F467274

General Info

Members Datasets Scaffolds Average Seq Length
593 333 572 180

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0086350|Ga0501034_0086350_726_1328
Length 200
Sequence VGGAVRPVDPLIGSIQVSRSGGNGMAKRWYIVQAYSNFERKVAEDIKQKVAQKKLEELFDDVIVPTEKVVEMRRGRKVDAERKFFPGYVLVKMEMTDQAFHLIKNTPKVTGFLGSGDKPMPISEKEAMAILQQVQEGVEHPKPSVSFEVGEQVRVSDGPFASFNGVVEEVDEERSRLKVEVSIFGRPTPVELEYGQVEKV

Samples

Sample ID Description Type Environment
1 2534681786 Brucella suis 92/29 Isolate Unclassified
2 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
3 2643221580 Devosia sp. Root635 Isolate Unclassified
4 2643221591 Devosia sp. Root685 Isolate Unclassified
5 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
6 2643221629 Devosia sp. Root105 Isolate Unclassified
7 2643221662 Devosia sp. Root413D1 Isolate Unclassified
8 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
9 2643221674 Devosia sp. Root436 Isolate Unclassified
10 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
11 2751185800 Brucella pituitosa AA2 Isolate Unclassified
12 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
13 2854911287 Brucella lupini LUP21 Isolate Unclassified
14 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
15 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
16 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
17 2932401849 Devosia sp. 2618 Isolate Rhizosphere
18 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
19 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
22 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
98 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
191 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
207 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
208 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
209 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
210 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
211 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
212 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
213 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
222 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
223 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
224 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
274 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
282 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
283 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
284 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
285 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
286 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
287 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
288 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
289 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
290 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
291 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
292 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
293 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
294 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
295 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
296 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
297 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
298 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
331 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
332 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
333 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.67
Metatranscriptomes 10.79
Isolates 3.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.97
Nodule 0.17
Rhizoplane 1.18
Rhizosphere 79.09
Stem 0
Stem Tuber 0
Unclassified 7.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10029916 3300001990 Bacteria 1706
2 JGI24737J22298_10091473 3300001990 Bacteria 902
3 JGI25165J46597_1001178 3300003214 Bacteria 16026
4 Ga0006562J51391_1003500 3300003578 Bacteria 4130
5 Ga0055526_1031555 3300003771 Bacteria 1515
6 Ga0055536_1004776 3300003781 Bacteria 6798
7 Ga0055531_10017052 3300003794 Bacteria 3090
8 Ga0055531_10032234 3300003794 Bacteria 1716
9 Ga0065707_10008628 3300005295 Bacteria 2523
10 Ga0070658_10017387 3300005327 Bacteria 5754
11 Ga0070658_10041171 3300005327 Bacteria 3727
12 Ga0070658_10077414 3300005327 Bacteria 2728
13 Ga0070658_10460850 3300005327 Bacteria 1096
14 Ga0070676_10502516 3300005328 Bacteria 861
15 Ga0070660_100167660 3300005339 Bacteria 1772
16 Ga0070660_100480779 3300005339 Bacteria 1032
17 Ga0070660_100957572 3300005339 Bacteria 723
18 Ga0070691_10011857 3300005341 Bacteria 3987
19 Ga0070661_100045249 3300005344 Bacteria 3217
20 Ga0070661_100056918 3300005344 Bacteria 2865
21 Ga0070661_100200235 3300005344 Bacteria 1525
22 Ga0070668_100021350 3300005347 Bacteria 4892
23 Ga0070668_100596944 3300005347 Bacteria 965
24 Ga0070668_101098586 3300005347 Bacteria 718
25 Ga0070669_100135037 3300005353 Bacteria 1897
26 Ga0070675_100099531 3300005354 Bacteria 2448
27 Ga0070671_100512535 3300005355 Bacteria 1032
28 Ga0070674_100049876 3300005356 Bacteria 2880
29 Ga0070673_100015008 3300005364 Bacteria 5421
30 Ga0070673_101590026 3300005364 Bacteria 617
31 Ga0070659_100115700 3300005366 Bacteria 2167
32 Ga0070667_100064208 3300005367 Bacteria 3115
33 Ga0070663_100189296 3300005455 Bacteria 1601
34 Ga0070663_100243034 3300005455 Bacteria 1422
35 Ga0070663_100321331 3300005455 Bacteria 1245
36 Ga0070678_100521948 3300005456 Bacteria 1051
37 Ga0070662_100296732 3300005457 Bacteria 1312
38 Ga0070681_10045736 3300005458 Bacteria 4378
39 Ga0068867_100221002 3300005459 Bacteria 1527
40 Ga0070706_100773966 3300005467 Bacteria 889
41 Ga0070707_100283004 3300005468 Bacteria 1611
42 Ga0070698_100205515 3300005471 Bacteria 1904
43 Ga0070679_100056140 3300005530 Bacteria 3923
44 Ga0070679_100637320 3300005530 Bacteria 1009
45 Ga0070684_100594042 3300005535 Bacteria 1029
46 Ga0068853_100124568 3300005539 Bacteria 2301
47 Ga0068853_100231270 3300005539 Bacteria 1691
48 Ga0068853_100353910 3300005539 Bacteria 1366
49 Ga0070665_100035135 3300005548 Bacteria 5039
50 Ga0070665_100371123 3300005548 Bacteria 1438
51 Ga0070665_100716483 3300005548 Bacteria 1014
52 Ga0068855_100016530 3300005563 Bacteria 8875
53 Ga0068855_100161316 3300005563 Bacteria 2544
54 Ga0068855_100207020 3300005563 Bacteria 2206
55 Ga0070664_100518560 3300005564 Bacteria 1100
56 Ga0068857_100298148 3300005577 Bacteria 1486
57 Ga0068857_100298253 3300005577 Bacteria 1485
58 Ga0068857_100756751 3300005577 Bacteria 926
59 Ga0068854_100013680 3300005578 Bacteria 5331
60 Ga0068854_100161487 3300005578 Bacteria 1736
61 Ga0068854_100321532 3300005578 Bacteria 1258
62 Ga0068856_100261567 3300005614 Bacteria 1746
63 Ga0068856_100556211 3300005614 Bacteria 1168
64 Ga0068856_100564899 3300005614 Bacteria 1159
65 Ga0068852_100014810 3300005616 Bacteria 6023
66 Ga0068852_100019933 3300005616 Bacteria 5322
67 Ga0068852_100031036 3300005616 Bacteria 4404
68 Ga0068852_100196644 3300005616 Bacteria 1906
69 Ga0068852_100607335 3300005616 Bacteria 1099
70 Ga0068852_100685816 3300005616 Bacteria 1034
71 Ga0068861_100271748 3300005719 Bacteria 1456
72 Ga0068861_100585815 3300005719 Bacteria 1022
73 Ga0068851_10130937 3300005834 Bacteria 1356
74 Ga0068863_100499207 3300005841 Bacteria 1198
75 Ga0068863_100566415 3300005841 Bacteria 1123
76 Ga0068858_100633646 3300005842 Bacteria 1038
77 Ga0068862_100038014 3300005844 Bacteria 4082
78 Ga0068862_100525435 3300005844 Bacteria 1127
79 Ga0068862_100673442 3300005844 Bacteria 1000
80 Ga0075363_100032369 3300006048 Bacteria 2715
81 Ga0075363_100153758 3300006048 Bacteria 1299
82 Ga0075363_100159528 3300006048 Bacteria 1276
83 Ga0075364_10041501 3300006051 Bacteria 2987
84 Ga0075362_10036652 3300006177 Bacteria 2146
85 Ga0075362_10124060 3300006177 Bacteria 1224
86 Ga0075362_10369604 3300006177 Bacteria 720
87 Ga0075367_10207723 3300006178 Bacteria 1224
88 Ga0075366_10019485 3300006195 Bacteria 3926
89 Ga0075366_10055078 3300006195 Bacteria 2362
90 Ga0097621_100206393 3300006237 Bacteria 1707
91 Ga0097621_100627304 3300006237 Bacteria 984
92 Ga0075370_10103997 3300006353 Bacteria 1645
93 Ga0075428_100162011 3300006844 Bacteria 2428
94 Ga0075433_10797560 3300006852 Bacteria 825
95 Ga0075434_100065894 3300006871 Bacteria 3607
96 Ga0075429_100390759 3300006880 Bacteria 1218
97 Ga0068865_100446886 3300006881 Bacteria 1068
98 Ga0105240_10039401 3300009093 Bacteria 6051
99 Ga0105240_10176263 3300009093 Bacteria 2527
100 Ga0105240_10297949 3300009093 Bacteria 1846
101 Ga0105240_10301988 3300009093 Bacteria 1831
102 Ga0105240_11430459 3300009093 Bacteria 726
103 Ga0114129_10930662 3300009147 Bacteria 1099
104 Ga0105243_10426046 3300009148 Bacteria 1239
105 Ga0105241_10049359 3300009174 Bacteria 3205
106 Ga0105241_10252956 3300009174 Bacteria 1494
107 Ga0105241_10669745 3300009174 Bacteria 944
108 Ga0105242_12211740 3300009176 Bacteria 595
109 Ga0105237_10036531 3300009545 Bacteria 4972
110 Ga0105237_10042299 3300009545 Bacteria 4595
111 Ga0105238_10050244 3300009551 Bacteria 4197
112 Ga0105238_10092832 3300009551 Bacteria 3006
113 Ga0105238_10110685 3300009551 Bacteria 2727
114 Ga0105238_10153410 3300009551 Bacteria 2278
115 Ga0105238_10303261 3300009551 Bacteria 1581
116 Ga0105239_10001871 3300010375 Bacteria 27550
117 Ga0105239_10287130 3300010375 Bacteria 1852
118 Ga0105239_10365486 3300010375 Bacteria 1630
119 Ga0105239_10564536 3300010375 Bacteria 1297
120 Ga0105239_11578846 3300010375 Bacteria 759
121 Ga0157373_10177775 3300013100 Bacteria 1498
122 Ga0157371_10045139 3300013102 Bacteria 3137
123 Ga0157371_10391427 3300013102 Bacteria 1016
124 Ga0157370_10011802 3300013104 Bacteria 9118
125 Ga0157370_10078661 3300013104 Bacteria 3105
126 Ga0157370_10166128 3300013104 Bacteria 2052
127 Ga0157370_10278139 3300013104 Bacteria 1547
128 Ga0157370_10683615 3300013104 Bacteria 937
129 Ga0157370_10727358 3300013104 Bacteria 905
130 Ga0157369_10015798 3300013105 Bacteria 8504
131 Ga0157369_10069561 3300013105 Bacteria 3781
132 Ga0157369_10145414 3300013105 Bacteria 2507
133 Ga0157369_10214492 3300013105 Bacteria 2016
134 Ga0157374_10062348 3300013296 Bacteria 3494
135 Ga0157374_10339675 3300013296 Bacteria 1491
136 Ga0157374_10482202 3300013296 Bacteria 1243
137 Ga0157374_11510612 3300013296 Bacteria 695
138 Ga0157378_10195211 3300013297 Bacteria 1912
139 Ga0157378_10220349 3300013297 Bacteria 1803
140 Ga0157378_10261139 3300013297 Bacteria 1662
141 Ga0163162_11979186 3300013306 Bacteria 668
142 Ga0157372_10186538 3300013307 Bacteria 2402
143 Ga0157375_10719851 3300013308 Bacteria 1151
144 Ga0163163_10221558 3300014325 Bacteria 1940
145 Ga0163163_10535051 3300014325 Bacteria 1234
146 Ga0163163_10628292 3300014325 Bacteria 1137
147 Ga0163163_10628730 3300014325 Bacteria 1137
148 Ga0157376_10329655 3300014969 Bacteria 1454
149 Ga0157376_10823102 3300014969 Bacteria 942
150 Ga0182007_10016613 3300015262 Bacteria 2712
151 Ga0183365_10002 3300015684 Bacteria 545891
152 Ga0206356_10005975 3300020070 Bacteria 1000
153 Ga0206355_1286819 3300020076 Bacteria 998
154 Ga0206350_11644842 3300020080 Bacteria 987
155 Ga0206354_10838826 3300020081 Bacteria 889
156 Ga0207427_103465 3300025231 Bacteria 3285
157 Ga0209026_1008620 3300025250 Bacteria 2106
158 Ga0209233_1000293 3300025261 Bacteria 63470
159 Ga0209675_1007439 3300025291 Bacteria 4194
160 Ga0209676_1000568 3300025292 Bacteria 55708
161 Ga0209564_1001858 3300025295 Bacteria 19142
162 Ga0209050_1016696 3300025298 Bacteria 2983
163 Ga0209051_1051975 3300025303 Bacteria 1358
164 Ga0209257_1000409 3300025304 Bacteria 83301
165 Ga0209257_1008579 3300025304 Bacteria 5757
166 Ga0207642_10268798 3300025899 Bacteria 975
167 Ga0207680_10407760 3300025903 Bacteria 961
168 Ga0207647_10144628 3300025904 Bacteria 1392
169 Ga0207647_10350067 3300025904 Bacteria 836
170 Ga0207705_10014607 3300025909 Bacteria 5651
171 Ga0207705_10019991 3300025909 Bacteria 4789
172 Ga0207705_10042944 3300025909 Bacteria 3246
173 Ga0207654_10173551 3300025911 Bacteria 1402
174 Ga0207654_10186551 3300025911 Bacteria 1356
175 Ga0207654_10198524 3300025911 Bacteria 1319
176 Ga0207654_10272905 3300025911 Bacteria 1141
177 Ga0207707_10129012 3300025912 Bacteria 2211
178 Ga0207695_10002347 3300025913 Bacteria 28115
179 Ga0207695_10039790 3300025913 Bacteria 5050
180 Ga0207695_10133597 3300025913 Bacteria 2437
181 Ga0207695_10170220 3300025913 Bacteria 2104
182 Ga0207695_10172095 3300025913 Bacteria 2091
183 Ga0207695_10215654 3300025913 Bacteria 1828
184 Ga0207695_11161795 3300025913 Bacteria 652
185 Ga0207671_10005841 3300025914 Bacteria 11184
186 Ga0207671_10337702 3300025914 Bacteria 1193
187 Ga0207671_10631931 3300025914 Bacteria 853
188 Ga0207660_10102435 3300025917 Bacteria 2140
189 Ga0207657_10009003 3300025919 Bacteria 10082
190 Ga0207657_10039932 3300025919 Bacteria 4163
191 Ga0207657_10073177 3300025919 Bacteria 2897
192 Ga0207657_10201488 3300025919 Bacteria 1601
193 Ga0207657_10667359 3300025919 Bacteria 809
194 Ga0207657_10962021 3300025919 Bacteria 656
195 Ga0207649_10113110 3300025920 Bacteria 1818
196 Ga0207649_10216965 3300025920 Bacteria 1360
197 Ga0207652_10098985 3300025921 Bacteria 2572
198 Ga0207652_10233045 3300025921 Bacteria 1659
199 Ga0207646_10125253 3300025922 Bacteria 2310
200 Ga0207681_10312307 3300025923 Bacteria 1247
201 Ga0207694_10013345 3300025924 Bacteria 6187
202 Ga0207694_10067712 3300025924 Bacteria 2787
203 Ga0207694_10088815 3300025924 Bacteria 2437
204 Ga0207694_10375311 3300025924 Bacteria 1180
205 Ga0207659_10194263 3300025926 Bacteria 1617
206 Ga0207687_10475150 3300025927 Bacteria 1040
207 Ga0207644_10354202 3300025931 Bacteria 1192
208 Ga0207706_10058547 3300025933 Bacteria 3394
209 Ga0207706_10306323 3300025933 Bacteria 1384
210 Ga0207709_10377901 3300025935 Bacteria 1077
211 Ga0207704_10170643 3300025938 Bacteria 1560
212 Ga0207691_10990864 3300025940 Bacteria 701
213 Ga0207689_10238851 3300025942 Bacteria 1502
214 Ga0207661_10380218 3300025944 Bacteria 1278
215 Ga0207667_10000877 3300025949 Bacteria 38435
216 Ga0207667_10047577 3300025949 Bacteria 4539
217 Ga0207667_10088375 3300025949 Bacteria 3205
218 Ga0207667_10358009 3300025949 Bacteria 1488
219 Ga0207651_10106272 3300025960 Bacteria 2095
220 Ga0207712_10158067 3300025961 Bacteria 1758
221 Ga0207668_10340869 3300025972 Bacteria 1250
222 Ga0207668_10718429 3300025972 Bacteria 879
223 Ga0207640_10058682 3300025981 Bacteria 2536
224 Ga0207658_10476683 3300025986 Bacteria 1108
225 Ga0207639_10026524 3300026041 Bacteria 4211
226 Ga0207639_10058875 3300026041 Bacteria 2957
227 Ga0207639_10178462 3300026041 Bacteria 1805
228 Ga0207639_10200245 3300026041 Bacteria 1712
229 Ga0207639_10895592 3300026041 Bacteria 829
230 Ga0207678_10098005 3300026067 Bacteria 2505
231 Ga0207678_10210936 3300026067 Bacteria 1661
232 Ga0207678_10260388 3300026067 Bacteria 1486
233 Ga0207678_10460391 3300026067 Bacteria 1106
234 Ga0207702_10023908 3300026078 Bacteria 5069
235 Ga0207702_10198970 3300026078 Bacteria 1856
236 Ga0207702_10565401 3300026078 Bacteria 1113
237 Ga0207641_10543028 3300026088 Bacteria 1133
238 Ga0207641_11119000 3300026088 Bacteria 786
239 Ga0207648_10217674 3300026089 Bacteria 1697
240 Ga0207648_10299591 3300026089 Bacteria 1442
241 Ga0207648_10357381 3300026089 Bacteria 1317
242 Ga0207648_10845726 3300026089 Bacteria 853
243 Ga0207676_10347186 3300026095 Bacteria 1371
244 Ga0207674_10057512 3300026116 Bacteria 3942
245 Ga0207674_10133008 3300026116 Bacteria 2450
246 Ga0207674_10417767 3300026116 Bacteria 1296
247 Ga0207674_10621237 3300026116 Bacteria 1044
248 Ga0207675_100264971 3300026118 Bacteria 1666
249 Ga0207683_10043859 3300026121 Bacteria 3909
250 Ga0207683_11014296 3300026121 Bacteria 770
251 Ga0207698_10016172 3300026142 Bacteria 5021
252 Ga0207698_10035856 3300026142 Bacteria 3633
253 Ga0207698_10047659 3300026142 Bacteria 3248
254 Ga0207698_10394137 3300026142 Bacteria 1321
255 Ga0207698_10441553 3300026142 Bacteria 1254
256 Ga0209973_1014726 3300027252 Bacteria 979
257 Ga0209981_1003112 3300027378 Bacteria 2143
258 Ga0210000_1021184 3300027462 Bacteria 993
259 Ga0209999_1001433 3300027543 Bacteria 4090
260 Ga0209983_1008868 3300027665 Bacteria 2054
261 Ga0209813_10090951 3300027866 Bacteria 1024
262 Ga0268266_10008349 3300028379 Bacteria 9217
263 Ga0268266_10316468 3300028379 Bacteria 1459
264 Ga0268265_10023575 3300028380 Bacteria 4340
265 Ga0268264_10559536 3300028381 Bacteria 1123
266 Ga0265319_1019867 3300028563 Bacteria 2500
267 Ga0265319_1088226 3300028563 Bacteria 980
268 Ga0265318_10028411 3300028577 Bacteria 2187
269 Ga0307517_10017315 3300028786 Bacteria 9404
270 Ga0307517_10153850 3300028786 Bacteria 1568
271 Ga0307515_10389197 3300028794 Bacteria 1024
272 Ga0307515_10583476 3300028794 Bacteria 728
273 Ga0265338_10005488 3300028800 Bacteria 16533
274 Ga0265338_10072606 3300028800 Bacteria 2937
275 Ga0265338_10175726 3300028800 Bacteria 1637
276 Ga0265338_10360529 3300028800 Bacteria 1043
277 Ga0265338_10533449 3300028800 Bacteria 823
278 Ga0265760_10059085 3300031090 Bacteria 1163
279 Ga0265330_10037458 3300031235 Bacteria 2159
280 Ga0265330_10069359 3300031235 Bacteria 1526
281 Ga0265328_10043192 3300031239 Bacteria 1658
282 Ga0265328_10116568 3300031239 Bacteria 994
283 Ga0265320_10031544 3300031240 Bacteria 2721
284 Ga0265325_10005965 3300031241 Bacteria 7461
285 Ga0265325_10163790 3300031241 Bacteria 1044
286 Ga0265329_10023539 3300031242 Bacteria 2051
287 Ga0265340_10027855 3300031247 Bacteria 2846
288 Ga0265340_10054518 3300031247 Bacteria 1928
289 Ga0265339_10003829 3300031249 Bacteria 10455
290 Ga0265339_10072571 3300031249 Bacteria 1831
291 Ga0265327_10002372 3300031251 Bacteria 20065
292 Ga0265327_10082224 3300031251 Bacteria 1588
293 Ga0265327_10133561 3300031251 Bacteria 1165
294 Ga0307513_10119626 3300031456 Bacteria 2605
295 Ga0307513_10209279 3300031456 Bacteria 1783
296 Ga0265313_10005744 3300031595 Bacteria 9030
297 Ga0265313_10010610 3300031595 Bacteria 5803
298 Ga0307508_10747184 3300031616 Bacteria 591
299 Ga0316575_10174733 3300031665 Bacteria 891
300 Ga0265314_10026660 3300031711 Bacteria 4338
301 Ga0265314_10122183 3300031711 Bacteria 1637
302 Ga0265342_10012909 3300031712 Bacteria 5633
303 Ga0265342_10175308 3300031712 Bacteria 1177
304 Ga0265342_10188784 3300031712 Bacteria 1125
305 Ga0307405_10233495 3300031731 Bacteria 1357
306 Ga0316577_10015566 3300031733 Bacteria 4185
307 Ga0307413_10234703 3300031824 Bacteria 1349
308 Ga0307406_10020179 3300031901 Bacteria 3920
309 Ga0307406_10220598 3300031901 Bacteria 1409
310 Ga0307407_10350768 3300031903 Bacteria 1045
311 Ga0307412_10501461 3300031911 Bacteria 1011
312 Ga0307412_10615991 3300031911 Bacteria 921
313 Ga0307409_100160211 3300031995 Bacteria 1967
314 Ga0307409_100183418 3300031995 Bacteria 1855
315 Ga0307414_10158521 3300032004 Bacteria 1794
316 Ga0307414_10251061 3300032004 Bacteria 1470
317 Ga0307414_10279709 3300032004 Bacteria 1401
318 Ga0307414_10362365 3300032004 Bacteria 1248
319 Ga0307414_10503944 3300032004 Bacteria 1071
320 Ga0307414_10536895 3300032004 Bacteria 1040
321 Ga0307414_11017494 3300032004 Bacteria 763
322 Ga0307411_10025036 3300032005 Bacteria 3568
323 Ga0307411_10362977 3300032005 Bacteria 1185
324 Ga0307415_100496592 3300032126 Bacteria 1066
325 Ga0307415_100730290 3300032126 Bacteria 897
326 Ga0316593_10003346 3300032168 Bacteria 3964
327 Ga0316593_10049940 3300032168 Bacteria 1410
328 Ga0316593_10136180 3300032168 Bacteria 888
329 Ga0316596_1014420 3300033541 Bacteria 1959
330 Ga0373928_0006334 3300035084 Bacteria 2277
331 Ga0373944_0011684 3300035089 Bacteria 2409
332 Ga0373945_0319129 3300035116 Bacteria 668
333 Ga0373946_0021471 3300035171 Bacteria 2504
334 Ga0373942_0011773 3300035207 Bacteria 2079
335 Ga0316584_0276083 3300036712 Bacteria 1222
336 Ga0373925_0011853 3300037068 Bacteria 6309
337 Ga0395899_0124663 3300037312 Bacteria 1843
338 Ga0395899_0135084 3300037312 Bacteria 1758
339 Ga0395899_0225003 3300037312 Bacteria 1298
340 Ga0395900_0001326 3300037418 Bacteria 29962
341 Ga0395900_0434395 3300037418 Bacteria 1271
342 Ga0395898_0048963 3300037466 Bacteria 4143
343 Ga0395898_0074152 3300037466 Bacteria 3287
344 Ga0395905_0000858 3300037471 Bacteria 39725
345 Ga0395901_0006588 3300038443 Bacteria 11733
346 Ga0395901_0133546 3300038443 Bacteria 2608
347 Ga0395901_0267197 3300038443 Bacteria 1780
348 Ga0395901_0380795 3300038443 Bacteria 1452
349 Ga0400487_44160 3300039110 Bacteria 3629
350 Ga0436365_0759160 3300039437 Bacteria 802
351 Ga0436365_1043054 3300039437 Bacteria 883
352 Ga0436360_0228618 3300039438 Bacteria 675
353 Ga0436360_1227143 3300039438 Bacteria 773
354 Ga0436361_0283636 3300039447 Bacteria 1186
355 Ga0436361_0743740 3300039447 Bacteria 979
356 Ga0439465_0167991 3300041413 Bacteria 789
357 Ga0451797_0660248 3300041453 Bacteria 1214
358 Ga0451835_0029965 3300041492 Bacteria 602
359 Ga0451845_0932815 3300041501 Bacteria 806
360 Ga0439441_132058 3300042001 Bacteria 579
361 Ga0439432_178502 3300042006 Bacteria 619
362 Ga0439462_0047104 3300042015 Bacteria 1156
363 Ga0439459_0012158 3300042438 Bacteria 1528
364 Ga0466972_0179438 3300044658 Bacteria 993
365 Ga0466961_0172245 3300044693 Bacteria 1346
366 Ga0466963_0419411 3300044694 Bacteria 944
367 Ga0466971_0545625 3300044719 Bacteria 575
368 Ga0466959_0017451 3300045049 Bacteria 5262
369 Ga0466967_0526237 3300045976 Bacteria 1162
370 Ga0495620_0147397 3300046515 Bacteria 918
371 Ga0495644_0037224 3300046523 Bacteria 1836
372 Ga0495642_0100535 3300046528 Bacteria 1230
373 Ga0495598_0000485 3300046537 Bacteria 7290
374 Ga0495597_0296479 3300046542 Bacteria 628
375 Ga0495633_0003352 3300046558 Bacteria 10748
376 Ga0495668_0077225 3300046616 Bacteria 1828
377 Ga0495668_0079185 3300046616 Bacteria 1804
378 Ga0495611_0021759 3300046648 Bacteria 2771
379 Ga0495625_0016914 3300046660 Bacteria 5723
380 Ga0495625_0143909 3300046660 Bacteria 1607
381 Ga0495669_0035371 3300046684 Bacteria 2205
382 Ga0495649_0006906 3300046694 Bacteria 7022
383 Ga0495649_0137210 3300046694 Bacteria 1289
384 Ga0495636_0001365 3300047318 Bacteria 9237
385 Ga0495636_0180044 3300047318 Bacteria 959
386 Ga0495672_0132747 3300047320 Bacteria 1308
387 Ga0495686_0014923 3300047472 Bacteria 5328
388 Ga0495686_0051823 3300047472 Bacteria 2574
389 Ga0496104_0416016 3300048907 Bacteria 1257
390 Ga0496109_0159407 3300048912 Bacteria 2114
391 Ga0496110_0217866 3300048913 Bacteria 1736
392 Ga0496111_0041973 3300048914 Bacteria 3284
393 Ga0496113_0402749 3300048916 Bacteria 1099
394 Ga0496114_0993790 3300048917 Bacteria 722
395 Ga0496116_0026200 3300048919 Bacteria 4270
396 Ga0496119_0046912 3300048922 Bacteria 2692
397 Ga0496120_0051339 3300048923 Bacteria 2356
398 Ga0496121_0035615 3300048924 Bacteria 4456
399 Ga0496121_0360158 3300048924 Bacteria 966
400 Ga0496121_0540723 3300048924 Bacteria 731
401 Ga0496122_0021882 3300048925 Bacteria 5703
402 Ga0496122_0074305 3300048925 Bacteria 2405
403 Ga0496123_0001897 3300048926 Bacteria 27276
404 Ga0496124_0132957 3300048927 Bacteria 1974
405 Ga0496125_0000332 3300048928 Bacteria 90664
406 Ga0496125_0013173 3300048928 Bacteria 8147
407 Ga0496125_0214014 3300048928 Bacteria 1248
408 Ga0496126_0178063 3300048929 Bacteria 1808
409 Ga0496126_0189404 3300048929 Bacteria 1743
410 Ga0496126_0434148 3300048929 Bacteria 1060
411 Ga0501319_002929 3300049535 Bacteria 1112
412 Ga0501031_0031373 3300049568 Bacteria 3466
413 Ga0501031_0418698 3300049568 Bacteria 866
414 Ga0501032_0000353 3300049569 Bacteria 38266
415 Ga0501033_0074646 3300049570 Bacteria 2489
416 Ga0501033_0108928 3300049570 Bacteria 2017
417 Ga0501033_0170158 3300049570 Bacteria 1565
418 Ga0501034_0002037 3300049571 Bacteria 25398
419 Ga0501034_0019877 3300049571 Bacteria 6861
420 Ga0501034_0086350 3300049571 Bacteria 3138
421 Ga0501034_0136346 3300049571 Bacteria 2435
422 Ga0501034_0142332 3300049571 Bacteria 2377
423 Ga0501034_0264458 3300049571 Bacteria 1662
424 Ga0501034_0283362 3300049571 Bacteria 1596
425 Ga0501034_0666762 3300049571 Bacteria 941
426 Ga0501036_0004376 3300049572 Bacteria 11401
427 Ga0501036_0364857 3300049572 Bacteria 1206
428 Ga0501036_0829203 3300049572 Bacteria 761
429 Ga0501037_0009761 3300049573 Bacteria 7048
430 Ga0501037_0415367 3300049573 Bacteria 921
431 Ga0501037_0502170 3300049573 Bacteria 823
432 Ga0501038_0077633 3300049574 Bacteria 2803
433 Ga0501038_0875457 3300049574 Bacteria 664
434 Ga0501039_0412867 3300049575 Bacteria 1060
435 Ga0501043_0093303 3300049579 Bacteria 2366
436 Ga0501043_0172198 3300049579 Bacteria 1689
437 Ga0501046_0090258 3300049580 Bacteria 2358
438 Ga0501047_0022580 3300049581 Bacteria 6041
439 Ga0501047_0101080 3300049581 Bacteria 2763
440 Ga0501047_0198157 3300049581 Bacteria 1870
441 Ga0501067_0005732 3300049583 Bacteria 6893
442 Ga0501067_0063219 3300049583 Bacteria 2049
443 Ga0501070_0005291 3300049586 Bacteria 11012
444 Ga0501070_0070868 3300049586 Bacteria 2886
445 Ga0501070_0109892 3300049586 Bacteria 2278
446 Ga0501070_0850910 3300049586 Bacteria 714
447 Ga0501071_1020826 3300049587 Bacteria 639
448 Ga0501072_0002118 3300049588 Bacteria 14789
449 Ga0501072_0050290 3300049588 Bacteria 3282
450 Ga0501073_0014097 3300049589 Bacteria 5807
451 Ga0501073_0100511 3300049589 Bacteria 2008
452 Ga0501073_0232330 3300049589 Bacteria 1274
453 Ga0501074_0002236 3300049590 Bacteria 13434
454 Ga0501074_0127774 3300049590 Bacteria 1819
455 Ga0501079_0259232 3300049741 Bacteria 1359
456 Ga0501080_0006112 3300049742 Bacteria 10794
457 Ga0501080_0043318 3300049742 Bacteria 4191
458 Ga0501080_0357176 3300049742 Bacteria 1319
459 Ga0501083_0012769 3300049744 Bacteria 5874
460 Ga0501035_0090514 3300049822 Bacteria 2693
461 Ga0501035_0114657 3300049822 Bacteria 2359
462 Ga0501035_0137247 3300049822 Bacteria 2128
463 Ga0501035_0549079 3300049822 Bacteria 946
464 Ga0501044_0025232 3300049823 Bacteria 6302
465 Ga0501044_0064786 3300049823 Bacteria 3729
466 Ga0501044_0167797 3300049823 Bacteria 2168
467 Ga0501044_0406359 3300049823 Bacteria 1273
468 Ga0501044_0495597 3300049823 Bacteria 1123
469 Ga0501045_0469858 3300049824 Bacteria 935
470 nmdc:mga03683_77093_c1 3300050489 Bacteria 1434
471 nmdc:mga03n38_117316_c1 3300050490 Bacteria 1304
472 nmdc:mga00v17_187001_c1 3300050491 Bacteria 1337
473 nmdc:mga00v17_713256_c1 3300050491 Bacteria 642
474 nmdc:mga00v17_72435_c1 3300050491 Bacteria 2138
475 nmdc:mga0k408_199884_c1 3300050493 Bacteria 1193
476 nmdc:mga0k408_263869_c1 3300050493 Bacteria 1028
477 nmdc:mga0k408_294588_c1 3300050493 Bacteria 968
478 nmdc:mga0k408_349461_c1 3300050493 Bacteria 881
479 nmdc:mga0k408_94914_c1 3300050493 Bacteria 1754
480 nmdc:mga06z11_174188_c1 3300050494 Bacteria 1237
481 nmdc:mga06z11_56646_c1 3300050494 Bacteria 2028
482 nmdc:mga04h51_25967_c1 3300050495 Bacteria 1807
483 nmdc:mga07m45_410316_c1 3300050496 Bacteria 786
484 nmdc:mga07m45_43800_c1 3300050496 Bacteria 2510
485 nmdc:mga0a205_603859_c1 3300050515 Bacteria 950
486 nmdc:mga0sz30_47315_c1 3300050516 Bacteria 1396
487 Ga0500643_000723 3300053087 Bacteria 21742
488 Ga0500643_008293 3300053087 Bacteria 4091
489 Ga0500644_0001107 3300053088 Bacteria 7942
490 Ga0500566_0387973 3300053094 Bacteria 629
491 Ga0500641_0011889 3300053096 Bacteria 3167
492 Ga0500555_004874 3300053103 Bacteria 3808
493 Ga0500556_0005007 3300053104 Bacteria 3748
494 Ga0500556_0009636 3300053104 Bacteria 2812
495 Ga0500556_0069962 3300053104 Bacteria 1309
496 Ga0500556_0086223 3300053104 Bacteria 1194
497 Ga0500562_000681 3300053108 Bacteria 8259
498 Ga0500562_090903 3300053108 Bacteria 828
499 Ga0500608_000939 3300053122 Bacteria 10440
500 Ga0500559_0046691 3300053136 Bacteria 1900
501 Ga0500559_0110960 3300053136 Bacteria 1271
502 Ga0500559_0124663 3300053136 Bacteria 1200
503 Ga0500559_0331992 3300053136 Bacteria 712
504 Ga0500568_0030281 3300053139 Bacteria 2242
505 Ga0500604_0000349 3300053151 Bacteria 12752
506 Ga0500616_0056403 3300053153 Bacteria 2051
507 Ga0500616_0082672 3300053153 Bacteria 1610
508 Ga0500622_0008596 3300053156 Bacteria 5701
509 Ga0500622_0150322 3300053156 Bacteria 1101
510 Ga0500624_003122 3300053157 Bacteria 2184
511 Ga0500627_0207561 3300053158 Bacteria 877
512 Ga0500634_0000076 3300053161 Bacteria 38266
513 Ga0500645_003194 3300053730 Bacteria 6809
514 Ga0500645_011120 3300053730 Bacteria 2950
515 Ga0500645_116944 3300053730 Bacteria 745
516 Ga0501084_0820264 3300054114 Bacteria 783
517 Ga0587084_060894 3300059477 Bacteria 692
518 Ga0587084_098001 3300059477 Bacteria 591
519 Ga0587066_016517 3300059490 Bacteria 1164
520 Ga0587070_017442 3300059491 Bacteria 1164
521 Ga0587070_032366 3300059491 Bacteria 955
522 Ga0587070_128421 3300059491 Bacteria 614
523 Ga0587077_009922 3300059493 Bacteria 1459
524 Ga0587077_018511 3300059493 Bacteria 1200
525 Ga0587077_050643 3300059493 Bacteria 868
526 Ga0587077_056346 3300059493 Bacteria 838
527 Ga0587077_056411 3300059493 Bacteria 838
528 Ga0587080_013869 3300059503 Bacteria 1240
529 Ga0587082_019313 3300059504 Bacteria 1093
530 Ga0587082_030216 3300059504 Bacteria 940
531 Ga0587085_024532 3300059506 Bacteria 946
532 Ga0587086_011556 3300059507 Bacteria 1085
533 Ga0587086_019450 3300059507 Bacteria 914
534 Ga0587088_070995 3300059508 Bacteria 726
535 Ga0587091_006642 3300059511 Bacteria 1634
536 Ga0587092_057966 3300059512 Bacteria 718
537 Ga0587106_009910 3300059605 Bacteria 1222
538 Ga0587106_019344 3300059605 Bacteria 993
539 Ga0587101_010360 3300059623 Bacteria 1169
540 Ga0587101_020262 3300059623 Bacteria 950
541 Ga0587109_015552 3300059624 Bacteria 1293
542 Ga0587109_040342 3300059624 Bacteria 923
543 Ga0587127_003572 3300059629 Bacteria 994
544 Ga0587128_015576 3300059630 Bacteria 1104
545 Ga0587128_105633 3300059630 Bacteria 596
546 Ga0587062_003520 3300059639 Bacteria 1590
547 Ga0587062_010141 3300059639 Bacteria 1163
548 Ga0587067_019647 3300059640 Bacteria 1147
549 Ga0587068_012481 3300059641 Bacteria 1297
550 Ga0587069_006174 3300059642 Bacteria 1430
551 Ga0587072_004181 3300059643 Bacteria 2079
552 Ga0587072_027718 3300059643 Bacteria 1041
553 Ga0587075_016471 3300059644 Bacteria 1051
554 Ga0587075_073567 3300059644 Bacteria 639
555 Ga0587075_073891 3300059644 Bacteria 638
556 Ga0587076_026837 3300059645 Bacteria 994
557 Ga0587076_038489 3300059645 Bacteria 883
558 Ga0587076_114693 3300059645 Bacteria 617
559 Ga0587078_007400 3300059646 Bacteria 1213
560 Ga0587100_007304 3300059648 Bacteria 870
561 Ga0587107_007979 3300059652 Bacteria 1209
562 Ga0587107_022463 3300059652 Bacteria 893
563 Ga0587124_002826 3300059660 Bacteria 1253
564 Ga0587124_006690 3300059660 Bacteria 955
565 Ga0587071_038084 3300060344 Bacteria 954
566 Ga0587111_0004584 3300060346 Bacteria 2069
567 Ga0587111_0005023 3300060346 Bacteria 2013
568 Ga0587111_0014909 3300060346 Bacteria 1412
569 Ga0587111_0045636 3300060346 Bacteria 950
570 Ga0501082_0012036 3300060353 Bacteria 7435
571 Ga0466962_0100180 3300061719 Bacteria 1391
572 Ga0530510_0650489 3300061734 Bacteria 803

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8019678201 8019683019 168
2 iso_pu_bacteria 2534681786 2535484961 171
3 iso_pu_bacteria 2751185800 2753359590 171
4 iso_pu_bacteria 2758568016 2758641852 171
5 iso_pu_bacteria 2854911287 2854912181 171
6 iso_pu_bacteria 2915650412 2915652217 171
7 iso_pu_bacteria 2643221580 2643911564 172
8 iso_pu_bacteria 2643221591 2643963637 172
9 iso_pu_bacteria 2643221629 2644165919 172
10 iso_pu_bacteria 2643221662 2644347071 172
11 iso_pu_bacteria 2643221674 2644410358 172
12 iso_pu_bacteria 2932401849 2932403048 172
13 iso_pu_bacteria 8045864390 8045865520 172
14 3300027462 Ga0210000_1021184 Ga0210000_10211842 173
15 3300035116 Ga0373945_0319129 Ga0373945_0319129_28_561 173
16 iso_pu_bacteria 2894772417 2894776363 173
17 3300048924 Ga0496121_0360158 Ga0496121_0360158_353_877 174
18 3300003578 Ga0006562J51391_1003500 Ga0006562J51391_10035003 175
19 3300005339 Ga0070660_100480779 Ga0070660_1004807792 175
20 3300005355 Ga0070671_100512535 Ga0070671_1005125352 175
21 3300005364 Ga0070673_101590026 Ga0070673_1015900261 175
22 3300005719 Ga0068861_100271748 Ga0068861_1002717482 175
23 3300005841 Ga0068863_100499207 Ga0068863_1004992073 175
24 3300005841 Ga0068863_100566415 Ga0068863_1005664154 175
25 3300005844 Ga0068862_100673442 Ga0068862_1006734423 175
26 3300009176 Ga0105242_12211740 Ga0105242_122117401 175
27 3300013297 Ga0157378_10195211 Ga0157378_101952114 175
28 3300013308 Ga0157375_10719851 Ga0157375_107198512 175
29 3300014325 Ga0163163_10221558 Ga0163163_102215583 175
30 3300025919 Ga0207657_10667359 Ga0207657_106673591 175
31 3300026088 Ga0207641_11119000 Ga0207641_111190001 175
32 3300026118 Ga0207675_100264971 Ga0207675_1002649712 175
33 3300028800 Ga0265338_10072606 Ga0265338_100726061 175
34 3300031090 Ga0265760_10059085 Ga0265760_100590852 175
35 3300042015 Ga0439462_0047104 Ga0439462_0047104_10_537 175
36 3300046537 Ga0495598_0000485 Ga0495598_0000485_1227_1805 175
37 3300047318 Ga0495636_0001365 Ga0495636_0001365_519_1091 175
38 3300048922 Ga0496119_0046912 Ga0496119_0046912_865_1392 175
39 3300048923 Ga0496120_0051339 Ga0496120_0051339_1243_1770 175
40 3300048925 Ga0496122_0074305 Ga0496122_0074305_873_1400 175
41 3300048928 Ga0496125_0214014 Ga0496125_0214014_265_792 175
42 3300048929 Ga0496126_0189404 Ga0496126_0189404_1094_1621 175
43 3300001990 JGI24737J22298_10029916 JGI24737J22298_100299163 176
44 3300001990 JGI24737J22298_10091473 JGI24737J22298_100914731 176
45 3300003214 JGI25165J46597_1001178 JGI25165J46597_10011787 176
46 3300003771 Ga0055526_1031555 Ga0055526_10315553 176
47 3300003781 Ga0055536_1004776 Ga0055536_10047763 176
48 3300003794 Ga0055531_10017052 Ga0055531_100170521 176
49 3300003794 Ga0055531_10032234 Ga0055531_100322343 176
50 3300005295 Ga0065707_10008628 Ga0065707_100086285 176
51 3300005327 Ga0070658_10017387 Ga0070658_100173876 176
52 3300005327 Ga0070658_10041171 Ga0070658_100411712 176
53 3300005327 Ga0070658_10077414 Ga0070658_100774143 176
54 3300005327 Ga0070658_10460850 Ga0070658_104608502 176
55 3300005328 Ga0070676_10502516 Ga0070676_105025161 176
56 3300005339 Ga0070660_100167660 Ga0070660_1001676601 176
57 3300005339 Ga0070660_100957572 Ga0070660_1009575721 176
58 3300005341 Ga0070691_10011857 Ga0070691_100118575 176
59 3300005344 Ga0070661_100045249 Ga0070661_1000452494 176
60 3300005344 Ga0070661_100056918 Ga0070661_1000569183 176
61 3300005344 Ga0070661_100200235 Ga0070661_1002002352 176
62 3300005347 Ga0070668_100021350 Ga0070668_1000213502 176
63 3300005347 Ga0070668_100596944 Ga0070668_1005969443 176
64 3300005347 Ga0070668_101098586 Ga0070668_1010985861 176
65 3300005353 Ga0070669_100135037 Ga0070669_1001350373 176
66 3300005354 Ga0070675_100099531 Ga0070675_1000995313 176
67 3300005356 Ga0070674_100049876 Ga0070674_1000498764 176
68 3300005364 Ga0070673_100015008 Ga0070673_1000150083 176
69 3300005366 Ga0070659_100115700 Ga0070659_1001157003 176
70 3300005367 Ga0070667_100064208 Ga0070667_1000642085 176
71 3300005455 Ga0070663_100189296 Ga0070663_1001892962 176
72 3300005455 Ga0070663_100243034 Ga0070663_1002430342 176
73 3300005455 Ga0070663_100321331 Ga0070663_1003213312 176
74 3300005456 Ga0070678_100521948 Ga0070678_1005219481 176
75 3300005457 Ga0070662_100296732 Ga0070662_1002967322 176
76 3300005458 Ga0070681_10045736 Ga0070681_100457366 176
77 3300005459 Ga0068867_100221002 Ga0068867_1002210022 176
78 3300005467 Ga0070706_100773966 Ga0070706_1007739661 176
79 3300005468 Ga0070707_100283004 Ga0070707_1002830043 176
80 3300005471 Ga0070698_100205515 Ga0070698_1002055153 176
81 3300005530 Ga0070679_100056140 Ga0070679_1000561405 176
82 3300005530 Ga0070679_100637320 Ga0070679_1006373202 176
83 3300005535 Ga0070684_100594042 Ga0070684_1005940422 176
84 3300005539 Ga0068853_100124568 Ga0068853_1001245682 176
85 3300005539 Ga0068853_100231270 Ga0068853_1002312703 176
86 3300005539 Ga0068853_100353910 Ga0068853_1003539101 176
87 3300005548 Ga0070665_100035135 Ga0070665_1000351352 176
88 3300005548 Ga0070665_100371123 Ga0070665_1003711232 176
89 3300005548 Ga0070665_100716483 Ga0070665_1007164831 176
90 3300005563 Ga0068855_100016530 Ga0068855_1000165303 176
91 3300005563 Ga0068855_100161316 Ga0068855_1001613163 176
92 3300005563 Ga0068855_100207020 Ga0068855_1002070205 176
93 3300005564 Ga0070664_100518560 Ga0070664_1005185601 176
94 3300005577 Ga0068857_100298148 Ga0068857_1002981483 176
95 3300005577 Ga0068857_100298253 Ga0068857_1002982532 176
96 3300005577 Ga0068857_100756751 Ga0068857_1007567511 176
97 3300005578 Ga0068854_100013680 Ga0068854_1000136802 176
98 3300005578 Ga0068854_100161487 Ga0068854_1001614873 176
99 3300005578 Ga0068854_100321532 Ga0068854_1003215322 176
100 3300005614 Ga0068856_100261567 Ga0068856_1002615671 176
101 3300005614 Ga0068856_100556211 Ga0068856_1005562111 176
102 3300005614 Ga0068856_100564899 Ga0068856_1005648992 176
103 3300005616 Ga0068852_100014810 Ga0068852_1000148108 176
104 3300005616 Ga0068852_100019933 Ga0068852_1000199335 176
105 3300005616 Ga0068852_100031036 Ga0068852_1000310365 176
106 3300005616 Ga0068852_100196644 Ga0068852_1001966443 176
107 3300005616 Ga0068852_100607335 Ga0068852_1006073352 176
108 3300005616 Ga0068852_100685816 Ga0068852_1006858161 176
109 3300005719 Ga0068861_100585815 Ga0068861_1005858152 176
110 3300005834 Ga0068851_10130937 Ga0068851_101309372 176
111 3300005842 Ga0068858_100633646 Ga0068858_1006336461 176
112 3300005844 Ga0068862_100038014 Ga0068862_1000380144 176
113 3300005844 Ga0068862_100525435 Ga0068862_1005254354 176
114 3300006048 Ga0075363_100032369 Ga0075363_1000323693 176
115 3300006048 Ga0075363_100153758 Ga0075363_1001537582 176
116 3300006048 Ga0075363_100159528 Ga0075363_1001595283 176
117 3300006051 Ga0075364_10041501 Ga0075364_100415012 176
118 3300006177 Ga0075362_10036652 Ga0075362_100366521 176
119 3300006177 Ga0075362_10124060 Ga0075362_101240602 176
120 3300006177 Ga0075362_10369604 Ga0075362_103696041 176
121 3300006178 Ga0075367_10207723 Ga0075367_102077232 176
122 3300006195 Ga0075366_10019485 Ga0075366_100194853 176
123 3300006195 Ga0075366_10055078 Ga0075366_100550782 176
124 3300006237 Ga0097621_100206393 Ga0097621_1002063933 176
125 3300006237 Ga0097621_100627304 Ga0097621_1006273042 176
126 3300006353 Ga0075370_10103997 Ga0075370_101039972 176
127 3300006844 Ga0075428_100162011 Ga0075428_1001620114 176
128 3300006852 Ga0075433_10797560 Ga0075433_107975601 176
129 3300006871 Ga0075434_100065894 Ga0075434_1000658942 176
130 3300006880 Ga0075429_100390759 Ga0075429_1003907591 176
131 3300006881 Ga0068865_100446886 Ga0068865_1004468862 176
132 3300009093 Ga0105240_10039401 Ga0105240_100394013 176
133 3300009093 Ga0105240_10176263 Ga0105240_101762633 176
134 3300009093 Ga0105240_10297949 Ga0105240_102979491 176
135 3300009093 Ga0105240_10301988 Ga0105240_103019883 176
136 3300009093 Ga0105240_11430459 Ga0105240_114304591 176
137 3300009147 Ga0114129_10930662 Ga0114129_109306623 176
138 3300009148 Ga0105243_10426046 Ga0105243_104260462 176
139 3300009174 Ga0105241_10049359 Ga0105241_100493594 176
140 3300009174 Ga0105241_10252956 Ga0105241_102529562 176
141 3300009174 Ga0105241_10669745 Ga0105241_106697451 176
142 3300009545 Ga0105237_10036531 Ga0105237_100365318 176
143 3300009545 Ga0105237_10042299 Ga0105237_100422996 176
144 3300009551 Ga0105238_10050244 Ga0105238_100502445 176
145 3300009551 Ga0105238_10092832 Ga0105238_100928324 176
146 3300009551 Ga0105238_10110685 Ga0105238_101106853 176
147 3300009551 Ga0105238_10153410 Ga0105238_101534102 176
148 3300009551 Ga0105238_10303261 Ga0105238_103032613 176
149 3300010375 Ga0105239_10001871 Ga0105239_1000187131 176
150 3300010375 Ga0105239_10287130 Ga0105239_102871303 176
151 3300010375 Ga0105239_10365486 Ga0105239_103654863 176
152 3300010375 Ga0105239_10564536 Ga0105239_105645362 176
153 3300010375 Ga0105239_11578846 Ga0105239_115788462 176
154 3300013100 Ga0157373_10177775 Ga0157373_101777753 176
155 3300013102 Ga0157371_10045139 Ga0157371_100451392 176
156 3300013102 Ga0157371_10391427 Ga0157371_103914272 176
157 3300013104 Ga0157370_10011802 Ga0157370_1001180210 176
158 3300013104 Ga0157370_10078661 Ga0157370_100786612 176
159 3300013104 Ga0157370_10166128 Ga0157370_101661283 176
160 3300013104 Ga0157370_10278139 Ga0157370_102781393 176
161 3300013104 Ga0157370_10683615 Ga0157370_106836151 176
162 3300013104 Ga0157370_10727358 Ga0157370_107273581 176
163 3300013105 Ga0157369_10015798 Ga0157369_100157983 176
164 3300013105 Ga0157369_10069561 Ga0157369_100695613 176
165 3300013105 Ga0157369_10145414 Ga0157369_101454142 176
166 3300013105 Ga0157369_10214492 Ga0157369_102144922 176
167 3300013296 Ga0157374_10062348 Ga0157374_100623483 176
168 3300013296 Ga0157374_10339675 Ga0157374_103396752 176
169 3300013296 Ga0157374_10482202 Ga0157374_104822022 176
170 3300013296 Ga0157374_11510612 Ga0157374_115106121 176
171 3300013297 Ga0157378_10220349 Ga0157378_102203492 176
172 3300013297 Ga0157378_10261139 Ga0157378_102611393 176
173 3300013306 Ga0163162_11979186 Ga0163162_119791861 176
174 3300013307 Ga0157372_10186538 Ga0157372_101865382 176
175 3300014325 Ga0163163_10535051 Ga0163163_105350511 176
176 3300014325 Ga0163163_10628292 Ga0163163_106282922 176
177 3300014325 Ga0163163_10628730 Ga0163163_106287303 176
178 3300014969 Ga0157376_10329655 Ga0157376_103296551 176
179 3300014969 Ga0157376_10823102 Ga0157376_108231022 176
180 3300015262 Ga0182007_10016613 Ga0182007_100166134 176
181 3300015684 Ga0183365_10002 Ga0183365_10002512 176
182 3300020070 Ga0206356_10005975 Ga0206356_100059751 176
183 3300020076 Ga0206355_1286819 Ga0206355_12868191 176
184 3300020080 Ga0206350_11644842 Ga0206350_116448421 176
185 3300020081 Ga0206354_10838826 Ga0206354_108388262 176
186 3300025231 Ga0207427_103465 Ga0207427_1034653 176
187 3300025250 Ga0209026_1008620 Ga0209026_10086205 176
188 3300025261 Ga0209233_1000293 Ga0209233_100029352 176
189 3300025291 Ga0209675_1007439 Ga0209675_10074394 176
190 3300025292 Ga0209676_1000568 Ga0209676_100056856 176
191 3300025295 Ga0209564_1001858 Ga0209564_100185811 176
192 3300025298 Ga0209050_1016696 Ga0209050_10166963 176
193 3300025303 Ga0209051_1051975 Ga0209051_10519751 176
194 3300025304 Ga0209257_1000409 Ga0209257_10004099 176
195 3300025304 Ga0209257_1008579 Ga0209257_10085791 176
196 3300025899 Ga0207642_10268798 Ga0207642_102687981 176
197 3300025903 Ga0207680_10407760 Ga0207680_104077602 176
198 3300025904 Ga0207647_10144628 Ga0207647_101446283 176
199 3300025904 Ga0207647_10350067 Ga0207647_103500671 176
200 3300025909 Ga0207705_10014607 Ga0207705_100146076 176
201 3300025909 Ga0207705_10019991 Ga0207705_100199913 176
202 3300025909 Ga0207705_10042944 Ga0207705_100429443 176
203 3300025911 Ga0207654_10173551 Ga0207654_101735514 176
204 3300025911 Ga0207654_10186551 Ga0207654_101865513 176
205 3300025911 Ga0207654_10198524 Ga0207654_101985242 176
206 3300025911 Ga0207654_10272905 Ga0207654_102729052 176
207 3300025912 Ga0207707_10129012 Ga0207707_101290123 176
208 3300025913 Ga0207695_10002347 Ga0207695_1000234734 176
209 3300025913 Ga0207695_10039790 Ga0207695_100397907 176
210 3300025913 Ga0207695_10133597 Ga0207695_101335971 176
211 3300025913 Ga0207695_10170220 Ga0207695_101702202 176
212 3300025913 Ga0207695_10172095 Ga0207695_101720951 176
213 3300025913 Ga0207695_10215654 Ga0207695_102156544 176
214 3300025913 Ga0207695_11161795 Ga0207695_111617951 176
215 3300025914 Ga0207671_10005841 Ga0207671_100058416 176
216 3300025914 Ga0207671_10337702 Ga0207671_103377022 176
217 3300025914 Ga0207671_10631931 Ga0207671_106319311 176
218 3300025917 Ga0207660_10102435 Ga0207660_101024355 176
219 3300025919 Ga0207657_10009003 Ga0207657_100090034 176
220 3300025919 Ga0207657_10039932 Ga0207657_100399324 176
221 3300025919 Ga0207657_10073177 Ga0207657_100731774 176
222 3300025919 Ga0207657_10201488 Ga0207657_102014882 176
223 3300025919 Ga0207657_10962021 Ga0207657_109620211 176
224 3300025920 Ga0207649_10113110 Ga0207649_101131102 176
225 3300025920 Ga0207649_10216965 Ga0207649_102169652 176
226 3300025921 Ga0207652_10098985 Ga0207652_100989851 176
227 3300025921 Ga0207652_10233045 Ga0207652_102330453 176
228 3300025922 Ga0207646_10125253 Ga0207646_101252534 176
229 3300025923 Ga0207681_10312307 Ga0207681_103123072 176
230 3300025924 Ga0207694_10013345 Ga0207694_100133451 176
231 3300025924 Ga0207694_10067712 Ga0207694_100677121 176
232 3300025924 Ga0207694_10088815 Ga0207694_100888152 176
233 3300025924 Ga0207694_10375311 Ga0207694_103753111 176
234 3300025926 Ga0207659_10194263 Ga0207659_101942633 176
235 3300025927 Ga0207687_10475150 Ga0207687_104751502 176
236 3300025931 Ga0207644_10354202 Ga0207644_103542023 176
237 3300025933 Ga0207706_10058547 Ga0207706_100585471 176
238 3300025933 Ga0207706_10306323 Ga0207706_103063231 176
239 3300025935 Ga0207709_10377901 Ga0207709_103779012 176
240 3300025938 Ga0207704_10170643 Ga0207704_101706433 176
241 3300025940 Ga0207691_10990864 Ga0207691_109908641 176
242 3300025942 Ga0207689_10238851 Ga0207689_102388512 176
243 3300025944 Ga0207661_10380218 Ga0207661_103802183 176
244 3300025949 Ga0207667_10000877 Ga0207667_1000087743 176
245 3300025949 Ga0207667_10047577 Ga0207667_100475773 176
246 3300025949 Ga0207667_10088375 Ga0207667_100883753 176
247 3300025949 Ga0207667_10358009 Ga0207667_103580094 176
248 3300025960 Ga0207651_10106272 Ga0207651_101062722 176
249 3300025961 Ga0207712_10158067 Ga0207712_101580673 176
250 3300025972 Ga0207668_10340869 Ga0207668_103408693 176
251 3300025972 Ga0207668_10718429 Ga0207668_107184291 176
252 3300025981 Ga0207640_10058682 Ga0207640_100586824 176
253 3300025986 Ga0207658_10476683 Ga0207658_104766832 176
254 3300026041 Ga0207639_10026524 Ga0207639_100265246 176
255 3300026041 Ga0207639_10058875 Ga0207639_100588753 176
256 3300026041 Ga0207639_10178462 Ga0207639_101784622 176
257 3300026041 Ga0207639_10200245 Ga0207639_102002453 176
258 3300026041 Ga0207639_10895592 Ga0207639_108955922 176
259 3300026067 Ga0207678_10098005 Ga0207678_100980052 176
260 3300026067 Ga0207678_10210936 Ga0207678_102109361 176
261 3300026067 Ga0207678_10260388 Ga0207678_102603882 176
262 3300026067 Ga0207678_10460391 Ga0207678_104603912 176
263 3300026078 Ga0207702_10023908 Ga0207702_100239083 176
264 3300026078 Ga0207702_10198970 Ga0207702_101989701 176
265 3300026078 Ga0207702_10565401 Ga0207702_105654013 176
266 3300026088 Ga0207641_10543028 Ga0207641_105430284 176
267 3300026089 Ga0207648_10217674 Ga0207648_102176742 176
268 3300026089 Ga0207648_10299591 Ga0207648_102995913 176
269 3300026089 Ga0207648_10357381 Ga0207648_103573812 176
270 3300026089 Ga0207648_10845726 Ga0207648_108457261 176
271 3300026095 Ga0207676_10347186 Ga0207676_103471862 176
272 3300026116 Ga0207674_10057512 Ga0207674_100575125 176
273 3300026116 Ga0207674_10133008 Ga0207674_101330083 176
274 3300026116 Ga0207674_10417767 Ga0207674_104177673 176
275 3300026116 Ga0207674_10621237 Ga0207674_106212372 176
276 3300026121 Ga0207683_10043859 Ga0207683_100438595 176
277 3300026121 Ga0207683_11014296 Ga0207683_110142961 176
278 3300026142 Ga0207698_10016172 Ga0207698_100161723 176
279 3300026142 Ga0207698_10035856 Ga0207698_100358564 176
280 3300026142 Ga0207698_10047659 Ga0207698_100476593 176
281 3300026142 Ga0207698_10394137 Ga0207698_103941373 176
282 3300026142 Ga0207698_10441553 Ga0207698_104415533 176
283 3300027252 Ga0209973_1014726 Ga0209973_10147262 176
284 3300027378 Ga0209981_1003112 Ga0209981_10031124 176
285 3300027543 Ga0209999_1001433 Ga0209999_10014337 176
286 3300027665 Ga0209983_1008868 Ga0209983_10088683 176
287 3300027866 Ga0209813_10090951 Ga0209813_100909512 176
288 3300028379 Ga0268266_10008349 Ga0268266_1000834912 176
289 3300028379 Ga0268266_10316468 Ga0268266_103164683 176
290 3300028380 Ga0268265_10023575 Ga0268265_100235755 176
291 3300028381 Ga0268264_10559536 Ga0268264_105595362 176
292 3300028563 Ga0265319_1019867 Ga0265319_10198672 176
293 3300028563 Ga0265319_1088226 Ga0265319_10882262 176
294 3300028577 Ga0265318_10028411 Ga0265318_100284113 176
295 3300028786 Ga0307517_10017315 Ga0307517_100173154 176
296 3300028786 Ga0307517_10153850 Ga0307517_101538502 176
297 3300028794 Ga0307515_10389197 Ga0307515_103891972 176
298 3300028794 Ga0307515_10583476 Ga0307515_105834761 176
299 3300028800 Ga0265338_10005488 Ga0265338_1000548817 176
300 3300028800 Ga0265338_10175726 Ga0265338_101757261 176
301 3300028800 Ga0265338_10360529 Ga0265338_103605292 176
302 3300028800 Ga0265338_10533449 Ga0265338_105334491 176
303 3300031235 Ga0265330_10037458 Ga0265330_100374582 176
304 3300031235 Ga0265330_10069359 Ga0265330_100693592 176
305 3300031239 Ga0265328_10043192 Ga0265328_100431923 176
306 3300031239 Ga0265328_10116568 Ga0265328_101165682 176
307 3300031240 Ga0265320_10031544 Ga0265320_100315442 176
308 3300031241 Ga0265325_10005965 Ga0265325_1000596510 176
309 3300031241 Ga0265325_10163790 Ga0265325_101637902 176
310 3300031242 Ga0265329_10023539 Ga0265329_100235392 176
311 3300031247 Ga0265340_10027855 Ga0265340_100278553 176
312 3300031247 Ga0265340_10054518 Ga0265340_100545184 176
313 3300031249 Ga0265339_10003829 Ga0265339_1000382918 176
314 3300031249 Ga0265339_10072571 Ga0265339_100725713 176
315 3300031251 Ga0265327_10002372 Ga0265327_100023724 176
316 3300031251 Ga0265327_10082224 Ga0265327_100822242 176
317 3300031251 Ga0265327_10133561 Ga0265327_101335611 176
318 3300031456 Ga0307513_10119626 Ga0307513_101196263 176
319 3300031456 Ga0307513_10209279 Ga0307513_102092793 176
320 3300031595 Ga0265313_10005744 Ga0265313_100057447 176
321 3300031595 Ga0265313_10010610 Ga0265313_100106103 176
322 3300031616 Ga0307508_10747184 Ga0307508_107471841 176
323 3300031665 Ga0316575_10174733 Ga0316575_101747331 176
324 3300031711 Ga0265314_10026660 Ga0265314_100266606 176
325 3300031711 Ga0265314_10122183 Ga0265314_101221833 176
326 3300031712 Ga0265342_10012909 Ga0265342_100129095 176
327 3300031712 Ga0265342_10175308 Ga0265342_101753082 176
328 3300031712 Ga0265342_10188784 Ga0265342_101887842 176
329 3300031731 Ga0307405_10233495 Ga0307405_102334952 176
330 3300031733 Ga0316577_10015566 Ga0316577_100155664 176
331 3300031824 Ga0307413_10234703 Ga0307413_102347032 176
332 3300031901 Ga0307406_10020179 Ga0307406_100201795 176
333 3300031901 Ga0307406_10220598 Ga0307406_102205982 176
334 3300031903 Ga0307407_10350768 Ga0307407_103507683 176
335 3300031911 Ga0307412_10501461 Ga0307412_105014612 176
336 3300031911 Ga0307412_10615991 Ga0307412_106159911 176
337 3300031995 Ga0307409_100160211 Ga0307409_1001602111 176
338 3300031995 Ga0307409_100183418 Ga0307409_1001834183 176
339 3300032004 Ga0307414_10158521 Ga0307414_101585213 176
340 3300032004 Ga0307414_10251061 Ga0307414_102510613 176
341 3300032004 Ga0307414_10279709 Ga0307414_102797092 176
342 3300032004 Ga0307414_10362365 Ga0307414_103623651 176
343 3300032004 Ga0307414_10503944 Ga0307414_105039442 176
344 3300032004 Ga0307414_10536895 Ga0307414_105368952 176
345 3300032004 Ga0307414_11017494 Ga0307414_110174941 176
346 3300032005 Ga0307411_10025036 Ga0307411_100250361 176
347 3300032005 Ga0307411_10362977 Ga0307411_103629771 176
348 3300032126 Ga0307415_100496592 Ga0307415_1004965922 176
349 3300032126 Ga0307415_100730290 Ga0307415_1007302901 176
350 3300032168 Ga0316593_10003346 Ga0316593_100033462 176
351 3300032168 Ga0316593_10049940 Ga0316593_100499402 176
352 3300032168 Ga0316593_10136180 Ga0316593_101361802 176
353 3300033541 Ga0316596_1014420 Ga0316596_10144203 176
354 3300035084 Ga0373928_0006334 Ga0373928_0006334_1073_1603 176
355 3300035089 Ga0373944_0011684 Ga0373944_0011684_1644_2216 176
356 3300035171 Ga0373946_0021471 Ga0373946_0021471_1592_2158 176
357 3300035207 Ga0373942_0011773 Ga0373942_0011773_803_1333 176
358 3300036712 Ga0316584_0276083 Ga0316584_0276083_120_650 176
359 3300037068 Ga0373925_0011853 Ga0373925_0011853_4875_5444 176
360 3300037312 Ga0395899_0124663 Ga0395899_0124663_803_1333 176
361 3300037312 Ga0395899_0135084 Ga0395899_0135084_1049_1579 176
362 3300037312 Ga0395899_0225003 Ga0395899_0225003_106_675 176
363 3300037418 Ga0395900_0001326 Ga0395900_0001326_25188_25760 176
364 3300037418 Ga0395900_0434395 Ga0395900_0434395_135_665 176
365 3300037466 Ga0395898_0048963 Ga0395898_0048963_423_953 176
366 3300037466 Ga0395898_0074152 Ga0395898_0074152_1390_1920 176
367 3300037471 Ga0395905_0000858 Ga0395905_0000858_20348_20923 176
368 3300038443 Ga0395901_0006588 Ga0395901_0006588_2400_2972 176
369 3300038443 Ga0395901_0133546 Ga0395901_0133546_1943_2473 176
370 3300038443 Ga0395901_0267197 Ga0395901_0267197_884_1414 176
371 3300038443 Ga0395901_0380795 Ga0395901_0380795_347_919 176
372 3300039110 Ga0400487_44160 Ga0400487_44160_2750_3292 176
373 3300039437 Ga0436365_0759160 Ga0436365_0759160_134_706 176
374 3300039437 Ga0436365_1043054 Ga0436365_1043054_197_727 176
375 3300039438 Ga0436360_0228618 Ga0436360_0228618_71_643 176
376 3300039438 Ga0436360_1227143 Ga0436360_1227143_142_711 176
377 3300039447 Ga0436361_0283636 Ga0436361_0283636_71_643 176
378 3300039447 Ga0436361_0743740 Ga0436361_0743740_116_688 176
379 3300041413 Ga0439465_0167991 Ga0439465_0167991_98_628 176
380 3300041453 Ga0451797_0660248 Ga0451797_0660248_163_693 176
381 3300041492 Ga0451835_0029965 Ga0451835_0029965_15_545 176
382 3300041501 Ga0451845_0932815 Ga0451845_0932815_133_663 176
383 3300042001 Ga0439441_132058 Ga0439441_132058_39_569 176
384 3300042006 Ga0439432_178502 Ga0439432_178502_52_582 176
385 3300042438 Ga0439459_0012158 Ga0439459_0012158_924_1457 176
386 3300044658 Ga0466972_0179438 Ga0466972_0179438_51_584 176
387 3300044693 Ga0466961_0172245 Ga0466961_0172245_649_1224 176
388 3300044694 Ga0466963_0419411 Ga0466963_0419411_29_610 176
389 3300044719 Ga0466971_0545625 Ga0466971_0545625_31_561 176
390 3300045049 Ga0466959_0017451 Ga0466959_0017451_1357_1926 176
391 3300045976 Ga0466967_0526237 Ga0466967_0526237_419_976 176
392 3300046515 Ga0495620_0147397 Ga0495620_0147397_43_615 176
393 3300046523 Ga0495644_0037224 Ga0495644_0037224_1000_1566 176
394 3300046528 Ga0495642_0100535 Ga0495642_0100535_495_1061 176
395 3300046542 Ga0495597_0296479 Ga0495597_0296479_25_594 176
396 3300046558 Ga0495633_0003352 Ga0495633_0003352_6584_7159 176
397 3300046616 Ga0495668_0077225 Ga0495668_0077225_932_1501 176
398 3300046616 Ga0495668_0079185 Ga0495668_0079185_238_771 176
399 3300046648 Ga0495611_0021759 Ga0495611_0021759_1412_1978 176
400 3300046660 Ga0495625_0016914 Ga0495625_0016914_4513_5079 176
401 3300046660 Ga0495625_0143909 Ga0495625_0143909_62_631 176
402 3300046684 Ga0495669_0035371 Ga0495669_0035371_195_761 176
403 3300046694 Ga0495649_0006906 Ga0495649_0006906_5264_5842 176
404 3300046694 Ga0495649_0137210 Ga0495649_0137210_707_1237 176
405 3300047318 Ga0495636_0180044 Ga0495636_0180044_251_835 176
406 3300047320 Ga0495672_0132747 Ga0495672_0132747_246_809 176
407 3300047472 Ga0495686_0014923 Ga0495686_0014923_895_1458 176
408 3300047472 Ga0495686_0051823 Ga0495686_0051823_1526_2095 176
409 3300048907 Ga0496104_0416016 Ga0496104_0416016_380_946 176
410 3300048912 Ga0496109_0159407 Ga0496109_0159407_21_554 176
411 3300048913 Ga0496110_0217866 Ga0496110_0217866_355_888 176
412 3300048914 Ga0496111_0041973 Ga0496111_0041973_230_760 176
413 3300048916 Ga0496113_0402749 Ga0496113_0402749_356_931 176
414 3300048917 Ga0496114_0993790 Ga0496114_0993790_70_600 176
415 3300048919 Ga0496116_0026200 Ga0496116_0026200_3631_4206 176
416 3300048924 Ga0496121_0035615 Ga0496121_0035615_1450_1980 176
417 3300048924 Ga0496121_0540723 Ga0496121_0540723_121_651 176
418 3300048925 Ga0496122_0021882 Ga0496122_0021882_2535_3110 176
419 3300048926 Ga0496123_0001897 Ga0496123_0001897_17298_17873 176
420 3300048927 Ga0496124_0132957 Ga0496124_0132957_889_1419 176
421 3300048928 Ga0496125_0000332 Ga0496125_0000332_7472_8002 176
422 3300048928 Ga0496125_0013173 Ga0496125_0013173_6546_7121 176
423 3300048929 Ga0496126_0178063 Ga0496126_0178063_109_639 176
424 3300048929 Ga0496126_0434148 Ga0496126_0434148_317_847 176
425 3300049535 Ga0501319_002929 Ga0501319_002929_512_1087 176
426 3300049568 Ga0501031_0031373 Ga0501031_0031373_1241_1771 176
427 3300049568 Ga0501031_0418698 Ga0501031_0418698_146_676 176
428 3300049569 Ga0501032_0000353 Ga0501032_0000353_21866_22399 176
429 3300049570 Ga0501033_0074646 Ga0501033_0074646_627_1157 176
430 3300049570 Ga0501033_0108928 Ga0501033_0108928_975_1505 176
431 3300049570 Ga0501033_0170158 Ga0501033_0170158_66_596 176
432 3300049571 Ga0501034_0002037 Ga0501034_0002037_1909_2439 176
433 3300049571 Ga0501034_0019877 Ga0501034_0019877_1913_2443 176
434 3300049571 Ga0501034_0086350 Ga0501034_0086350_726_1328 176
435 3300049571 Ga0501034_0136346 Ga0501034_0136346_1347_1922 176
436 3300049571 Ga0501034_0142332 Ga0501034_0142332_1262_1792 176
437 3300049571 Ga0501034_0264458 Ga0501034_0264458_656_1186 176
438 3300049571 Ga0501034_0283362 Ga0501034_0283362_671_1201 176
439 3300049571 Ga0501034_0666762 Ga0501034_0666762_387_917 176
440 3300049572 Ga0501036_0004376 Ga0501036_0004376_5665_6195 176
441 3300049572 Ga0501036_0364857 Ga0501036_0364857_354_920 176
442 3300049572 Ga0501036_0829203 Ga0501036_0829203_164_694 176
443 3300049573 Ga0501037_0009761 Ga0501037_0009761_4566_5096 176
444 3300049573 Ga0501037_0415367 Ga0501037_0415367_284_814 176
445 3300049573 Ga0501037_0502170 Ga0501037_0502170_212_742 176
446 3300049574 Ga0501038_0077633 Ga0501038_0077633_1563_2093 176
447 3300049574 Ga0501038_0875457 Ga0501038_0875457_118_648 176
448 3300049575 Ga0501039_0412867 Ga0501039_0412867_166_696 176
449 3300049579 Ga0501043_0093303 Ga0501043_0093303_426_956 176
450 3300049579 Ga0501043_0172198 Ga0501043_0172198_21_569 176
451 3300049580 Ga0501046_0090258 Ga0501046_0090258_119_649 176
452 3300049581 Ga0501047_0022580 Ga0501047_0022580_4310_4840 176
453 3300049581 Ga0501047_0101080 Ga0501047_0101080_494_1024 176
454 3300049581 Ga0501047_0198157 Ga0501047_0198157_492_1094 176
455 3300049583 Ga0501067_0005732 Ga0501067_0005732_631_1224 176
456 3300049583 Ga0501067_0063219 Ga0501067_0063219_537_1094 176
457 3300049586 Ga0501070_0005291 Ga0501070_0005291_4622_5215 176
458 3300049586 Ga0501070_0070868 Ga0501070_0070868_1907_2464 176
459 3300049586 Ga0501070_0109892 Ga0501070_0109892_1223_1753 176
460 3300049586 Ga0501070_0850910 Ga0501070_0850910_167_697 176
461 3300049587 Ga0501071_1020826 Ga0501071_1020826_73_603 176
462 3300049588 Ga0501072_0002118 Ga0501072_0002118_2533_3090 176
463 3300049588 Ga0501072_0050290 Ga0501072_0050290_30_623 176
464 3300049589 Ga0501073_0014097 Ga0501073_0014097_1720_2277 176
465 3300049589 Ga0501073_0100511 Ga0501073_0100511_889_1419 176
466 3300049589 Ga0501073_0232330 Ga0501073_0232330_265_825 176
467 3300049590 Ga0501074_0002236 Ga0501074_0002236_6490_7083 176
468 3300049590 Ga0501074_0127774 Ga0501074_0127774_951_1508 176
469 3300049741 Ga0501079_0259232 Ga0501079_0259232_276_869 176
470 3300049742 Ga0501080_0006112 Ga0501080_0006112_4748_5341 176
471 3300049742 Ga0501080_0043318 Ga0501080_0043318_1238_1795 176
472 3300049742 Ga0501080_0357176 Ga0501080_0357176_496_1026 176
473 3300049744 Ga0501083_0012769 Ga0501083_0012769_4342_4935 176
474 3300049822 Ga0501035_0090514 Ga0501035_0090514_2034_2564 176
475 3300049822 Ga0501035_0114657 Ga0501035_0114657_511_1041 176
476 3300049822 Ga0501035_0137247 Ga0501035_0137247_1224_1754 176
477 3300049822 Ga0501035_0549079 Ga0501035_0549079_356_886 176
478 3300049823 Ga0501044_0025232 Ga0501044_0025232_1827_2357 176
479 3300049823 Ga0501044_0064786 Ga0501044_0064786_584_1114 176
480 3300049823 Ga0501044_0167797 Ga0501044_0167797_695_1225 176
481 3300049823 Ga0501044_0406359 Ga0501044_0406359_590_1120 176
482 3300049823 Ga0501044_0495597 Ga0501044_0495597_115_708 176
483 3300049824 Ga0501045_0469858 Ga0501045_0469858_109_639 176
484 3300050489 nmdc:mga03683_77093_c1 nmdc:mga03683_77093_c1_798_1328 176
485 3300050490 nmdc:mga03n38_117316_c1 nmdc:mga03n38_117316_c1_226_756 176
486 3300050491 nmdc:mga00v17_187001_c1 nmdc:mga00v17_187001_c1_49_582 176
487 3300050491 nmdc:mga00v17_713256_c1 nmdc:mga00v17_713256_c1_84_614 176
488 3300050491 nmdc:mga00v17_72435_c1 nmdc:mga00v17_72435_c1_824_1354 176
489 3300050493 nmdc:mga0k408_199884_c1 nmdc:mga0k408_199884_c1_460_993 176
490 3300050493 nmdc:mga0k408_263869_c1 nmdc:mga0k408_263869_c1_31_561 176
491 3300050493 nmdc:mga0k408_294588_c1 nmdc:mga0k408_294588_c1_101_634 176
492 3300050493 nmdc:mga0k408_349461_c1 nmdc:mga0k408_349461_c1_11_562 176
493 3300050493 nmdc:mga0k408_94914_c1 nmdc:mga0k408_94914_c1_635_1183 176
494 3300050494 nmdc:mga06z11_174188_c1 nmdc:mga06z11_174188_c1_330_881 176
495 3300050494 nmdc:mga06z11_56646_c1 nmdc:mga06z11_56646_c1_827_1357 176
496 3300050495 nmdc:mga04h51_25967_c1 nmdc:mga04h51_25967_c1_1150_1680 176
497 3300050496 nmdc:mga07m45_410316_c1 nmdc:mga07m45_410316_c1_207_758 176
498 3300050496 nmdc:mga07m45_43800_c1 nmdc:mga07m45_43800_c1_1803_2333 176
499 3300050515 nmdc:mga0a205_603859_c1 nmdc:mga0a205_603859_c1_218_751 176
500 3300050516 nmdc:mga0sz30_47315_c1 nmdc:mga0sz30_47315_c1_310_843 176
501 3300053087 Ga0500643_000723 Ga0500643_000723_21063_21632 176
502 3300053087 Ga0500643_008293 Ga0500643_008293_2266_2838 176
503 3300053088 Ga0500644_0001107 Ga0500644_0001107_1942_2511 176
504 3300053094 Ga0500566_0387973 Ga0500566_0387973_37_612 176
505 3300053096 Ga0500641_0011889 Ga0500641_0011889_151_720 176
506 3300053103 Ga0500555_004874 Ga0500555_004874_2808_3341 176
507 3300053104 Ga0500556_0005007 Ga0500556_0005007_1547_2119 176
508 3300053104 Ga0500556_0009636 Ga0500556_0009636_1777_2346 176
509 3300053104 Ga0500556_0069962 Ga0500556_0069962_679_1212 176
510 3300053104 Ga0500556_0086223 Ga0500556_0086223_204_737 176
511 3300053108 Ga0500562_000681 Ga0500562_000681_5046_5618 176
512 3300053108 Ga0500562_090903 Ga0500562_090903_156_725 176
513 3300053122 Ga0500608_000939 Ga0500608_000939_8992_9567 176
514 3300053136 Ga0500559_0046691 Ga0500559_0046691_831_1409 176
515 3300053136 Ga0500559_0110960 Ga0500559_0110960_490_1020 176
516 3300053136 Ga0500559_0124663 Ga0500559_0124663_519_1088 176
517 3300053136 Ga0500559_0331992 Ga0500559_0331992_82_654 176
518 3300053139 Ga0500568_0030281 Ga0500568_0030281_1385_1948 176
519 3300053151 Ga0500604_0000349 Ga0500604_0000349_1637_2167 176
520 3300053153 Ga0500616_0056403 Ga0500616_0056403_393_992 176
521 3300053153 Ga0500616_0082672 Ga0500616_0082672_698_1267 176
522 3300053156 Ga0500622_0008596 Ga0500622_0008596_2352_2921 176
523 3300053156 Ga0500622_0150322 Ga0500622_0150322_90_659 176
524 3300053157 Ga0500624_003122 Ga0500624_003122_274_804 176
525 3300053158 Ga0500627_0207561 Ga0500627_0207561_238_807 176
526 3300053161 Ga0500634_0000076 Ga0500634_0000076_22369_22899 176
527 3300053730 Ga0500645_003194 Ga0500645_003194_2817_3386 176
528 3300053730 Ga0500645_011120 Ga0500645_011120_1549_2121 176
529 3300053730 Ga0500645_116944 Ga0500645_116944_126_695 176
530 3300054114 Ga0501084_0820264 Ga0501084_0820264_240_770 176
531 3300059477 Ga0587084_060894 Ga0587084_060894_116_646 176
532 3300059477 Ga0587084_098001 Ga0587084_098001_31_561 176
533 3300059490 Ga0587066_016517 Ga0587066_016517_370_900 176
534 3300059491 Ga0587070_017442 Ga0587070_017442_336_866 176
535 3300059491 Ga0587070_032366 Ga0587070_032366_282_812 176
536 3300059491 Ga0587070_128421 Ga0587070_128421_53_583 176
537 3300059493 Ga0587077_009922 Ga0587077_009922_16_546 176
538 3300059493 Ga0587077_018511 Ga0587077_018511_590_1120 176
539 3300059493 Ga0587077_050643 Ga0587077_050643_50_580 176
540 3300059493 Ga0587077_056346 Ga0587077_056346_14_547 176
541 3300059493 Ga0587077_056411 Ga0587077_056411_22_552 176
542 3300059503 Ga0587080_013869 Ga0587080_013869_306_836 176
543 3300059504 Ga0587082_019313 Ga0587082_019313_287_817 176
544 3300059504 Ga0587082_030216 Ga0587082_030216_112_642 176
545 3300059506 Ga0587085_024532 Ga0587085_024532_173_703 176
546 3300059507 Ga0587086_011556 Ga0587086_011556_497_1027 176
547 3300059507 Ga0587086_019450 Ga0587086_019450_63_593 176
548 3300059508 Ga0587088_070995 Ga0587088_070995_17_547 176
549 3300059511 Ga0587091_006642 Ga0587091_006642_1059_1589 176
550 3300059512 Ga0587092_057966 Ga0587092_057966_162_692 176
551 3300059605 Ga0587106_009910 Ga0587106_009910_383_913 176
552 3300059605 Ga0587106_019344 Ga0587106_019344_173_703 176
553 3300059623 Ga0587101_010360 Ga0587101_010360_90_620 176
554 3300059623 Ga0587101_020262 Ga0587101_020262_381_911 176
555 3300059624 Ga0587109_015552 Ga0587109_015552_292_822 176
556 3300059624 Ga0587109_040342 Ga0587109_040342_287_817 176
557 3300059629 Ga0587127_003572 Ga0587127_003572_384_914 176
558 3300059630 Ga0587128_015576 Ga0587128_015576_376_906 176
559 3300059630 Ga0587128_105633 Ga0587128_105633_35_565 176
560 3300059639 Ga0587062_003520 Ga0587062_003520_118_648 176
561 3300059639 Ga0587062_010141 Ga0587062_010141_345_875 176
562 3300059640 Ga0587067_019647 Ga0587067_019647_303_833 176
563 3300059641 Ga0587068_012481 Ga0587068_012481_377_907 176
564 3300059642 Ga0587069_006174 Ga0587069_006174_500_1030 176
565 3300059643 Ga0587072_004181 Ga0587072_004181_283_813 176
566 3300059643 Ga0587072_027718 Ga0587072_027718_225_755 176
567 3300059644 Ga0587075_016471 Ga0587075_016471_105_635 176
568 3300059644 Ga0587075_073567 Ga0587075_073567_40_570 176
569 3300059644 Ga0587075_073891 Ga0587075_073891_60_590 176
570 3300059645 Ga0587076_026837 Ga0587076_026837_172_702 176
571 3300059645 Ga0587076_038489 Ga0587076_038489_63_593 176
572 3300059645 Ga0587076_114693 Ga0587076_114693_62_592 176
573 3300059646 Ga0587078_007400 Ga0587078_007400_295_825 176
574 3300059648 Ga0587100_007304 Ga0587100_007304_49_579 176
575 3300059652 Ga0587107_007979 Ga0587107_007979_507_1037 176
576 3300059652 Ga0587107_022463 Ga0587107_022463_72_602 176
577 3300059660 Ga0587124_002826 Ga0587124_002826_154_684 176
578 3300059660 Ga0587124_006690 Ga0587124_006690_80_610 176
579 3300060344 Ga0587071_038084 Ga0587071_038084_344_874 176
580 3300060346 Ga0587111_0004584 Ga0587111_0004584_1080_1610 176
581 3300060346 Ga0587111_0005023 Ga0587111_0005023_603_1136 176
582 3300060346 Ga0587111_0014909 Ga0587111_0014909_407_937 176
583 3300060346 Ga0587111_0045636 Ga0587111_0045636_61_591 176
584 3300060353 Ga0501082_0012036 Ga0501082_0012036_6815_7357 176
585 3300061719 Ga0466962_0100180 Ga0466962_0100180_267_842 176
586 3300061734 Ga0530510_0650489 Ga0530510_0650489_196_744 176
587 iso_pu_bacteria 2643221574 2643883449 176
588 iso_pu_bacteria 2643221598 2644000523 176
589 iso_pu_bacteria 2643221663 2644353969 176
590 iso_pu_bacteria 2739367756 2739791481 176
591 iso_pu_bacteria 2928972540 2928975369 176
592 iso_pu_bacteria 2941485952 2941486899 176
593 iso_pu_bacteria 2977240413 2977241642 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02357

NusG

Transcription termination factor nusG

27

131

0.94

PF00467

KOW

KOW motif

149

184

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kvq-assembly1.cif.gz_G solution structure of nuse:nusg-ctd complex 0.9541 123 176
8exy-assembly1.cif.gz_G m. tuberculosis rnap paused complex with b. subtilis nusg and gmpcpp 0.9191 4 108
5xfq-assembly1.cif.gz_B ternary complex of phf1, a dna duplex and a histone peptide 0.9099 123 175
2e70-assembly1.cif.gz_A solution structure of the fifth kow motif of human transcription elongation factor spt5 0.9077 125 176
5xfp-assembly3.cif.gz_E binary complex of phf1 and a double stranded dna 0.9077 123 175
ID Description Score Start End Superfamily
af_Q10BA7_272_328_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9721 122 176 2.30.30.30
2xhcA03 Mainly Beta;Roll;SH3 type barrels.; 0.9605 121 176 2.30.30.30
2kvqG00 Mainly Beta;Roll;SH3 type barrels.; 0.9541 123 176 2.30.30.30
af_P9WIU9_43_152_3.30.70.940 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain 0.9518 2 107 3.30.70.940
2xhcA03 Mainly Beta;Roll;SH3 type barrels.; 0.9444 121 176 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A3R7WK22-F1-model_v4 deleted 0.9939 123 176
AF-A0A4Q6CKU3-F1-model_v4 Transcription termination/antitermination protein NusG 0.9915 120 176 GO:0005829
GO:0006353
GO:0031564
GO:0032784
AF-A0A3R7WK22-F1-model_v4 deleted 0.976 123 176
AF-A0A4Q6CKU3-F1-model_v4 Transcription termination/antitermination protein NusG 0.9745 120 176 GO:0005829
GO:0006353
GO:0031564
GO:0032784
AF-A0A432IT60-F1-model_v4 deleted 0.9688 3 73

Feature Viewer

pLDDT pTM Quality
79.4 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map