacteria 838
418 Ga0373925_0493706 3300037068 Bacteria 1005
419 Ga0373925_0829486 3300037068 Unclassified 762
420 Ga0395899_0000998 3300037312 Bacteria 25996
421 Ga0395899_0005178 3300037312 Bacteria 10146
422 Ga0395899_0022713 3300037312 Bacteria 4752
423 Ga0395899_0046356 3300037312 Bacteria 3238
424 Ga0395899_0057412 3300037312 Bacteria 2873
425 Ga0395899_0062099 3300037312 Bacteria 2751
426 Ga0395899_0077905 3300037312 Bacteria 2417
427 Ga0395899_0168464 3300037312 Bacteria 1543
428 Ga0395899_0305507 3300037312 Bacteria 1075
429 Ga0395899_0811123 3300037312 Unclassified 577
430 Ga0395900_0000290 3300037418 Bacteria 75444
431 Ga0395900_0004722 3300037418 Bacteria 14370
432 Ga0395900_0020873 3300037418 Bacteria 6693
433 Ga0395900_0023551 3300037418 Bacteria 6301
434 Ga0395900_0027076 3300037418 Bacteria 5869
435 Ga0395900_0031149 3300037418 Bacteria 5479
436 Ga0395900_0036434 3300037418 Bacteria 5072
437 Ga0395900_0040170 3300037418 Bacteria 4821
438 Ga0395900_0087831 3300037418 Bacteria 3195
439 Ga0395900_0097447 3300037418 Bacteria 3021
440 Ga0395900_0130828 3300037418 Bacteria 2572
441 Ga0395900_0132099 3300037418 Bacteria 2558
442 Ga0395900_0185552 3300037418 Bacteria 2111
443 Ga0395900_0346001 3300037418 Bacteria 1461
444 Ga0395900_0570912 3300037418 Bacteria 1074
445 Ga0395900_0760162 3300037418 Bacteria 899
446 Ga0395900_0937056 3300037418 Unclassified 788
447 Ga0395898_0000054 3300037466 Bacteria 279561
448 Ga0395898_0002537 3300037466 Bacteria 21412
449 Ga0395898_0041709 3300037466 Bacteria 4531
450 Ga0395898_0046066 3300037466 Bacteria 4284
451 Ga0395898_0085501 3300037466 Bacteria 3040
452 Ga0395898_0147552 3300037466 Bacteria 2251
453 Ga0395898_0169260 3300037466 Bacteria 2088
454 Ga0395898_0461849 3300037466 Bacteria 1209
455 Ga0395898_0693281 3300037466 Bacteria 960
456 Ga0395905_0000046 3300037471 Bacteria 240463
457 Ga0395905_0001943 3300037471 Bacteria 23692
458 Ga0395905_0004198 3300037471 Bacteria 15079
459 Ga0395905_0004285 3300037471 Bacteria 14873
460 Ga0395905_0008539 3300037471 Bacteria 10101
461 Ga0395905_0013007 3300037471 Bacteria 7996
462 Ga0395905_0022580 3300037471 Bacteria 5950
463 Ga0395905_0030628 3300037471 Bacteria 5067
464 Ga0395905_0041705 3300037471 Bacteria 4307
465 Ga0395905_0068148 3300037471 Bacteria 3333
466 Ga0395905_0070818 3300037471 Bacteria 3268
467 Ga0395905_0091208 3300037471 Bacteria 2857
468 Ga0395905_0103871 3300037471 Bacteria 2667
469 Ga0395905_0108083 3300037471 Bacteria 2611
470 Ga0395905_0117679 3300037471 Bacteria 2497
471 Ga0395905_0132817 3300037471 Bacteria 2341
472 Ga0395905_0203216 3300037471 Bacteria 1857
473 Ga0395905_0332294 3300037471 Bacteria 1410
474 Ga0395905_0355449 3300037471 Bacteria 1357
475 Ga0395905_0414838 3300037471 Bacteria 1242
476 Ga0395905_0548693 3300037471 Bacteria 1057
477 Ga0395905_0666466 3300037471 Bacteria 942
478 Ga0395901_0000102 3300038443 Bacteria 115611
479 Ga0395901_0004019 3300038443 Bacteria 14813
480 Ga0395901_0005414 3300038443 Bacteria 12914
481 Ga0395901_0008454 3300038443 Bacteria 10402
482 Ga0395901_0018700 3300038443 Bacteria 7077
483 Ga0395901_0020521 3300038443 Bacteria 6763
484 Ga0395901_0026838 3300038443 Bacteria 5913
485 Ga0395901_0027538 3300038443 Bacteria 5840
486 Ga0395901_0037708 3300038443 Bacteria 4999
487 Ga0395901_0045144 3300038443 Bacteria 4572
488 Ga0395901_0088454 3300038443 Bacteria 3240
489 Ga0395901_0093089 3300038443 Bacteria 3155
490 Ga0395901_0387860 3300038443 Bacteria 1437
491 Ga0395901_0405058 3300038443 Bacteria 1401
492 Ga0395901_0432486 3300038443 Unclassified 1348
493 Ga0395901_0926438 3300038443 Bacteria 851
494 Ga0436365_0512070 3300039437 Bacteria 14106
495 Ga0439465_0130057 3300041413 Bacteria 888
496 Ga0439448_0007029 3300042005 Bacteria 3250
497 Ga0439448_0065618 3300042005 Bacteria 1204
498 Ga0439448_0122428 3300042005 Bacteria 893
499 Ga0439449_0056262 3300042007 Bacteria 1453
500 Ga0439455_0042906 3300042012 Bacteria 1163
501 Ga0439458_0000063 3300042157 Bacteria 18856
502 Ga0466969_0009917 3300044656 Bacteria 5050
503 Ga0466969_0247649 3300044656 Bacteria 808
504 Ga0466972_0377970 3300044658 Bacteria 663
505 Ga0466965_0069559 3300044683 Bacteria 1769
506 Ga0466965_0290830 3300044683 Bacteria 884
507 Ga0466966_0024889 3300044684 Bacteria 3914
508 Ga0466966_0047119 3300044684 Bacteria 2750
509 Ga0466966_0063729 3300044684 Bacteria 2322
510 Ga0466966_0261772 3300044684 Bacteria 1041
511 Ga0466961_0012394 3300044693 Bacteria 5452
512 Ga0466961_0053844 3300044693 Bacteria 2567
513 Ga0466961_0075632 3300044693 Bacteria 2135
514 Ga0466961_0098881 3300044693 Bacteria 1839
515 Ga0466961_0130120 3300044693 Bacteria 1577
516 Ga0466961_0237332 3300044693 Bacteria 1121
517 Ga0466961_0375578 3300044693 Bacteria 864
518 Ga0466963_0003274 3300044694 Bacteria 9230
519 Ga0466963_0023726 3300044694 Bacteria 3899
520 Ga0466963_0162440 3300044694 Bacteria 1555
521 Ga0466963_0221579 3300044694 Bacteria 1325
522 Ga0466964_0004751 3300044706 Bacteria 5021
523 Ga0466964_0312828 3300044706 Bacteria 795
524 Ga0466971_0032186 3300044719 Bacteria 2349
525 Ga0466971_0085200 3300044719 Bacteria 1444
526 Ga0466968_0019965 3300044735 Bacteria 2701
527 Ga0466968_0378315 3300044735 Bacteria 691
528 Ga0466970_0016451 3300044765 Bacteria 3814
529 Ga0466970_0360685 3300044765 Bacteria 825
530 Ga0466970_0380630 3300044765 Unclassified 803
531 Ga0466970_0521828 3300044765 Bacteria 685
532 Ga0466957_0008674 3300044842 Bacteria 5788
533 Ga0466957_0065228 3300044842 Bacteria 2242
534 Ga0466957_0130337 3300044842 Bacteria 1610
535 Ga0466960_0363158 3300044901 Bacteria 828
536 Ga0466960_0401982 3300044901 Bacteria 789
537 Ga0466959_0017235 3300045049 Bacteria 5291
538 Ga0466959_0045185 3300045049 Bacteria 3244
539 Ga0466959_0068016 3300045049 Bacteria 2581
540 Ga0466959_0129536 3300045049 Bacteria 1788
541 Ga0466959_0534062 3300045049 Bacteria 792
542 Ga0466959_0771065 3300045049 Bacteria 643
543 Ga0466958_0003912 3300045836 Bacteria 7802
544 Ga0466958_0013466 3300045836 Bacteria 4657
545 Ga0466958_0025403 3300045836 Bacteria 3493
546 Ga0466958_0094006 3300045836 Bacteria 1857
547 Ga0466958_0412441 3300045836 Bacteria 873
548 Ga0466958_0994287 3300045836 Bacteria 547
549 Ga0466967_0029964 3300045976 Bacteria 4561
550 Ga0466967_0126652 3300045976 Bacteria 2366
551 Ga0466967_0129230 3300045976 Bacteria 2344
552 Ga0466967_0293253 3300045976 Bacteria 1563
553 Ga0466967_1137170 3300045976 Bacteria 778
554 Ga0466967_1168957 3300045976 Unclassified 767
555 Ga0466967_1242871 3300045976 Bacteria 742
556 Ga0466967_1295252 3300045976 Bacteria 726
557 Ga0495598_0004155 3300046537 Bacteria 3118
558 Ga0495621_0000406 3300046539 Bacteria 10609
559 Ga0495633_0324913 3300046558 Bacteria 698
560 Ga0495669_0011308 3300046684 Bacteria 3789
561 Ga0495669_0087141 3300046684 Bacteria 1438
562 Ga0495669_0266300 3300046684 Bacteria 824
563 Ga0495669_0405264 3300046684 Bacteria 661
564 Ga0495670_0000148 3300046691 Bacteria 30968
565 Ga0495674_0487117 3300047319 Unclassified 988
566 Ga0495677_0003645 3300047445 Bacteria 5962
567 Ga0496101_0000216 3300048904 Bacteria 43445
568 Ga0496101_0516416 3300048904 Bacteria 944
569 Ga0496102_0280375 3300048905 Bacteria 1571
570 Ga0496103_0087749 3300048906 Bacteria 1961
571 Ga0496104_0118828 3300048907 Bacteria 2538
572 Ga0496105_0100693 3300048908 Bacteria 2386
573 Ga0496106_0004559 3300048909 Bacteria 10269
574 Ga0496107_0019478 3300048910 Bacteria 4787
575 Ga0496107_0788335 3300048910 Bacteria 696
576 Ga0496108_0009355 3300048911 Bacteria 7933
577 Ga0496110_0000132 3300048913 Bacteria 42838
578 Ga0496111_0001206 3300048914 Bacteria 14423
579 Ga0496111_0179858 3300048914 Bacteria 1572
580 Ga0496113_0000182 3300048916 Bacteria 28189
581 Ga0496114_0271979 3300048917 Bacteria 1493
582 Ga0501067_0073570 3300049583 Bacteria 1893
583 Ga0501069_0243685 3300049585 Bacteria 1048
584 Ga0501201_008818 3300049651 Bacteria 976
585 Ga0501249_072098 3300049679 Bacteria 807
586 Ga0501257_106249 3300049686 Bacteria 741
587 Ga0501258_003961 3300049687 Unclassified 1382
588 Ga0501263_030559 3300049760 Bacteria 760
589 Ga0501266_029034 3300049763 Bacteria 783
590 Ga0501270_054900 3300049767 Bacteria 732
591 nmdc:mga00v17_95277_c1 3300050491 Bacteria 1873
592 Ga0466962_0003228 3300061719 Bacteria 7748
593 Ga0466962_0238393 3300061719 Bacteria 892
594 Ga0466959_0317603
595 JGI24741J21665_1005722
596 JGI24741J21665_1009891
597 JGI24740J21852_10000689
598 JGI24740J21852_10023179
599 JGI24740J21852_10045722
600 JGI24739J22299_10037335
601 JGI24737J22298_10009511
602 JGI24737J22298_10153634
603 JGI24743J22301_10076821
604 JGI24735J21928_10024602
605 JGI24735J21928_10030836
606 JGI24735J21928_10080007
607 JGI24735J21928_10099473
608 Ga0070658_10001056
609 Ga0070658_10038383
610 Ga0070658_10056174
611 Ga0070658_10065570
612 Ga0070676_10814991
613 Ga0070683_100001823
614 Ga0070683_100037555
615 Ga0070683_100202837
616 Ga0070683_100221898
617 Ga0070690_100045693
618 Ga0070670_100039992
619 Ga0070670_100041927
620 Ga0070670_100069330
621 Ga0070677_10103269
622 Ga0070666_10003605
623 Ga0070666_10423900
624 Ga0070680_100001306
625 Ga0070680_100010268
626 Ga0070680_100159130
627 Ga0070680_100228057
628 Ga0070680_100910860
629 Ga0070682_100025357
630 Ga0070682_100038114
631 Ga0070682_100083432
632 Ga0070682_100211406
633 Ga0068868_100013821
634 Ga0068868_100074101
635 Ga0068868_100583276
636 Ga0070660_100005078
637 Ga0070660_100012698
638 Ga0070660_100015172
639 Ga0070660_100043088
640 Ga0070660_100074881
641 Ga0070660_100143118
642 Ga0070660_100149535
643 Ga0070660_100462252
644 Ga0070660_101094165
645 Ga0070660_101605540
646 Ga0070689_100178716
647 Ga0070691_10000409
648 Ga0070661_100023146
649 Ga0070661_100059039
650 Ga0070661_100079676
651 Ga0070661_100154402
652 Ga0070661_100416303
653 Ga0070692_10017816
654 Ga0070668_100795434
655 Ga0070669_101807382
656 Ga0070671_100015612
657 Ga0070671_100064712
658 Ga0070671_100189545
659 Ga0070674_100006026
660 Ga0070674_100010882
661 Ga0070674_100104065
662 Ga0070673_100056434
663 Ga0070673_100218738
664 Ga0070673_100366082
665 Ga0070659_100008763
666 Ga0070659_100094828
667 Ga0070659_100108101
668 Ga0070659_100203699
669 Ga0070667_100048054
670 Ga0070667_100320778
671 Ga0070667_100759882
672 Ga0070709_10093220
673 Ga0070714_100040081
674 Ga0070714_100240302
675 Ga0070714_100514803
676 Ga0070713_100037671
677 Ga0070713_100049332
678 Ga0070663_100000271
679 Ga0070663_100020171
680 Ga0070663_100057475
681 Ga0070663_100240885
682 Ga0070663_100278270
683 Ga0070663_100324641
684 Ga0070678_100000769
685 Ga0070678_100428592
686 Ga0070662_100023375
687 Ga0070662_100046059
688 Ga0070662_100055826
689 Ga0070662_100089620
690 Ga0070662_100097908
691 Ga0070662_100107032
692 Ga0070662_100111231
693 Ga0070662_100152877
694 Ga0070662_100302072
695 Ga0070662_100720030
696 Ga0070681_10015737
697 Ga0070681_10267754
698 Ga0070681_10578927
699 Ga0068867_100037833
700 Ga0070679_100000346
701 Ga0070679_100042041
702 Ga0070679_100088397
703 Ga0070679_100242160
704 Ga0070679_100413868
705 Ga0070684_100029252
706 Ga0070684_100078595
707 Ga0070684_100099144
708 Ga0070684_100239135
709 Ga0068853_100016129
710 Ga0068853_100058406
711 Ga0068853_100226870
712 Ga0070672_100014410
713 Ga0070672_100098487
714 Ga0070672_100517225
715 Ga0070686_100088908
716 Ga0068855_100016546
717 Ga0068855_100078086
718 Ga0068855_100274112
719 Ga0068855_100627221
720 Ga0068855_100683712
721 Ga0070664_100005852
722 Ga0070664_100114874
723 Ga0070664_100152227
724 Ga0070664_100216283
725 Ga0068857_100046323
726 Ga0068857_100131197
727 Ga0068857_100139547
728 Ga0068857_100347285
729 Ga0068854_100014136
730 Ga0068854_100035932
731 Ga0068854_100164242
732 Ga0068854_100223921
733 Ga0068854_100450789
734 Ga0068854_100973588
735 Ga0068856_100092775
736 Ga0068856_100124962
737 Ga0068856_100160446
738 Ga0068856_100463862
739 Ga0068852_100012196
740 Ga0068852_100049356
741 Ga0068852_100151250
742 Ga0068852_100334783
743 Ga0068852_100370249
744 Ga0068852_100388458
745 Ga0068859_100014107
746 Ga0068864_100109266
747 Ga0068866_10135258
748 Ga0068866_10572557
749 Ga0068861_101549679
750 Ga0068851_10006169
751 Ga0068851_10035563
752 Ga0068863_100051639
753 Ga0068863_100079457
754 Ga0068858_100173478
755 Ga0068860_100061450
756 Ga0081539_10046464
757 Ga0081539_10090383
758 Ga0070717_10049649
759 Ga0070716_100074970
760 Ga0070712_100154685
761 Ga0075369_10191248
762 Ga0068871_100095208
763 Ga0068871_100423117
764 Ga0068871_101160003
765 Ga0068865_100091166
766 Ga0097620_100014105
767 Ga0105240_10040700
768 Ga0105240_10282688
769 Ga0105240_10401458
770 Ga0105245_10029221
771 Ga0105245_10053647
772 Ga0105247_10433933
773 Ga0105243_10166601
774 Ga0105243_11646984
775 Ga0105241_10063792
776 Ga0105241_10093064
777 Ga0105242_10065877
778 Ga0105248_10138282
779 Ga0105248_10159406
780 Ga0105248_10383357
781 Ga0105248_10419049
782 Ga0105248_10660951
783 Ga0105237_10036590
784 Ga0105238_10017206
785 Ga0105238_10090623
786 Ga0105238_10635167
787 Ga0105249_10134792
788 Ga0105239_10168165
789 Ga0105239_10943681
790 Ga0105246_10121185
791 Ga0157373_10009496
792 Ga0157373_10014195
793 Ga0157373_10022420
794 Ga0157373_10095330
795 Ga0157371_10023622
796 Ga0157371_10112923
797 Ga0157371_10119802
798 Ga0157371_10140855
799 Ga0157371_10143100
800 Ga0157371_10285992
801 Ga0157371_10751054
802 Ga0157370_10041857
803 Ga0157370_10120097
804 Ga0157370_10285304
805 Ga0157370_10720652
806 Ga0157369_10027719
807 Ga0157369_10067039
808 Ga0157369_10374297
809 Ga0157369_10481629
810 Ga0157369_11007549
811 Ga0157374_10271812
812 Ga0157378_10287344
813 Ga0157378_10337823
814 Ga0157378_10499390
815 Ga0157378_10510346
816 Ga0163162_11014255
817 Ga0157372_10009331
818 Ga0157372_10190333
819 Ga0157372_10229993
820 Ga0157375_12341738
821 Ga0157375_12438379
822 Ga0163163_10023665
823 Ga0163163_10171657
824 Ga0157377_10435701
825 Ga0157379_10388586
826 Ga0157376_10160321
827 Ga0163161_10801591
828 Ga0213876_10025219
829 Ga0207697_10135408
830 Ga0207656_10033306
831 Ga0207656_10087471
832 Ga0207656_10153645
833 Ga0207682_10110200
834 Ga0207642_10031911
835 Ga0207710_10120763
836 Ga0207688_10319324
837 Ga0207680_10005893
838 Ga0207680_10250061
839 Ga0207680_10705191
840 Ga0207647_10003739
841 Ga0207647_10014330
842 Ga0207647_10067658
843 Ga0207647_10098488
844 Ga0207647_10189479
845 Ga0207699_10375315
846 Ga0207705_10000270
847 Ga0207705_10001164
848 Ga0207705_10016806
849 Ga0207705_10029587
850 Ga0207705_10053870
851 Ga0207705_10220198
852 Ga0207705_10225197
853 Ga0207707_10015148
854 Ga0207707_10514813
855 Ga0207695_10016399
856 Ga0207695_10357387
857 Ga0207695_10849548
858 Ga0207671_10068459
859 Ga0207693_10114256
860 Ga0207660_10054458
861 Ga0207660_10213089
862 Ga0207660_10392159
863 Ga0207660_10625855
864 Ga0207657_10001091
865 Ga0207657_10005832
866 Ga0207657_10006264
867 Ga0207657_10014344
868 Ga0207657_10020199
869 Ga0207657_10044279
870 Ga0207657_10049588
871 Ga0207657_10129142
872 Ga0207657_10219045
873 Ga0207657_10252079
874 Ga0207649_10017659
875 Ga0207649_10082601
876 Ga0207649_10085153
877 Ga0207649_10160432
878 Ga0207649_10227690
879 Ga0207652_10000058
880 Ga0207652_10263361
881 Ga0207652_10277346
882 Ga0207652_10520250
883 Ga0207652_10674587
884 Ga0207694_10016284
885 Ga0207694_10535245
886 Ga0207650_10013001
887 Ga0207650_10316593
888 Ga0207650_10381033
889 Ga0207659_10214589
890 Ga0207687_10093417
891 Ga0207687_10094797
892 Ga0207700_10076130
893 Ga0207664_10069018
894 Ga0207664_10119157
895 Ga0207664_10207430
896 Ga0207664_10569920
897 Ga0207644_10000240
898 Ga0207644_10003730
899 Ga0207644_10018601
900 Ga0207644_10063018
901 Ga0207690_10022833
902 Ga0207690_10051701
903 Ga0207690_10155935
904 Ga0207706_10005424
905 Ga0207706_10011390
906 Ga0207706_10029785
907 Ga0207706_10063260
908 Ga0207706_10095623
909 Ga0207706_10146747
910 Ga0207706_10237012
911 Ga0207706_10732145
912 Ga0207686_10051430
913 Ga0207670_10206936
914 Ga0207669_10004611
915 Ga0207669_10046403
916 Ga0207704_10110278
917 Ga0207665_10009130
918 Ga0207691_10001687
919 Ga0207691_10030408
920 Ga0207691_10172338
921 Ga0207691_10184212
922 Ga0207691_10729766
923 Ga0207711_10101555
924 Ga0207711_10236499
925 Ga0207711_10345847
926 Ga0207711_10763811
927 Ga0207689_10292848
928 Ga0207661_10002950
929 Ga0207661_10006156
930 Ga0207661_10177410
931 Ga0207679_10054901
932 Ga0207679_10173681
933 Ga0207667_10006485
934 Ga0207667_10007276
935 Ga0207667_10067036
936 Ga0207667_10340594
937 Ga0207651_10017127
938 Ga0207651_10025946
939 Ga0207712_10108441
940 Ga0207640_10156367
941 Ga0207658_10329170
942 Ga0207677_10110564
943 Ga0207677_10151616
944 Ga0207677_10392753
945 Ga0207677_10570996
946 Ga0207703_10195283
947 Ga0207639_10011524
948 Ga0207639_10596669
949 Ga0207639_11366950
950 Ga0207678_10000217
951 Ga0207678_10013399
952 Ga0207678_10042492
953 Ga0207678_10084913
954 Ga0207678_10093023
955 Ga0207678_10295579
956 Ga0207678_10507791
957 Ga0207702_10006826
958 Ga0207702_10034448
959 Ga0207702_10060193
960 Ga0207702_10073485
961 Ga0207702_10175767
962 Ga0207702_10364042
963 Ga0207641_10051016
964 Ga0207641_10063930
965 Ga0207648_10005651
966 Ga0207676_10065741
967 Ga0207676_10069060
968 Ga0207676_10707793
969 Ga0207674_10001184
970 Ga0207674_10006941
971 Ga0207674_10010273
972 Ga0207674_10106556
973 Ga0207683_10002053
974 Ga0207683_10005631
975 Ga0207698_10006959
976 Ga0207698_10023171
977 Ga0207698_10168180
978 Ga0207698_10175620
979 Ga0207698_10488571
980 Ga0207698_10494380
981 Ga0207698_11143095
982 Ga0268264_10331502
983 Ga0307408_100396767
984 Ga0307405_10009277
985 Ga0307405_11077271
986 Ga0307410_10006341
987 Ga0307410_10233451
988 Ga0307406_10012050
989 Ga0307406_10411101
990 Ga0307406_10883956
991 Ga0307407_10286762
992 Ga0307409_100008784
993 Ga0307409_101146130
994 Ga0307416_100013572
995 Ga0307416_100934603
996 Ga0307416_101116038
997 Ga0307414_10403296
998 Ga0307414_10417713
999 Ga0307414_10610117
1000 Ga0307411_10016424
1001 Ga0307415_100014029
1002 Ga0307415_100063510
1003 Ga0373939_0086062
1004 Ga0373941_0236957
1005 Ga0373941_0419144
1006 Ga0373960_0047296
1007 Ga0373942_0027819
1008 Ga0373931_0073121
1009 Ga0373935_0006082
1010 Ga0373937_0892496
1011 Ga0373925_0493706
1012 Ga0373925_0829486
1013 Ga0395899_0000998
1014 Ga0395899_0005178
1015 Ga0395899_0022713
1016 Ga0395899_0046356
1017 Ga0395899_0057412
1018 Ga0395899_0062099
1019 Ga0395899_0077905
1020 Ga0395899_0168464
1021 Ga0395899_0305507
1022 Ga0395899_0811123
1023 Ga0395900_0000290
1024 Ga0395900_0004722
1025 Ga0395900_0020873
1026 Ga0395900_0023551
1027 Ga0395900_0027076
1028 Ga0395900_0031149
1029 Ga0395900_0036434
1030 Ga0395900_0040170
1031 Ga0395900_0087831
1032 Ga0395900_0097447
1033 Ga0395900_0130828
1034 Ga0395900_0132099
1035 Ga0395900_0185552
1036 Ga0395900_0346001
1037 Ga0395900_0570912
1038 Ga0395900_0760162
1039 Ga0395900_0937056
1040 Ga0395898_0000054
1041 Ga0395898_0002537
1042 Ga0395898_0041709
1043 Ga0395898_0046066
1044 Ga0395898_0085501
1045 Ga0395898_0147552
1046 Ga0395898_0169260
1047 Ga0395898_0461849
1048 Ga0395898_0693281
1049 Ga0395905_0000046
1050 Ga0395905_0001943
1051 Ga0395905_0004198
1052 Ga0395905_0004285
1053 Ga0395905_0008539
1054 Ga0395905_0013007
1055 Ga0395905_0022580
1056 Ga0395905_0030628
1057 Ga0395905_0041705
1058 Ga0395905_0068148
1059 Ga0395905_0070818
1060 Ga0395905_0091208
1061 Ga0395905_0103871
1062 Ga0395905_0108083
1063 Ga0395905_0117679
1064 Ga0395905_0132817
1065 Ga0395905_0203216
1066 Ga0395905_0332294
1067 Ga0395905_0355449
1068 Ga0395905_0414838
1069 Ga0395905_0548693
1070 Ga0395905_0666466
1071 Ga0395901_0000102
1072 Ga0395901_0004019
1073 Ga0395901_0005414
1074 Ga0395901_0008454
1075 Ga0395901_0018700
1076 Ga0395901_0020521
1077 Ga0395901_0026838
1078 Ga0395901_0027538
1079 Ga0395901_0037708
1080 Ga0395901_0045144
1081 Ga0395901_0088454
1082 Ga0395901_0093089
1083 Ga0395901_0387860
1084 Ga0395901_0405058
1085 Ga0395901_0432486
1086 Ga0395901_0926438
1087 Ga0436365_0512070
1088 Ga0439465_0130057
1089 Ga0439448_0007029
1090 Ga0439448_0065618
1091 Ga0439448_0122428
1092 Ga0439449_0056262
1093 Ga0439455_0042906
1094 Ga0439458_0000063
1095 Ga0466969_0009917
1096 Ga0466969_0247649
1097 Ga0466972_0377970
1098 Ga0466965_0069559
1099 Ga0466965_0290830
1100 Ga0466966_0024889
1101 Ga0466966_0047119
1102 Ga0466966_0063729
1103 Ga0466966_0261772
1104 Ga0466961_0012394
1105 Ga0466961_0053844
1106 Ga0466961_0075632
1107 Ga0466961_0098881
1108 Ga0466961_0130120
1109 Ga0466961_0237332
1110 Ga0466961_0375578
1111 Ga0466963_0003274
1112 Ga0466963_0023726
1113 Ga0466963_0162440
1114 Ga0466963_0221579
1115 Ga0466964_0004751
1116 Ga0466964_0312828
1117 Ga0466971_0032186
1118 Ga0466971_0085200
1119 Ga0466968_0019965
1120 Ga0466968_0378315
1121 Ga0466970_0016451
1122 Ga0466970_0360685
1123 Ga0466970_0380630
1124 Ga0466970_0521828
1125 Ga0466957_0008674
1126 Ga0466957_0065228
1127 Ga0466957_0130337
1128 Ga0466960_0363158
1129 Ga0466960_0401982
1130 Ga0466959_0017235
1131 Ga0466959_0045185
1132 Ga0466959_0068016
1133 Ga0466959_0129536
1134 Ga0466959_0534062
1135 Ga0466959_0771065
1136 Ga0466958_0003912
1137 Ga0466958_0013466
1138 Ga0466958_0025403
1139 Ga0466958_0094006
1140 Ga0466958_0412441
1141 Ga0466958_0994287
1142 Ga0466967_0029964
1143 Ga0466967_0126652
1144 Ga0466967_0129230
1145 Ga0466967_0293253
1146 Ga0466967_1137170
1147 Ga0466967_1168957
1148 Ga0466967_1242871
1149 Ga0466967_1295252
1150 Ga0495598_0004155
1151 Ga0495621_0000406
1152 Ga0495633_0324913
1153 Ga0495669_0011308
1154 Ga0495669_0087141
1155 Ga0495669_0266300
1156 Ga0495669_0405264
1157 Ga0495670_0000148
1158 Ga0495674_0487117
1159 Ga0495677_0003645
1160 Ga0496101_0000216
1161 Ga0496101_0516416
1162 Ga0496102_0280375
1163 Ga0496103_0087749
1164 Ga0496104_0118828
1165 Ga0496105_0100693
1166 Ga0496106_0004559
1167 Ga0496107_0019478
1168 Ga0496107_0788335
1169 Ga0496108_0009355
1170 Ga0496110_0000132
1171 Ga0496111_0001206
1172 Ga0496111_0179858
1173 Ga0496113_0000182
1174 Ga0496114_0271979
1175 Ga0501067_0073570
1176 Ga0501069_0243685
1177 Ga0501201_008818
1178 Ga0501249_072098
1179 Ga0501257_106249
1180 Ga0501258_003961
1181 Ga0501263_030559
1182 Ga0501266_029034
1183 Ga0501270_054900
1184 nmdc:mga00v17_95277_c1
1185 Ga0466962_0003228
1186 Ga0466962_0238393

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04355

SmpA_OmlA

SmpA / OmlA family

39

115

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ayw-assembly1.cif.gz_E structure of a membrane complex 0.8422 22 107
7ttc-assembly1.cif.gz_E bamabcde bound to substrate espp 0.8387 23 107
7ri9-assembly1.cif.gz_E the structure of bam in msp1e3d1 at 6.9 angstrom resolution 0.8146 22 107
6sn5-assembly1.cif.gz_E bamabcde in msp1d1 nanodisc ensemble 0-5 0.7936 23 107
7rj5-assembly1.cif.gz_E the structure of bam in complex with espp at 7 angstrom resolution 0.7822 27 107
ID Description Score Start End Superfamily
af_F1R4L9_9_222_3.30.420.150 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Exopolyphosphatase. Domain 2 0.8637 66 93 3.30.420.150
5ekqE01 Alpha Beta;2-Layer Sandwich;Beta-lactamase Inhibitory Protein; Chain:B, domain 1; 0.8359 28 107 3.30.1450.10
af_A0A0R0JI29_34_159_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7972 86 106 3.30.420.10
5ekqE01 Alpha Beta;2-Layer Sandwich;Beta-lactamase Inhibitory Protein; Chain:B, domain 1; 0.7968 28 107 3.30.1450.10
af_Q4V8K0_37_139_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7968 86 107 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A2I2GMN9-F1-model_v4 Uncharacterized protein 0.9089 66 106
AF-A0A3D2ERT3-F1-model_v4 Outer membrane protein assembly factor BamE domain-containing protein 0.8975 27 105 GO:0019867
AF-A0A846VB17-F1-model_v4 deleted 0.8855 24 107
AF-A0A529Y0M3-F1-model_v4 deleted 0.8788 24 107
AF-A0A435AHC6-F1-model_v4 deleted 0.8778 24 107

Map