F467274
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 593 | 333 | 572 | 180 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0086350|Ga0501034_0086350_726_1328 |
| Length | 200 |
| Sequence | VGGAVRPVDPLIGSIQVSRSGGNGMAKRWYIVQAYSNFERKVAEDIKQKVAQKKLEELFDDVIVPTEKVVEMRRGRKVDAERKFFPGYVLVKMEMTDQAFHLIKNTPKVTGFLGSGDKPMPISEKEAMAILQQVQEGVEHPKPSVSFEVGEQVRVSDGPFASFNGVVEEVDEERSRLKVEVSIFGRPTPVELEYGQVEKV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 2 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 3 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 4 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 5 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 6 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 7 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 8 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 9 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 10 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 11 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 12 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 13 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 14 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 15 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 16 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 17 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 18 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 19 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 20 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 21 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 22 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 96 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 98 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 159 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 161 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 162 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 168 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 170 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 175 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 176 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 186 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 205 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 206 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 207 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 209 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 210 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 211 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 212 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 213 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 214 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 241 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 242 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 245 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 246 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 275 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 276 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 277 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 278 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 279 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 280 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 282 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 283 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 285 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 286 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 287 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 288 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 289 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 290 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 291 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 292 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 293 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 294 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 295 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 296 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 297 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 298 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 299 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 331 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 332 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 333 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.67 |
| Metatranscriptomes | 10.79 |
| Isolates | 3.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.97 |
| Nodule | 0.17 |
| Rhizoplane | 1.18 |
| Rhizosphere | 79.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10029916 | 3300001990 | Bacteria | 1706 |
| 2 | JGI24737J22298_10091473 | 3300001990 | Bacteria | 902 |
| 3 | JGI25165J46597_1001178 | 3300003214 | Bacteria | 16026 |
| 4 | Ga0006562J51391_1003500 | 3300003578 | Bacteria | 4130 |
| 5 | Ga0055526_1031555 | 3300003771 | Bacteria | 1515 |
| 6 | Ga0055536_1004776 | 3300003781 | Bacteria | 6798 |
| 7 | Ga0055531_10017052 | 3300003794 | Bacteria | 3090 |
| 8 | Ga0055531_10032234 | 3300003794 | Bacteria | 1716 |
| 9 | Ga0065707_10008628 | 3300005295 | Bacteria | 2523 |
| 10 | Ga0070658_10017387 | 3300005327 | Bacteria | 5754 |
| 11 | Ga0070658_10041171 | 3300005327 | Bacteria | 3727 |
| 12 | Ga0070658_10077414 | 3300005327 | Bacteria | 2728 |
| 13 | Ga0070658_10460850 | 3300005327 | Bacteria | 1096 |
| 14 | Ga0070676_10502516 | 3300005328 | Bacteria | 861 |
| 15 | Ga0070660_100167660 | 3300005339 | Bacteria | 1772 |
| 16 | Ga0070660_100480779 | 3300005339 | Bacteria | 1032 |
| 17 | Ga0070660_100957572 | 3300005339 | Bacteria | 723 |
| 18 | Ga0070691_10011857 | 3300005341 | Bacteria | 3987 |
| 19 | Ga0070661_100045249 | 3300005344 | Bacteria | 3217 |
| 20 | Ga0070661_100056918 | 3300005344 | Bacteria | 2865 |
| 21 | Ga0070661_100200235 | 3300005344 | Bacteria | 1525 |
| 22 | Ga0070668_100021350 | 3300005347 | Bacteria | 4892 |
| 23 | Ga0070668_100596944 | 3300005347 | Bacteria | 965 |
| 24 | Ga0070668_101098586 | 3300005347 | Bacteria | 718 |
| 25 | Ga0070669_100135037 | 3300005353 | Bacteria | 1897 |
| 26 | Ga0070675_100099531 | 3300005354 | Bacteria | 2448 |
| 27 | Ga0070671_100512535 | 3300005355 | Bacteria | 1032 |
| 28 | Ga0070674_100049876 | 3300005356 | Bacteria | 2880 |
| 29 | Ga0070673_100015008 | 3300005364 | Bacteria | 5421 |
| 30 | Ga0070673_101590026 | 3300005364 | Bacteria | 617 |
| 31 | Ga0070659_100115700 | 3300005366 | Bacteria | 2167 |
| 32 | Ga0070667_100064208 | 3300005367 | Bacteria | 3115 |
| 33 | Ga0070663_100189296 | 3300005455 | Bacteria | 1601 |
| 34 | Ga0070663_100243034 | 3300005455 | Bacteria | 1422 |
| 35 | Ga0070663_100321331 | 3300005455 | Bacteria | 1245 |
| 36 | Ga0070678_100521948 | 3300005456 | Bacteria | 1051 |
| 37 | Ga0070662_100296732 | 3300005457 | Bacteria | 1312 |
| 38 | Ga0070681_10045736 | 3300005458 | Bacteria | 4378 |
| 39 | Ga0068867_100221002 | 3300005459 | Bacteria | 1527 |
| 40 | Ga0070706_100773966 | 3300005467 | Bacteria | 889 |
| 41 | Ga0070707_100283004 | 3300005468 | Bacteria | 1611 |
| 42 | Ga0070698_100205515 | 3300005471 | Bacteria | 1904 |
| 43 | Ga0070679_100056140 | 3300005530 | Bacteria | 3923 |
| 44 | Ga0070679_100637320 | 3300005530 | Bacteria | 1009 |
| 45 | Ga0070684_100594042 | 3300005535 | Bacteria | 1029 |
| 46 | Ga0068853_100124568 | 3300005539 | Bacteria | 2301 |
| 47 | Ga0068853_100231270 | 3300005539 | Bacteria | 1691 |
| 48 | Ga0068853_100353910 | 3300005539 | Bacteria | 1366 |
| 49 | Ga0070665_100035135 | 3300005548 | Bacteria | 5039 |
| 50 | Ga0070665_100371123 | 3300005548 | Bacteria | 1438 |
| 51 | Ga0070665_100716483 | 3300005548 | Bacteria | 1014 |
| 52 | Ga0068855_100016530 | 3300005563 | Bacteria | 8875 |
| 53 | Ga0068855_100161316 | 3300005563 | Bacteria | 2544 |
| 54 | Ga0068855_100207020 | 3300005563 | Bacteria | 2206 |
| 55 | Ga0070664_100518560 | 3300005564 | Bacteria | 1100 |
| 56 | Ga0068857_100298148 | 3300005577 | Bacteria | 1486 |
| 57 | Ga0068857_100298253 | 3300005577 | Bacteria | 1485 |
| 58 | Ga0068857_100756751 | 3300005577 | Bacteria | 926 |
| 59 | Ga0068854_100013680 | 3300005578 | Bacteria | 5331 |
| 60 | Ga0068854_100161487 | 3300005578 | Bacteria | 1736 |
| 61 | Ga0068854_100321532 | 3300005578 | Bacteria | 1258 |
| 62 | Ga0068856_100261567 | 3300005614 | Bacteria | 1746 |
| 63 | Ga0068856_100556211 | 3300005614 | Bacteria | 1168 |
| 64 | Ga0068856_100564899 | 3300005614 | Bacteria | 1159 |
| 65 | Ga0068852_100014810 | 3300005616 | Bacteria | 6023 |
| 66 | Ga0068852_100019933 | 3300005616 | Bacteria | 5322 |
| 67 | Ga0068852_100031036 | 3300005616 | Bacteria | 4404 |
| 68 | Ga0068852_100196644 | 3300005616 | Bacteria | 1906 |
| 69 | Ga0068852_100607335 | 3300005616 | Bacteria | 1099 |
| 70 | Ga0068852_100685816 | 3300005616 | Bacteria | 1034 |
| 71 | Ga0068861_100271748 | 3300005719 | Bacteria | 1456 |
| 72 | Ga0068861_100585815 | 3300005719 | Bacteria | 1022 |
| 73 | Ga0068851_10130937 | 3300005834 | Bacteria | 1356 |
| 74 | Ga0068863_100499207 | 3300005841 | Bacteria | 1198 |
| 75 | Ga0068863_100566415 | 3300005841 | Bacteria | 1123 |
| 76 | Ga0068858_100633646 | 3300005842 | Bacteria | 1038 |
| 77 | Ga0068862_100038014 | 3300005844 | Bacteria | 4082 |
| 78 | Ga0068862_100525435 | 3300005844 | Bacteria | 1127 |
| 79 | Ga0068862_100673442 | 3300005844 | Bacteria | 1000 |
| 80 | Ga0075363_100032369 | 3300006048 | Bacteria | 2715 |
| 81 | Ga0075363_100153758 | 3300006048 | Bacteria | 1299 |
| 82 | Ga0075363_100159528 | 3300006048 | Bacteria | 1276 |
| 83 | Ga0075364_10041501 | 3300006051 | Bacteria | 2987 |
| 84 | Ga0075362_10036652 | 3300006177 | Bacteria | 2146 |
| 85 | Ga0075362_10124060 | 3300006177 | Bacteria | 1224 |
| 86 | Ga0075362_10369604 | 3300006177 | Bacteria | 720 |
| 87 | Ga0075367_10207723 | 3300006178 | Bacteria | 1224 |
| 88 | Ga0075366_10019485 | 3300006195 | Bacteria | 3926 |
| 89 | Ga0075366_10055078 | 3300006195 | Bacteria | 2362 |
| 90 | Ga0097621_100206393 | 3300006237 | Bacteria | 1707 |
| 91 | Ga0097621_100627304 | 3300006237 | Bacteria | 984 |
| 92 | Ga0075370_10103997 | 3300006353 | Bacteria | 1645 |
| 93 | Ga0075428_100162011 | 3300006844 | Bacteria | 2428 |
| 94 | Ga0075433_10797560 | 3300006852 | Bacteria | 825 |
| 95 | Ga0075434_100065894 | 3300006871 | Bacteria | 3607 |
| 96 | Ga0075429_100390759 | 3300006880 | Bacteria | 1218 |
| 97 | Ga0068865_100446886 | 3300006881 | Bacteria | 1068 |
| 98 | Ga0105240_10039401 | 3300009093 | Bacteria | 6051 |
| 99 | Ga0105240_10176263 | 3300009093 | Bacteria | 2527 |
| 100 | Ga0105240_10297949 | 3300009093 | Bacteria | 1846 |
| 101 | Ga0105240_10301988 | 3300009093 | Bacteria | 1831 |
| 102 | Ga0105240_11430459 | 3300009093 | Bacteria | 726 |
| 103 | Ga0114129_10930662 | 3300009147 | Bacteria | 1099 |
| 104 | Ga0105243_10426046 | 3300009148 | Bacteria | 1239 |
| 105 | Ga0105241_10049359 | 3300009174 | Bacteria | 3205 |
| 106 | Ga0105241_10252956 | 3300009174 | Bacteria | 1494 |
| 107 | Ga0105241_10669745 | 3300009174 | Bacteria | 944 |
| 108 | Ga0105242_12211740 | 3300009176 | Bacteria | 595 |
| 109 | Ga0105237_10036531 | 3300009545 | Bacteria | 4972 |
| 110 | Ga0105237_10042299 | 3300009545 | Bacteria | 4595 |
| 111 | Ga0105238_10050244 | 3300009551 | Bacteria | 4197 |
| 112 | Ga0105238_10092832 | 3300009551 | Bacteria | 3006 |
| 113 | Ga0105238_10110685 | 3300009551 | Bacteria | 2727 |
| 114 | Ga0105238_10153410 | 3300009551 | Bacteria | 2278 |
| 115 | Ga0105238_10303261 | 3300009551 | Bacteria | 1581 |
| 116 | Ga0105239_10001871 | 3300010375 | Bacteria | 27550 |
| 117 | Ga0105239_10287130 | 3300010375 | Bacteria | 1852 |
| 118 | Ga0105239_10365486 | 3300010375 | Bacteria | 1630 |
| 119 | Ga0105239_10564536 | 3300010375 | Bacteria | 1297 |
| 120 | Ga0105239_11578846 | 3300010375 | Bacteria | 759 |
| 121 | Ga0157373_10177775 | 3300013100 | Bacteria | 1498 |
| 122 | Ga0157371_10045139 | 3300013102 | Bacteria | 3137 |
| 123 | Ga0157371_10391427 | 3300013102 | Bacteria | 1016 |
| 124 | Ga0157370_10011802 | 3300013104 | Bacteria | 9118 |
| 125 | Ga0157370_10078661 | 3300013104 | Bacteria | 3105 |
| 126 | Ga0157370_10166128 | 3300013104 | Bacteria | 2052 |
| 127 | Ga0157370_10278139 | 3300013104 | Bacteria | 1547 |
| 128 | Ga0157370_10683615 | 3300013104 | Bacteria | 937 |
| 129 | Ga0157370_10727358 | 3300013104 | Bacteria | 905 |
| 130 | Ga0157369_10015798 | 3300013105 | Bacteria | 8504 |
| 131 | Ga0157369_10069561 | 3300013105 | Bacteria | 3781 |
| 132 | Ga0157369_10145414 | 3300013105 | Bacteria | 2507 |
| 133 | Ga0157369_10214492 | 3300013105 | Bacteria | 2016 |
| 134 | Ga0157374_10062348 | 3300013296 | Bacteria | 3494 |
| 135 | Ga0157374_10339675 | 3300013296 | Bacteria | 1491 |
| 136 | Ga0157374_10482202 | 3300013296 | Bacteria | 1243 |
| 137 | Ga0157374_11510612 | 3300013296 | Bacteria | 695 |
| 138 | Ga0157378_10195211 | 3300013297 | Bacteria | 1912 |
| 139 | Ga0157378_10220349 | 3300013297 | Bacteria | 1803 |
| 140 | Ga0157378_10261139 | 3300013297 | Bacteria | 1662 |
| 141 | Ga0163162_11979186 | 3300013306 | Bacteria | 668 |
| 142 | Ga0157372_10186538 | 3300013307 | Bacteria | 2402 |
| 143 | Ga0157375_10719851 | 3300013308 | Bacteria | 1151 |
| 144 | Ga0163163_10221558 | 3300014325 | Bacteria | 1940 |
| 145 | Ga0163163_10535051 | 3300014325 | Bacteria | 1234 |
| 146 | Ga0163163_10628292 | 3300014325 | Bacteria | 1137 |
| 147 | Ga0163163_10628730 | 3300014325 | Bacteria | 1137 |
| 148 | Ga0157376_10329655 | 3300014969 | Bacteria | 1454 |
| 149 | Ga0157376_10823102 | 3300014969 | Bacteria | 942 |
| 150 | Ga0182007_10016613 | 3300015262 | Bacteria | 2712 |
| 151 | Ga0183365_10002 | 3300015684 | Bacteria | 545891 |
| 152 | Ga0206356_10005975 | 3300020070 | Bacteria | 1000 |
| 153 | Ga0206355_1286819 | 3300020076 | Bacteria | 998 |
| 154 | Ga0206350_11644842 | 3300020080 | Bacteria | 987 |
| 155 | Ga0206354_10838826 | 3300020081 | Bacteria | 889 |
| 156 | Ga0207427_103465 | 3300025231 | Bacteria | 3285 |
| 157 | Ga0209026_1008620 | 3300025250 | Bacteria | 2106 |
| 158 | Ga0209233_1000293 | 3300025261 | Bacteria | 63470 |
| 159 | Ga0209675_1007439 | 3300025291 | Bacteria | 4194 |
| 160 | Ga0209676_1000568 | 3300025292 | Bacteria | 55708 |
| 161 | Ga0209564_1001858 | 3300025295 | Bacteria | 19142 |
| 162 | Ga0209050_1016696 | 3300025298 | Bacteria | 2983 |
| 163 | Ga0209051_1051975 | 3300025303 | Bacteria | 1358 |
| 164 | Ga0209257_1000409 | 3300025304 | Bacteria | 83301 |
| 165 | Ga0209257_1008579 | 3300025304 | Bacteria | 5757 |
| 166 | Ga0207642_10268798 | 3300025899 | Bacteria | 975 |
| 167 | Ga0207680_10407760 | 3300025903 | Bacteria | 961 |
| 168 | Ga0207647_10144628 | 3300025904 | Bacteria | 1392 |
| 169 | Ga0207647_10350067 | 3300025904 | Bacteria | 836 |
| 170 | Ga0207705_10014607 | 3300025909 | Bacteria | 5651 |
| 171 | Ga0207705_10019991 | 3300025909 | Bacteria | 4789 |
| 172 | Ga0207705_10042944 | 3300025909 | Bacteria | 3246 |
| 173 | Ga0207654_10173551 | 3300025911 | Bacteria | 1402 |
| 174 | Ga0207654_10186551 | 3300025911 | Bacteria | 1356 |
| 175 | Ga0207654_10198524 | 3300025911 | Bacteria | 1319 |
| 176 | Ga0207654_10272905 | 3300025911 | Bacteria | 1141 |
| 177 | Ga0207707_10129012 | 3300025912 | Bacteria | 2211 |
| 178 | Ga0207695_10002347 | 3300025913 | Bacteria | 28115 |
| 179 | Ga0207695_10039790 | 3300025913 | Bacteria | 5050 |
| 180 | Ga0207695_10133597 | 3300025913 | Bacteria | 2437 |
| 181 | Ga0207695_10170220 | 3300025913 | Bacteria | 2104 |
| 182 | Ga0207695_10172095 | 3300025913 | Bacteria | 2091 |
| 183 | Ga0207695_10215654 | 3300025913 | Bacteria | 1828 |
| 184 | Ga0207695_11161795 | 3300025913 | Bacteria | 652 |
| 185 | Ga0207671_10005841 | 3300025914 | Bacteria | 11184 |
| 186 | Ga0207671_10337702 | 3300025914 | Bacteria | 1193 |
| 187 | Ga0207671_10631931 | 3300025914 | Bacteria | 853 |
| 188 | Ga0207660_10102435 | 3300025917 | Bacteria | 2140 |
| 189 | Ga0207657_10009003 | 3300025919 | Bacteria | 10082 |
| 190 | Ga0207657_10039932 | 3300025919 | Bacteria | 4163 |
| 191 | Ga0207657_10073177 | 3300025919 | Bacteria | 2897 |
| 192 | Ga0207657_10201488 | 3300025919 | Bacteria | 1601 |
| 193 | Ga0207657_10667359 | 3300025919 | Bacteria | 809 |
| 194 | Ga0207657_10962021 | 3300025919 | Bacteria | 656 |
| 195 | Ga0207649_10113110 | 3300025920 | Bacteria | 1818 |
| 196 | Ga0207649_10216965 | 3300025920 | Bacteria | 1360 |
| 197 | Ga0207652_10098985 | 3300025921 | Bacteria | 2572 |
| 198 | Ga0207652_10233045 | 3300025921 | Bacteria | 1659 |
| 199 | Ga0207646_10125253 | 3300025922 | Bacteria | 2310 |
| 200 | Ga0207681_10312307 | 3300025923 | Bacteria | 1247 |
| 201 | Ga0207694_10013345 | 3300025924 | Bacteria | 6187 |
| 202 | Ga0207694_10067712 | 3300025924 | Bacteria | 2787 |
| 203 | Ga0207694_10088815 | 3300025924 | Bacteria | 2437 |
| 204 | Ga0207694_10375311 | 3300025924 | Bacteria | 1180 |
| 205 | Ga0207659_10194263 | 3300025926 | Bacteria | 1617 |
| 206 | Ga0207687_10475150 | 3300025927 | Bacteria | 1040 |
| 207 | Ga0207644_10354202 | 3300025931 | Bacteria | 1192 |
| 208 | Ga0207706_10058547 | 3300025933 | Bacteria | 3394 |
| 209 | Ga0207706_10306323 | 3300025933 | Bacteria | 1384 |
| 210 | Ga0207709_10377901 | 3300025935 | Bacteria | 1077 |
| 211 | Ga0207704_10170643 | 3300025938 | Bacteria | 1560 |
| 212 | Ga0207691_10990864 | 3300025940 | Bacteria | 701 |
| 213 | Ga0207689_10238851 | 3300025942 | Bacteria | 1502 |
| 214 | Ga0207661_10380218 | 3300025944 | Bacteria | 1278 |
| 215 | Ga0207667_10000877 | 3300025949 | Bacteria | 38435 |
| 216 | Ga0207667_10047577 | 3300025949 | Bacteria | 4539 |
| 217 | Ga0207667_10088375 | 3300025949 | Bacteria | 3205 |
| 218 | Ga0207667_10358009 | 3300025949 | Bacteria | 1488 |
| 219 | Ga0207651_10106272 | 3300025960 | Bacteria | 2095 |
| 220 | Ga0207712_10158067 | 3300025961 | Bacteria | 1758 |
| 221 | Ga0207668_10340869 | 3300025972 | Bacteria | 1250 |
| 222 | Ga0207668_10718429 | 3300025972 | Bacteria | 879 |
| 223 | Ga0207640_10058682 | 3300025981 | Bacteria | 2536 |
| 224 | Ga0207658_10476683 | 3300025986 | Bacteria | 1108 |
| 225 | Ga0207639_10026524 | 3300026041 | Bacteria | 4211 |
| 226 | Ga0207639_10058875 | 3300026041 | Bacteria | 2957 |
| 227 | Ga0207639_10178462 | 3300026041 | Bacteria | 1805 |
| 228 | Ga0207639_10200245 | 3300026041 | Bacteria | 1712 |
| 229 | Ga0207639_10895592 | 3300026041 | Bacteria | 829 |
| 230 | Ga0207678_10098005 | 3300026067 | Bacteria | 2505 |
| 231 | Ga0207678_10210936 | 3300026067 | Bacteria | 1661 |
| 232 | Ga0207678_10260388 | 3300026067 | Bacteria | 1486 |
| 233 | Ga0207678_10460391 | 3300026067 | Bacteria | 1106 |
| 234 | Ga0207702_10023908 | 3300026078 | Bacteria | 5069 |
| 235 | Ga0207702_10198970 | 3300026078 | Bacteria | 1856 |
| 236 | Ga0207702_10565401 | 3300026078 | Bacteria | 1113 |
| 237 | Ga0207641_10543028 | 3300026088 | Bacteria | 1133 |
| 238 | Ga0207641_11119000 | 3300026088 | Bacteria | 786 |
| 239 | Ga0207648_10217674 | 3300026089 | Bacteria | 1697 |
| 240 | Ga0207648_10299591 | 3300026089 | Bacteria | 1442 |
| 241 | Ga0207648_10357381 | 3300026089 | Bacteria | 1317 |
| 242 | Ga0207648_10845726 | 3300026089 | Bacteria | 853 |
| 243 | Ga0207676_10347186 | 3300026095 | Bacteria | 1371 |
| 244 | Ga0207674_10057512 | 3300026116 | Bacteria | 3942 |
| 245 | Ga0207674_10133008 | 3300026116 | Bacteria | 2450 |
| 246 | Ga0207674_10417767 | 3300026116 | Bacteria | 1296 |
| 247 | Ga0207674_10621237 | 3300026116 | Bacteria | 1044 |
| 248 | Ga0207675_100264971 | 3300026118 | Bacteria | 1666 |
| 249 | Ga0207683_10043859 | 3300026121 | Bacteria | 3909 |
| 250 | Ga0207683_11014296 | 3300026121 | Bacteria | 770 |
| 251 | Ga0207698_10016172 | 3300026142 | Bacteria | 5021 |
| 252 | Ga0207698_10035856 | 3300026142 | Bacteria | 3633 |
| 253 | Ga0207698_10047659 | 3300026142 | Bacteria | 3248 |
| 254 | Ga0207698_10394137 | 3300026142 | Bacteria | 1321 |
| 255 | Ga0207698_10441553 | 3300026142 | Bacteria | 1254 |
| 256 | Ga0209973_1014726 | 3300027252 | Bacteria | 979 |
| 257 | Ga0209981_1003112 | 3300027378 | Bacteria | 2143 |
| 258 | Ga0210000_1021184 | 3300027462 | Bacteria | 993 |
| 259 | Ga0209999_1001433 | 3300027543 | Bacteria | 4090 |
| 260 | Ga0209983_1008868 | 3300027665 | Bacteria | 2054 |
| 261 | Ga0209813_10090951 | 3300027866 | Bacteria | 1024 |
| 262 | Ga0268266_10008349 | 3300028379 | Bacteria | 9217 |
| 263 | Ga0268266_10316468 | 3300028379 | Bacteria | 1459 |
| 264 | Ga0268265_10023575 | 3300028380 | Bacteria | 4340 |
| 265 | Ga0268264_10559536 | 3300028381 | Bacteria | 1123 |
| 266 | Ga0265319_1019867 | 3300028563 | Bacteria | 2500 |
| 267 | Ga0265319_1088226 | 3300028563 | Bacteria | 980 |
| 268 | Ga0265318_10028411 | 3300028577 | Bacteria | 2187 |
| 269 | Ga0307517_10017315 | 3300028786 | Bacteria | 9404 |
| 270 | Ga0307517_10153850 | 3300028786 | Bacteria | 1568 |
| 271 | Ga0307515_10389197 | 3300028794 | Bacteria | 1024 |
| 272 | Ga0307515_10583476 | 3300028794 | Bacteria | 728 |
| 273 | Ga0265338_10005488 | 3300028800 | Bacteria | 16533 |
| 274 | Ga0265338_10072606 | 3300028800 | Bacteria | 2937 |
| 275 | Ga0265338_10175726 | 3300028800 | Bacteria | 1637 |
| 276 | Ga0265338_10360529 | 3300028800 | Bacteria | 1043 |
| 277 | Ga0265338_10533449 | 3300028800 | Bacteria | 823 |
| 278 | Ga0265760_10059085 | 3300031090 | Bacteria | 1163 |
| 279 | Ga0265330_10037458 | 3300031235 | Bacteria | 2159 |
| 280 | Ga0265330_10069359 | 3300031235 | Bacteria | 1526 |
| 281 | Ga0265328_10043192 | 3300031239 | Bacteria | 1658 |
| 282 | Ga0265328_10116568 | 3300031239 | Bacteria | 994 |
| 283 | Ga0265320_10031544 | 3300031240 | Bacteria | 2721 |
| 284 | Ga0265325_10005965 | 3300031241 | Bacteria | 7461 |
| 285 | Ga0265325_10163790 | 3300031241 | Bacteria | 1044 |
| 286 | Ga0265329_10023539 | 3300031242 | Bacteria | 2051 |
| 287 | Ga0265340_10027855 | 3300031247 | Bacteria | 2846 |
| 288 | Ga0265340_10054518 | 3300031247 | Bacteria | 1928 |
| 289 | Ga0265339_10003829 | 3300031249 | Bacteria | 10455 |
| 290 | Ga0265339_10072571 | 3300031249 | Bacteria | 1831 |
| 291 | Ga0265327_10002372 | 3300031251 | Bacteria | 20065 |
| 292 | Ga0265327_10082224 | 3300031251 | Bacteria | 1588 |
| 293 | Ga0265327_10133561 | 3300031251 | Bacteria | 1165 |
| 294 | Ga0307513_10119626 | 3300031456 | Bacteria | 2605 |
| 295 | Ga0307513_10209279 | 3300031456 | Bacteria | 1783 |
| 296 | Ga0265313_10005744 | 3300031595 | Bacteria | 9030 |
| 297 | Ga0265313_10010610 | 3300031595 | Bacteria | 5803 |
| 298 | Ga0307508_10747184 | 3300031616 | Bacteria | 591 |
| 299 | Ga0316575_10174733 | 3300031665 | Bacteria | 891 |
| 300 | Ga0265314_10026660 | 3300031711 | Bacteria | 4338 |
| 301 | Ga0265314_10122183 | 3300031711 | Bacteria | 1637 |
| 302 | Ga0265342_10012909 | 3300031712 | Bacteria | 5633 |
| 303 | Ga0265342_10175308 | 3300031712 | Bacteria | 1177 |
| 304 | Ga0265342_10188784 | 3300031712 | Bacteria | 1125 |
| 305 | Ga0307405_10233495 | 3300031731 | Bacteria | 1357 |
| 306 | Ga0316577_10015566 | 3300031733 | Bacteria | 4185 |
| 307 | Ga0307413_10234703 | 3300031824 | Bacteria | 1349 |
| 308 | Ga0307406_10020179 | 3300031901 | Bacteria | 3920 |
| 309 | Ga0307406_10220598 | 3300031901 | Bacteria | 1409 |
| 310 | Ga0307407_10350768 | 3300031903 | Bacteria | 1045 |
| 311 | Ga0307412_10501461 | 3300031911 | Bacteria | 1011 |
| 312 | Ga0307412_10615991 | 3300031911 | Bacteria | 921 |
| 313 | Ga0307409_100160211 | 3300031995 | Bacteria | 1967 |
| 314 | Ga0307409_100183418 | 3300031995 | Bacteria | 1855 |
| 315 | Ga0307414_10158521 | 3300032004 | Bacteria | 1794 |
| 316 | Ga0307414_10251061 | 3300032004 | Bacteria | 1470 |
| 317 | Ga0307414_10279709 | 3300032004 | Bacteria | 1401 |
| 318 | Ga0307414_10362365 | 3300032004 | Bacteria | 1248 |
| 319 | Ga0307414_10503944 | 3300032004 | Bacteria | 1071 |
| 320 | Ga0307414_10536895 | 3300032004 | Bacteria | 1040 |
| 321 | Ga0307414_11017494 | 3300032004 | Bacteria | 763 |
| 322 | Ga0307411_10025036 | 3300032005 | Bacteria | 3568 |
| 323 | Ga0307411_10362977 | 3300032005 | Bacteria | 1185 |
| 324 | Ga0307415_100496592 | 3300032126 | Bacteria | 1066 |
| 325 | Ga0307415_100730290 | 3300032126 | Bacteria | 897 |
| 326 | Ga0316593_10003346 | 3300032168 | Bacteria | 3964 |
| 327 | Ga0316593_10049940 | 3300032168 | Bacteria | 1410 |
| 328 | Ga0316593_10136180 | 3300032168 | Bacteria | 888 |
| 329 | Ga0316596_1014420 | 3300033541 | Bacteria | 1959 |
| 330 | Ga0373928_0006334 | 3300035084 | Bacteria | 2277 |
| 331 | Ga0373944_0011684 | 3300035089 | Bacteria | 2409 |
| 332 | Ga0373945_0319129 | 3300035116 | Bacteria | 668 |
| 333 | Ga0373946_0021471 | 3300035171 | Bacteria | 2504 |
| 334 | Ga0373942_0011773 | 3300035207 | Bacteria | 2079 |
| 335 | Ga0316584_0276083 | 3300036712 | Bacteria | 1222 |
| 336 | Ga0373925_0011853 | 3300037068 | Bacteria | 6309 |
| 337 | Ga0395899_0124663 | 3300037312 | Bacteria | 1843 |
| 338 | Ga0395899_0135084 | 3300037312 | Bacteria | 1758 |
| 339 | Ga0395899_0225003 | 3300037312 | Bacteria | 1298 |
| 340 | Ga0395900_0001326 | 3300037418 | Bacteria | 29962 |
| 341 | Ga0395900_0434395 | 3300037418 | Bacteria | 1271 |
| 342 | Ga0395898_0048963 | 3300037466 | Bacteria | 4143 |
| 343 | Ga0395898_0074152 | 3300037466 | Bacteria | 3287 |
| 344 | Ga0395905_0000858 | 3300037471 | Bacteria | 39725 |
| 345 | Ga0395901_0006588 | 3300038443 | Bacteria | 11733 |
| 346 | Ga0395901_0133546 | 3300038443 | Bacteria | 2608 |
| 347 | Ga0395901_0267197 | 3300038443 | Bacteria | 1780 |
| 348 | Ga0395901_0380795 | 3300038443 | Bacteria | 1452 |
| 349 | Ga0400487_44160 | 3300039110 | Bacteria | 3629 |
| 350 | Ga0436365_0759160 | 3300039437 | Bacteria | 802 |
| 351 | Ga0436365_1043054 | 3300039437 | Bacteria | 883 |
| 352 | Ga0436360_0228618 | 3300039438 | Bacteria | 675 |
| 353 | Ga0436360_1227143 | 3300039438 | Bacteria | 773 |
| 354 | Ga0436361_0283636 | 3300039447 | Bacteria | 1186 |
| 355 | Ga0436361_0743740 | 3300039447 | Bacteria | 979 |
| 356 | Ga0439465_0167991 | 3300041413 | Bacteria | 789 |
| 357 | Ga0451797_0660248 | 3300041453 | Bacteria | 1214 |
| 358 | Ga0451835_0029965 | 3300041492 | Bacteria | 602 |
| 359 | Ga0451845_0932815 | 3300041501 | Bacteria | 806 |
| 360 | Ga0439441_132058 | 3300042001 | Bacteria | 579 |
| 361 | Ga0439432_178502 | 3300042006 | Bacteria | 619 |
| 362 | Ga0439462_0047104 | 3300042015 | Bacteria | 1156 |
| 363 | Ga0439459_0012158 | 3300042438 | Bacteria | 1528 |
| 364 | Ga0466972_0179438 | 3300044658 | Bacteria | 993 |
| 365 | Ga0466961_0172245 | 3300044693 | Bacteria | 1346 |
| 366 | Ga0466963_0419411 | 3300044694 | Bacteria | 944 |
| 367 | Ga0466971_0545625 | 3300044719 | Bacteria | 575 |
| 368 | Ga0466959_0017451 | 3300045049 | Bacteria | 5262 |
| 369 | Ga0466967_0526237 | 3300045976 | Bacteria | 1162 |
| 370 | Ga0495620_0147397 | 3300046515 | Bacteria | 918 |
| 371 | Ga0495644_0037224 | 3300046523 | Bacteria | 1836 |
| 372 | Ga0495642_0100535 | 3300046528 | Bacteria | 1230 |
| 373 | Ga0495598_0000485 | 3300046537 | Bacteria | 7290 |
| 374 | Ga0495597_0296479 | 3300046542 | Bacteria | 628 |
| 375 | Ga0495633_0003352 | 3300046558 | Bacteria | 10748 |
| 376 | Ga0495668_0077225 | 3300046616 | Bacteria | 1828 |
| 377 | Ga0495668_0079185 | 3300046616 | Bacteria | 1804 |
| 378 | Ga0495611_0021759 | 3300046648 | Bacteria | 2771 |
| 379 | Ga0495625_0016914 | 3300046660 | Bacteria | 5723 |
| 380 | Ga0495625_0143909 | 3300046660 | Bacteria | 1607 |
| 381 | Ga0495669_0035371 | 3300046684 | Bacteria | 2205 |
| 382 | Ga0495649_0006906 | 3300046694 | Bacteria | 7022 |
| 383 | Ga0495649_0137210 | 3300046694 | Bacteria | 1289 |
| 384 | Ga0495636_0001365 | 3300047318 | Bacteria | 9237 |
| 385 | Ga0495636_0180044 | 3300047318 | Bacteria | 959 |
| 386 | Ga0495672_0132747 | 3300047320 | Bacteria | 1308 |
| 387 | Ga0495686_0014923 | 3300047472 | Bacteria | 5328 |
| 388 | Ga0495686_0051823 | 3300047472 | Bacteria | 2574 |
| 389 | Ga0496104_0416016 | 3300048907 | Bacteria | 1257 |
| 390 | Ga0496109_0159407 | 3300048912 | Bacteria | 2114 |
| 391 | Ga0496110_0217866 | 3300048913 | Bacteria | 1736 |
| 392 | Ga0496111_0041973 | 3300048914 | Bacteria | 3284 |
| 393 | Ga0496113_0402749 | 3300048916 | Bacteria | 1099 |
| 394 | Ga0496114_0993790 | 3300048917 | Bacteria | 722 |
| 395 | Ga0496116_0026200 | 3300048919 | Bacteria | 4270 |
| 396 | Ga0496119_0046912 | 3300048922 | Bacteria | 2692 |
| 397 | Ga0496120_0051339 | 3300048923 | Bacteria | 2356 |
| 398 | Ga0496121_0035615 | 3300048924 | Bacteria | 4456 |
| 399 | Ga0496121_0360158 | 3300048924 | Bacteria | 966 |
| 400 | Ga0496121_0540723 | 3300048924 | Bacteria | 731 |
| 401 | Ga0496122_0021882 | 3300048925 | Bacteria | 5703 |
| 402 | Ga0496122_0074305 | 3300048925 | Bacteria | 2405 |
| 403 | Ga0496123_0001897 | 3300048926 | Bacteria | 27276 |
| 404 | Ga0496124_0132957 | 3300048927 | Bacteria | 1974 |
| 405 | Ga0496125_0000332 | 3300048928 | Bacteria | 90664 |
| 406 | Ga0496125_0013173 | 3300048928 | Bacteria | 8147 |
| 407 | Ga0496125_0214014 | 3300048928 | Bacteria | 1248 |
| 408 | Ga0496126_0178063 | 3300048929 | Bacteria | 1808 |
| 409 | Ga0496126_0189404 | 3300048929 | Bacteria | 1743 |
| 410 | Ga0496126_0434148 | 3300048929 | Bacteria | 1060 |
| 411 | Ga0501319_002929 | 3300049535 | Bacteria | 1112 |
| 412 | Ga0501031_0031373 | 3300049568 | Bacteria | 3466 |
| 413 | Ga0501031_0418698 | 3300049568 | Bacteria | 866 |
| 414 | Ga0501032_0000353 | 3300049569 | Bacteria | 38266 |
| 415 | Ga0501033_0074646 | 3300049570 | Bacteria | 2489 |
| 416 | Ga0501033_0108928 | 3300049570 | Bacteria | 2017 |
| 417 | Ga0501033_0170158 | 3300049570 | Bacteria | 1565 |
| 418 | Ga0501034_0002037 | 3300049571 | Bacteria | 25398 |
| 419 | Ga0501034_0019877 | 3300049571 | Bacteria | 6861 |
| 420 | Ga0501034_0086350 | 3300049571 | Bacteria | 3138 |
| 421 | Ga0501034_0136346 | 3300049571 | Bacteria | 2435 |
| 422 | Ga0501034_0142332 | 3300049571 | Bacteria | 2377 |
| 423 | Ga0501034_0264458 | 3300049571 | Bacteria | 1662 |
| 424 | Ga0501034_0283362 | 3300049571 | Bacteria | 1596 |
| 425 | Ga0501034_0666762 | 3300049571 | Bacteria | 941 |
| 426 | Ga0501036_0004376 | 3300049572 | Bacteria | 11401 |
| 427 | Ga0501036_0364857 | 3300049572 | Bacteria | 1206 |
| 428 | Ga0501036_0829203 | 3300049572 | Bacteria | 761 |
| 429 | Ga0501037_0009761 | 3300049573 | Bacteria | 7048 |
| 430 | Ga0501037_0415367 | 3300049573 | Bacteria | 921 |
| 431 | Ga0501037_0502170 | 3300049573 | Bacteria | 823 |
| 432 | Ga0501038_0077633 | 3300049574 | Bacteria | 2803 |
| 433 | Ga0501038_0875457 | 3300049574 | Bacteria | 664 |
| 434 | Ga0501039_0412867 | 3300049575 | Bacteria | 1060 |
| 435 | Ga0501043_0093303 | 3300049579 | Bacteria | 2366 |
| 436 | Ga0501043_0172198 | 3300049579 | Bacteria | 1689 |
| 437 | Ga0501046_0090258 | 3300049580 | Bacteria | 2358 |
| 438 | Ga0501047_0022580 | 3300049581 | Bacteria | 6041 |
| 439 | Ga0501047_0101080 | 3300049581 | Bacteria | 2763 |
| 440 | Ga0501047_0198157 | 3300049581 | Bacteria | 1870 |
| 441 | Ga0501067_0005732 | 3300049583 | Bacteria | 6893 |
| 442 | Ga0501067_0063219 | 3300049583 | Bacteria | 2049 |
| 443 | Ga0501070_0005291 | 3300049586 | Bacteria | 11012 |
| 444 | Ga0501070_0070868 | 3300049586 | Bacteria | 2886 |
| 445 | Ga0501070_0109892 | 3300049586 | Bacteria | 2278 |
| 446 | Ga0501070_0850910 | 3300049586 | Bacteria | 714 |
| 447 | Ga0501071_1020826 | 3300049587 | Bacteria | 639 |
| 448 | Ga0501072_0002118 | 3300049588 | Bacteria | 14789 |
| 449 | Ga0501072_0050290 | 3300049588 | Bacteria | 3282 |
| 450 | Ga0501073_0014097 | 3300049589 | Bacteria | 5807 |
| 451 | Ga0501073_0100511 | 3300049589 | Bacteria | 2008 |
| 452 | Ga0501073_0232330 | 3300049589 | Bacteria | 1274 |
| 453 | Ga0501074_0002236 | 3300049590 | Bacteria | 13434 |
| 454 | Ga0501074_0127774 | 3300049590 | Bacteria | 1819 |
| 455 | Ga0501079_0259232 | 3300049741 | Bacteria | 1359 |
| 456 | Ga0501080_0006112 | 3300049742 | Bacteria | 10794 |
| 457 | Ga0501080_0043318 | 3300049742 | Bacteria | 4191 |
| 458 | Ga0501080_0357176 | 3300049742 | Bacteria | 1319 |
| 459 | Ga0501083_0012769 | 3300049744 | Bacteria | 5874 |
| 460 | Ga0501035_0090514 | 3300049822 | Bacteria | 2693 |
| 461 | Ga0501035_0114657 | 3300049822 | Bacteria | 2359 |
| 462 | Ga0501035_0137247 | 3300049822 | Bacteria | 2128 |
| 463 | Ga0501035_0549079 | 3300049822 | Bacteria | 946 |
| 464 | Ga0501044_0025232 | 3300049823 | Bacteria | 6302 |
| 465 | Ga0501044_0064786 | 3300049823 | Bacteria | 3729 |
| 466 | Ga0501044_0167797 | 3300049823 | Bacteria | 2168 |
| 467 | Ga0501044_0406359 | 3300049823 | Bacteria | 1273 |
| 468 | Ga0501044_0495597 | 3300049823 | Bacteria | 1123 |
| 469 | Ga0501045_0469858 | 3300049824 | Bacteria | 935 |
| 470 | nmdc:mga03683_77093_c1 | 3300050489 | Bacteria | 1434 |
| 471 | nmdc:mga03n38_117316_c1 | 3300050490 | Bacteria | 1304 |
| 472 | nmdc:mga00v17_187001_c1 | 3300050491 | Bacteria | 1337 |
| 473 | nmdc:mga00v17_713256_c1 | 3300050491 | Bacteria | 642 |
| 474 | nmdc:mga00v17_72435_c1 | 3300050491 | Bacteria | 2138 |
| 475 | nmdc:mga0k408_199884_c1 | 3300050493 | Bacteria | 1193 |
| 476 | nmdc:mga0k408_263869_c1 | 3300050493 | Bacteria | 1028 |
| 477 | nmdc:mga0k408_294588_c1 | 3300050493 | Bacteria | 968 |
| 478 | nmdc:mga0k408_349461_c1 | 3300050493 | Bacteria | 881 |
| 479 | nmdc:mga0k408_94914_c1 | 3300050493 | Bacteria | 1754 |
| 480 | nmdc:mga06z11_174188_c1 | 3300050494 | Bacteria | 1237 |
| 481 | nmdc:mga06z11_56646_c1 | 3300050494 | Bacteria | 2028 |
| 482 | nmdc:mga04h51_25967_c1 | 3300050495 | Bacteria | 1807 |
| 483 | nmdc:mga07m45_410316_c1 | 3300050496 | Bacteria | 786 |
| 484 | nmdc:mga07m45_43800_c1 | 3300050496 | Bacteria | 2510 |
| 485 | nmdc:mga0a205_603859_c1 | 3300050515 | Bacteria | 950 |
| 486 | nmdc:mga0sz30_47315_c1 | 3300050516 | Bacteria | 1396 |
| 487 | Ga0500643_000723 | 3300053087 | Bacteria | 21742 |
| 488 | Ga0500643_008293 | 3300053087 | Bacteria | 4091 |
| 489 | Ga0500644_0001107 | 3300053088 | Bacteria | 7942 |
| 490 | Ga0500566_0387973 | 3300053094 | Bacteria | 629 |
| 491 | Ga0500641_0011889 | 3300053096 | Bacteria | 3167 |
| 492 | Ga0500555_004874 | 3300053103 | Bacteria | 3808 |
| 493 | Ga0500556_0005007 | 3300053104 | Bacteria | 3748 |
| 494 | Ga0500556_0009636 | 3300053104 | Bacteria | 2812 |
| 495 | Ga0500556_0069962 | 3300053104 | Bacteria | 1309 |
| 496 | Ga0500556_0086223 | 3300053104 | Bacteria | 1194 |
| 497 | Ga0500562_000681 | 3300053108 | Bacteria | 8259 |
| 498 | Ga0500562_090903 | 3300053108 | Bacteria | 828 |
| 499 | Ga0500608_000939 | 3300053122 | Bacteria | 10440 |
| 500 | Ga0500559_0046691 | 3300053136 | Bacteria | 1900 |
| 501 | Ga0500559_0110960 | 3300053136 | Bacteria | 1271 |
| 502 | Ga0500559_0124663 | 3300053136 | Bacteria | 1200 |
| 503 | Ga0500559_0331992 | 3300053136 | Bacteria | 712 |
| 504 | Ga0500568_0030281 | 3300053139 | Bacteria | 2242 |
| 505 | Ga0500604_0000349 | 3300053151 | Bacteria | 12752 |
| 506 | Ga0500616_0056403 | 3300053153 | Bacteria | 2051 |
| 507 | Ga0500616_0082672 | 3300053153 | Bacteria | 1610 |
| 508 | Ga0500622_0008596 | 3300053156 | Bacteria | 5701 |
| 509 | Ga0500622_0150322 | 3300053156 | Bacteria | 1101 |
| 510 | Ga0500624_003122 | 3300053157 | Bacteria | 2184 |
| 511 | Ga0500627_0207561 | 3300053158 | Bacteria | 877 |
| 512 | Ga0500634_0000076 | 3300053161 | Bacteria | 38266 |
| 513 | Ga0500645_003194 | 3300053730 | Bacteria | 6809 |
| 514 | Ga0500645_011120 | 3300053730 | Bacteria | 2950 |
| 515 | Ga0500645_116944 | 3300053730 | Bacteria | 745 |
| 516 | Ga0501084_0820264 | 3300054114 | Bacteria | 783 |
| 517 | Ga0587084_060894 | 3300059477 | Bacteria | 692 |
| 518 | Ga0587084_098001 | 3300059477 | Bacteria | 591 |
| 519 | Ga0587066_016517 | 3300059490 | Bacteria | 1164 |
| 520 | Ga0587070_017442 | 3300059491 | Bacteria | 1164 |
| 521 | Ga0587070_032366 | 3300059491 | Bacteria | 955 |
| 522 | Ga0587070_128421 | 3300059491 | Bacteria | 614 |
| 523 | Ga0587077_009922 | 3300059493 | Bacteria | 1459 |
| 524 | Ga0587077_018511 | 3300059493 | Bacteria | 1200 |
| 525 | Ga0587077_050643 | 3300059493 | Bacteria | 868 |
| 526 | Ga0587077_056346 | 3300059493 | Bacteria | 838 |
| 527 | Ga0587077_056411 | 3300059493 | Bacteria | 838 |
| 528 | Ga0587080_013869 | 3300059503 | Bacteria | 1240 |
| 529 | Ga0587082_019313 | 3300059504 | Bacteria | 1093 |
| 530 | Ga0587082_030216 | 3300059504 | Bacteria | 940 |
| 531 | Ga0587085_024532 | 3300059506 | Bacteria | 946 |
| 532 | Ga0587086_011556 | 3300059507 | Bacteria | 1085 |
| 533 | Ga0587086_019450 | 3300059507 | Bacteria | 914 |
| 534 | Ga0587088_070995 | 3300059508 | Bacteria | 726 |
| 535 | Ga0587091_006642 | 3300059511 | Bacteria | 1634 |
| 536 | Ga0587092_057966 | 3300059512 | Bacteria | 718 |
| 537 | Ga0587106_009910 | 3300059605 | Bacteria | 1222 |
| 538 | Ga0587106_019344 | 3300059605 | Bacteria | 993 |
| 539 | Ga0587101_010360 | 3300059623 | Bacteria | 1169 |
| 540 | Ga0587101_020262 | 3300059623 | Bacteria | 950 |
| 541 | Ga0587109_015552 | 3300059624 | Bacteria | 1293 |
| 542 | Ga0587109_040342 | 3300059624 | Bacteria | 923 |
| 543 | Ga0587127_003572 | 3300059629 | Bacteria | 994 |
| 544 | Ga0587128_015576 | 3300059630 | Bacteria | 1104 |
| 545 | Ga0587128_105633 | 3300059630 | Bacteria | 596 |
| 546 | Ga0587062_003520 | 3300059639 | Bacteria | 1590 |
| 547 | Ga0587062_010141 | 3300059639 | Bacteria | 1163 |
| 548 | Ga0587067_019647 | 3300059640 | Bacteria | 1147 |
| 549 | Ga0587068_012481 | 3300059641 | Bacteria | 1297 |
| 550 | Ga0587069_006174 | 3300059642 | Bacteria | 1430 |
| 551 | Ga0587072_004181 | 3300059643 | Bacteria | 2079 |
| 552 | Ga0587072_027718 | 3300059643 | Bacteria | 1041 |
| 553 | Ga0587075_016471 | 3300059644 | Bacteria | 1051 |
| 554 | Ga0587075_073567 | 3300059644 | Bacteria | 639 |
| 555 | Ga0587075_073891 | 3300059644 | Bacteria | 638 |
| 556 | Ga0587076_026837 | 3300059645 | Bacteria | 994 |
| 557 | Ga0587076_038489 | 3300059645 | Bacteria | 883 |
| 558 | Ga0587076_114693 | 3300059645 | Bacteria | 617 |
| 559 | Ga0587078_007400 | 3300059646 | Bacteria | 1213 |
| 560 | Ga0587100_007304 | 3300059648 | Bacteria | 870 |
| 561 | Ga0587107_007979 | 3300059652 | Bacteria | 1209 |
| 562 | Ga0587107_022463 | 3300059652 | Bacteria | 893 |
| 563 | Ga0587124_002826 | 3300059660 | Bacteria | 1253 |
| 564 | Ga0587124_006690 | 3300059660 | Bacteria | 955 |
| 565 | Ga0587071_038084 | 3300060344 | Bacteria | 954 |
| 566 | Ga0587111_0004584 | 3300060346 | Bacteria | 2069 |
| 567 | Ga0587111_0005023 | 3300060346 | Bacteria | 2013 |
| 568 | Ga0587111_0014909 | 3300060346 | Bacteria | 1412 |
| 569 | Ga0587111_0045636 | 3300060346 | Bacteria | 950 |
| 570 | Ga0501082_0012036 | 3300060353 | Bacteria | 7435 |
| 571 | Ga0466962_0100180 | 3300061719 | Bacteria | 1391 |
| 572 | Ga0530510_0650489 | 3300061734 | Bacteria | 803 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8019678201 | 8019683019 | 168 |
| 2 | iso_pu_bacteria | 2534681786 | 2535484961 | 171 |
| 3 | iso_pu_bacteria | 2751185800 | 2753359590 | 171 |
| 4 | iso_pu_bacteria | 2758568016 | 2758641852 | 171 |
| 5 | iso_pu_bacteria | 2854911287 | 2854912181 | 171 |
| 6 | iso_pu_bacteria | 2915650412 | 2915652217 | 171 |
| 7 | iso_pu_bacteria | 2643221580 | 2643911564 | 172 |
| 8 | iso_pu_bacteria | 2643221591 | 2643963637 | 172 |
| 9 | iso_pu_bacteria | 2643221629 | 2644165919 | 172 |
| 10 | iso_pu_bacteria | 2643221662 | 2644347071 | 172 |
| 11 | iso_pu_bacteria | 2643221674 | 2644410358 | 172 |
| 12 | iso_pu_bacteria | 2932401849 | 2932403048 | 172 |
| 13 | iso_pu_bacteria | 8045864390 | 8045865520 | 172 |
| 14 | 3300027462 | Ga0210000_1021184 | Ga0210000_10211842 | 173 |
| 15 | 3300035116 | Ga0373945_0319129 | Ga0373945_0319129_28_561 | 173 |
| 16 | iso_pu_bacteria | 2894772417 | 2894776363 | 173 |
| 17 | 3300048924 | Ga0496121_0360158 | Ga0496121_0360158_353_877 | 174 |
| 18 | 3300003578 | Ga0006562J51391_1003500 | Ga0006562J51391_10035003 | 175 |
| 19 | 3300005339 | Ga0070660_100480779 | Ga0070660_1004807792 | 175 |
| 20 | 3300005355 | Ga0070671_100512535 | Ga0070671_1005125352 | 175 |
| 21 | 3300005364 | Ga0070673_101590026 | Ga0070673_1015900261 | 175 |
| 22 | 3300005719 | Ga0068861_100271748 | Ga0068861_1002717482 | 175 |
| 23 | 3300005841 | Ga0068863_100499207 | Ga0068863_1004992073 | 175 |
| 24 | 3300005841 | Ga0068863_100566415 | Ga0068863_1005664154 | 175 |
| 25 | 3300005844 | Ga0068862_100673442 | Ga0068862_1006734423 | 175 |
| 26 | 3300009176 | Ga0105242_12211740 | Ga0105242_122117401 | 175 |
| 27 | 3300013297 | Ga0157378_10195211 | Ga0157378_101952114 | 175 |
| 28 | 3300013308 | Ga0157375_10719851 | Ga0157375_107198512 | 175 |
| 29 | 3300014325 | Ga0163163_10221558 | Ga0163163_102215583 | 175 |
| 30 | 3300025919 | Ga0207657_10667359 | Ga0207657_106673591 | 175 |
| 31 | 3300026088 | Ga0207641_11119000 | Ga0207641_111190001 | 175 |
| 32 | 3300026118 | Ga0207675_100264971 | Ga0207675_1002649712 | 175 |
| 33 | 3300028800 | Ga0265338_10072606 | Ga0265338_100726061 | 175 |
| 34 | 3300031090 | Ga0265760_10059085 | Ga0265760_100590852 | 175 |
| 35 | 3300042015 | Ga0439462_0047104 | Ga0439462_0047104_10_537 | 175 |
| 36 | 3300046537 | Ga0495598_0000485 | Ga0495598_0000485_1227_1805 | 175 |
| 37 | 3300047318 | Ga0495636_0001365 | Ga0495636_0001365_519_1091 | 175 |
| 38 | 3300048922 | Ga0496119_0046912 | Ga0496119_0046912_865_1392 | 175 |
| 39 | 3300048923 | Ga0496120_0051339 | Ga0496120_0051339_1243_1770 | 175 |
| 40 | 3300048925 | Ga0496122_0074305 | Ga0496122_0074305_873_1400 | 175 |
| 41 | 3300048928 | Ga0496125_0214014 | Ga0496125_0214014_265_792 | 175 |
| 42 | 3300048929 | Ga0496126_0189404 | Ga0496126_0189404_1094_1621 | 175 |
| 43 | 3300001990 | JGI24737J22298_10029916 | JGI24737J22298_100299163 | 176 |
| 44 | 3300001990 | JGI24737J22298_10091473 | JGI24737J22298_100914731 | 176 |
| 45 | 3300003214 | JGI25165J46597_1001178 | JGI25165J46597_10011787 | 176 |
| 46 | 3300003771 | Ga0055526_1031555 | Ga0055526_10315553 | 176 |
| 47 | 3300003781 | Ga0055536_1004776 | Ga0055536_10047763 | 176 |
| 48 | 3300003794 | Ga0055531_10017052 | Ga0055531_100170521 | 176 |
| 49 | 3300003794 | Ga0055531_10032234 | Ga0055531_100322343 | 176 |
| 50 | 3300005295 | Ga0065707_10008628 | Ga0065707_100086285 | 176 |
| 51 | 3300005327 | Ga0070658_10017387 | Ga0070658_100173876 | 176 |
| 52 | 3300005327 | Ga0070658_10041171 | Ga0070658_100411712 | 176 |
| 53 | 3300005327 | Ga0070658_10077414 | Ga0070658_100774143 | 176 |
| 54 | 3300005327 | Ga0070658_10460850 | Ga0070658_104608502 | 176 |
| 55 | 3300005328 | Ga0070676_10502516 | Ga0070676_105025161 | 176 |
| 56 | 3300005339 | Ga0070660_100167660 | Ga0070660_1001676601 | 176 |
| 57 | 3300005339 | Ga0070660_100957572 | Ga0070660_1009575721 | 176 |
| 58 | 3300005341 | Ga0070691_10011857 | Ga0070691_100118575 | 176 |
| 59 | 3300005344 | Ga0070661_100045249 | Ga0070661_1000452494 | 176 |
| 60 | 3300005344 | Ga0070661_100056918 | Ga0070661_1000569183 | 176 |
| 61 | 3300005344 | Ga0070661_100200235 | Ga0070661_1002002352 | 176 |
| 62 | 3300005347 | Ga0070668_100021350 | Ga0070668_1000213502 | 176 |
| 63 | 3300005347 | Ga0070668_100596944 | Ga0070668_1005969443 | 176 |
| 64 | 3300005347 | Ga0070668_101098586 | Ga0070668_1010985861 | 176 |
| 65 | 3300005353 | Ga0070669_100135037 | Ga0070669_1001350373 | 176 |
| 66 | 3300005354 | Ga0070675_100099531 | Ga0070675_1000995313 | 176 |
| 67 | 3300005356 | Ga0070674_100049876 | Ga0070674_1000498764 | 176 |
| 68 | 3300005364 | Ga0070673_100015008 | Ga0070673_1000150083 | 176 |
| 69 | 3300005366 | Ga0070659_100115700 | Ga0070659_1001157003 | 176 |
| 70 | 3300005367 | Ga0070667_100064208 | Ga0070667_1000642085 | 176 |
| 71 | 3300005455 | Ga0070663_100189296 | Ga0070663_1001892962 | 176 |
| 72 | 3300005455 | Ga0070663_100243034 | Ga0070663_1002430342 | 176 |
| 73 | 3300005455 | Ga0070663_100321331 | Ga0070663_1003213312 | 176 |
| 74 | 3300005456 | Ga0070678_100521948 | Ga0070678_1005219481 | 176 |
| 75 | 3300005457 | Ga0070662_100296732 | Ga0070662_1002967322 | 176 |
| 76 | 3300005458 | Ga0070681_10045736 | Ga0070681_100457366 | 176 |
| 77 | 3300005459 | Ga0068867_100221002 | Ga0068867_1002210022 | 176 |
| 78 | 3300005467 | Ga0070706_100773966 | Ga0070706_1007739661 | 176 |
| 79 | 3300005468 | Ga0070707_100283004 | Ga0070707_1002830043 | 176 |
| 80 | 3300005471 | Ga0070698_100205515 | Ga0070698_1002055153 | 176 |
| 81 | 3300005530 | Ga0070679_100056140 | Ga0070679_1000561405 | 176 |
| 82 | 3300005530 | Ga0070679_100637320 | Ga0070679_1006373202 | 176 |
| 83 | 3300005535 | Ga0070684_100594042 | Ga0070684_1005940422 | 176 |
| 84 | 3300005539 | Ga0068853_100124568 | Ga0068853_1001245682 | 176 |
| 85 | 3300005539 | Ga0068853_100231270 | Ga0068853_1002312703 | 176 |
| 86 | 3300005539 | Ga0068853_100353910 | Ga0068853_1003539101 | 176 |
| 87 | 3300005548 | Ga0070665_100035135 | Ga0070665_1000351352 | 176 |
| 88 | 3300005548 | Ga0070665_100371123 | Ga0070665_1003711232 | 176 |
| 89 | 3300005548 | Ga0070665_100716483 | Ga0070665_1007164831 | 176 |
| 90 | 3300005563 | Ga0068855_100016530 | Ga0068855_1000165303 | 176 |
| 91 | 3300005563 | Ga0068855_100161316 | Ga0068855_1001613163 | 176 |
| 92 | 3300005563 | Ga0068855_100207020 | Ga0068855_1002070205 | 176 |
| 93 | 3300005564 | Ga0070664_100518560 | Ga0070664_1005185601 | 176 |
| 94 | 3300005577 | Ga0068857_100298148 | Ga0068857_1002981483 | 176 |
| 95 | 3300005577 | Ga0068857_100298253 | Ga0068857_1002982532 | 176 |
| 96 | 3300005577 | Ga0068857_100756751 | Ga0068857_1007567511 | 176 |
| 97 | 3300005578 | Ga0068854_100013680 | Ga0068854_1000136802 | 176 |
| 98 | 3300005578 | Ga0068854_100161487 | Ga0068854_1001614873 | 176 |
| 99 | 3300005578 | Ga0068854_100321532 | Ga0068854_1003215322 | 176 |
| 100 | 3300005614 | Ga0068856_100261567 | Ga0068856_1002615671 | 176 |
| 101 | 3300005614 | Ga0068856_100556211 | Ga0068856_1005562111 | 176 |
| 102 | 3300005614 | Ga0068856_100564899 | Ga0068856_1005648992 | 176 |
| 103 | 3300005616 | Ga0068852_100014810 | Ga0068852_1000148108 | 176 |
| 104 | 3300005616 | Ga0068852_100019933 | Ga0068852_1000199335 | 176 |
| 105 | 3300005616 | Ga0068852_100031036 | Ga0068852_1000310365 | 176 |
| 106 | 3300005616 | Ga0068852_100196644 | Ga0068852_1001966443 | 176 |
| 107 | 3300005616 | Ga0068852_100607335 | Ga0068852_1006073352 | 176 |
| 108 | 3300005616 | Ga0068852_100685816 | Ga0068852_1006858161 | 176 |
| 109 | 3300005719 | Ga0068861_100585815 | Ga0068861_1005858152 | 176 |
| 110 | 3300005834 | Ga0068851_10130937 | Ga0068851_101309372 | 176 |
| 111 | 3300005842 | Ga0068858_100633646 | Ga0068858_1006336461 | 176 |
| 112 | 3300005844 | Ga0068862_100038014 | Ga0068862_1000380144 | 176 |
| 113 | 3300005844 | Ga0068862_100525435 | Ga0068862_1005254354 | 176 |
| 114 | 3300006048 | Ga0075363_100032369 | Ga0075363_1000323693 | 176 |
| 115 | 3300006048 | Ga0075363_100153758 | Ga0075363_1001537582 | 176 |
| 116 | 3300006048 | Ga0075363_100159528 | Ga0075363_1001595283 | 176 |
| 117 | 3300006051 | Ga0075364_10041501 | Ga0075364_100415012 | 176 |
| 118 | 3300006177 | Ga0075362_10036652 | Ga0075362_100366521 | 176 |
| 119 | 3300006177 | Ga0075362_10124060 | Ga0075362_101240602 | 176 |
| 120 | 3300006177 | Ga0075362_10369604 | Ga0075362_103696041 | 176 |
| 121 | 3300006178 | Ga0075367_10207723 | Ga0075367_102077232 | 176 |
| 122 | 3300006195 | Ga0075366_10019485 | Ga0075366_100194853 | 176 |
| 123 | 3300006195 | Ga0075366_10055078 | Ga0075366_100550782 | 176 |
| 124 | 3300006237 | Ga0097621_100206393 | Ga0097621_1002063933 | 176 |
| 125 | 3300006237 | Ga0097621_100627304 | Ga0097621_1006273042 | 176 |
| 126 | 3300006353 | Ga0075370_10103997 | Ga0075370_101039972 | 176 |
| 127 | 3300006844 | Ga0075428_100162011 | Ga0075428_1001620114 | 176 |
| 128 | 3300006852 | Ga0075433_10797560 | Ga0075433_107975601 | 176 |
| 129 | 3300006871 | Ga0075434_100065894 | Ga0075434_1000658942 | 176 |
| 130 | 3300006880 | Ga0075429_100390759 | Ga0075429_1003907591 | 176 |
| 131 | 3300006881 | Ga0068865_100446886 | Ga0068865_1004468862 | 176 |
| 132 | 3300009093 | Ga0105240_10039401 | Ga0105240_100394013 | 176 |
| 133 | 3300009093 | Ga0105240_10176263 | Ga0105240_101762633 | 176 |
| 134 | 3300009093 | Ga0105240_10297949 | Ga0105240_102979491 | 176 |
| 135 | 3300009093 | Ga0105240_10301988 | Ga0105240_103019883 | 176 |
| 136 | 3300009093 | Ga0105240_11430459 | Ga0105240_114304591 | 176 |
| 137 | 3300009147 | Ga0114129_10930662 | Ga0114129_109306623 | 176 |
| 138 | 3300009148 | Ga0105243_10426046 | Ga0105243_104260462 | 176 |
| 139 | 3300009174 | Ga0105241_10049359 | Ga0105241_100493594 | 176 |
| 140 | 3300009174 | Ga0105241_10252956 | Ga0105241_102529562 | 176 |
| 141 | 3300009174 | Ga0105241_10669745 | Ga0105241_106697451 | 176 |
| 142 | 3300009545 | Ga0105237_10036531 | Ga0105237_100365318 | 176 |
| 143 | 3300009545 | Ga0105237_10042299 | Ga0105237_100422996 | 176 |
| 144 | 3300009551 | Ga0105238_10050244 | Ga0105238_100502445 | 176 |
| 145 | 3300009551 | Ga0105238_10092832 | Ga0105238_100928324 | 176 |
| 146 | 3300009551 | Ga0105238_10110685 | Ga0105238_101106853 | 176 |
| 147 | 3300009551 | Ga0105238_10153410 | Ga0105238_101534102 | 176 |
| 148 | 3300009551 | Ga0105238_10303261 | Ga0105238_103032613 | 176 |
| 149 | 3300010375 | Ga0105239_10001871 | Ga0105239_1000187131 | 176 |
| 150 | 3300010375 | Ga0105239_10287130 | Ga0105239_102871303 | 176 |
| 151 | 3300010375 | Ga0105239_10365486 | Ga0105239_103654863 | 176 |
| 152 | 3300010375 | Ga0105239_10564536 | Ga0105239_105645362 | 176 |
| 153 | 3300010375 | Ga0105239_11578846 | Ga0105239_115788462 | 176 |
| 154 | 3300013100 | Ga0157373_10177775 | Ga0157373_101777753 | 176 |
| 155 | 3300013102 | Ga0157371_10045139 | Ga0157371_100451392 | 176 |
| 156 | 3300013102 | Ga0157371_10391427 | Ga0157371_103914272 | 176 |
| 157 | 3300013104 | Ga0157370_10011802 | Ga0157370_1001180210 | 176 |
| 158 | 3300013104 | Ga0157370_10078661 | Ga0157370_100786612 | 176 |
| 159 | 3300013104 | Ga0157370_10166128 | Ga0157370_101661283 | 176 |
| 160 | 3300013104 | Ga0157370_10278139 | Ga0157370_102781393 | 176 |
| 161 | 3300013104 | Ga0157370_10683615 | Ga0157370_106836151 | 176 |
| 162 | 3300013104 | Ga0157370_10727358 | Ga0157370_107273581 | 176 |
| 163 | 3300013105 | Ga0157369_10015798 | Ga0157369_100157983 | 176 |
| 164 | 3300013105 | Ga0157369_10069561 | Ga0157369_100695613 | 176 |
| 165 | 3300013105 | Ga0157369_10145414 | Ga0157369_101454142 | 176 |
| 166 | 3300013105 | Ga0157369_10214492 | Ga0157369_102144922 | 176 |
| 167 | 3300013296 | Ga0157374_10062348 | Ga0157374_100623483 | 176 |
| 168 | 3300013296 | Ga0157374_10339675 | Ga0157374_103396752 | 176 |
| 169 | 3300013296 | Ga0157374_10482202 | Ga0157374_104822022 | 176 |
| 170 | 3300013296 | Ga0157374_11510612 | Ga0157374_115106121 | 176 |
| 171 | 3300013297 | Ga0157378_10220349 | Ga0157378_102203492 | 176 |
| 172 | 3300013297 | Ga0157378_10261139 | Ga0157378_102611393 | 176 |
| 173 | 3300013306 | Ga0163162_11979186 | Ga0163162_119791861 | 176 |
| 174 | 3300013307 | Ga0157372_10186538 | Ga0157372_101865382 | 176 |
| 175 | 3300014325 | Ga0163163_10535051 | Ga0163163_105350511 | 176 |
| 176 | 3300014325 | Ga0163163_10628292 | Ga0163163_106282922 | 176 |
| 177 | 3300014325 | Ga0163163_10628730 | Ga0163163_106287303 | 176 |
| 178 | 3300014969 | Ga0157376_10329655 | Ga0157376_103296551 | 176 |
| 179 | 3300014969 | Ga0157376_10823102 | Ga0157376_108231022 | 176 |
| 180 | 3300015262 | Ga0182007_10016613 | Ga0182007_100166134 | 176 |
| 181 | 3300015684 | Ga0183365_10002 | Ga0183365_10002512 | 176 |
| 182 | 3300020070 | Ga0206356_10005975 | Ga0206356_100059751 | 176 |
| 183 | 3300020076 | Ga0206355_1286819 | Ga0206355_12868191 | 176 |
| 184 | 3300020080 | Ga0206350_11644842 | Ga0206350_116448421 | 176 |
| 185 | 3300020081 | Ga0206354_10838826 | Ga0206354_108388262 | 176 |
| 186 | 3300025231 | Ga0207427_103465 | Ga0207427_1034653 | 176 |
| 187 | 3300025250 | Ga0209026_1008620 | Ga0209026_10086205 | 176 |
| 188 | 3300025261 | Ga0209233_1000293 | Ga0209233_100029352 | 176 |
| 189 | 3300025291 | Ga0209675_1007439 | Ga0209675_10074394 | 176 |
| 190 | 3300025292 | Ga0209676_1000568 | Ga0209676_100056856 | 176 |
| 191 | 3300025295 | Ga0209564_1001858 | Ga0209564_100185811 | 176 |
| 192 | 3300025298 | Ga0209050_1016696 | Ga0209050_10166963 | 176 |
| 193 | 3300025303 | Ga0209051_1051975 | Ga0209051_10519751 | 176 |
| 194 | 3300025304 | Ga0209257_1000409 | Ga0209257_10004099 | 176 |
| 195 | 3300025304 | Ga0209257_1008579 | Ga0209257_10085791 | 176 |
| 196 | 3300025899 | Ga0207642_10268798 | Ga0207642_102687981 | 176 |
| 197 | 3300025903 | Ga0207680_10407760 | Ga0207680_104077602 | 176 |
| 198 | 3300025904 | Ga0207647_10144628 | Ga0207647_101446283 | 176 |
| 199 | 3300025904 | Ga0207647_10350067 | Ga0207647_103500671 | 176 |
| 200 | 3300025909 | Ga0207705_10014607 | Ga0207705_100146076 | 176 |
| 201 | 3300025909 | Ga0207705_10019991 | Ga0207705_100199913 | 176 |
| 202 | 3300025909 | Ga0207705_10042944 | Ga0207705_100429443 | 176 |
| 203 | 3300025911 | Ga0207654_10173551 | Ga0207654_101735514 | 176 |
| 204 | 3300025911 | Ga0207654_10186551 | Ga0207654_101865513 | 176 |
| 205 | 3300025911 | Ga0207654_10198524 | Ga0207654_101985242 | 176 |
| 206 | 3300025911 | Ga0207654_10272905 | Ga0207654_102729052 | 176 |
| 207 | 3300025912 | Ga0207707_10129012 | Ga0207707_101290123 | 176 |
| 208 | 3300025913 | Ga0207695_10002347 | Ga0207695_1000234734 | 176 |
| 209 | 3300025913 | Ga0207695_10039790 | Ga0207695_100397907 | 176 |
| 210 | 3300025913 | Ga0207695_10133597 | Ga0207695_101335971 | 176 |
| 211 | 3300025913 | Ga0207695_10170220 | Ga0207695_101702202 | 176 |
| 212 | 3300025913 | Ga0207695_10172095 | Ga0207695_101720951 | 176 |
| 213 | 3300025913 | Ga0207695_10215654 | Ga0207695_102156544 | 176 |
| 214 | 3300025913 | Ga0207695_11161795 | Ga0207695_111617951 | 176 |
| 215 | 3300025914 | Ga0207671_10005841 | Ga0207671_100058416 | 176 |
| 216 | 3300025914 | Ga0207671_10337702 | Ga0207671_103377022 | 176 |
| 217 | 3300025914 | Ga0207671_10631931 | Ga0207671_106319311 | 176 |
| 218 | 3300025917 | Ga0207660_10102435 | Ga0207660_101024355 | 176 |
| 219 | 3300025919 | Ga0207657_10009003 | Ga0207657_100090034 | 176 |
| 220 | 3300025919 | Ga0207657_10039932 | Ga0207657_100399324 | 176 |
| 221 | 3300025919 | Ga0207657_10073177 | Ga0207657_100731774 | 176 |
| 222 | 3300025919 | Ga0207657_10201488 | Ga0207657_102014882 | 176 |
| 223 | 3300025919 | Ga0207657_10962021 | Ga0207657_109620211 | 176 |
| 224 | 3300025920 | Ga0207649_10113110 | Ga0207649_101131102 | 176 |
| 225 | 3300025920 | Ga0207649_10216965 | Ga0207649_102169652 | 176 |
| 226 | 3300025921 | Ga0207652_10098985 | Ga0207652_100989851 | 176 |
| 227 | 3300025921 | Ga0207652_10233045 | Ga0207652_102330453 | 176 |
| 228 | 3300025922 | Ga0207646_10125253 | Ga0207646_101252534 | 176 |
| 229 | 3300025923 | Ga0207681_10312307 | Ga0207681_103123072 | 176 |
| 230 | 3300025924 | Ga0207694_10013345 | Ga0207694_100133451 | 176 |
| 231 | 3300025924 | Ga0207694_10067712 | Ga0207694_100677121 | 176 |
| 232 | 3300025924 | Ga0207694_10088815 | Ga0207694_100888152 | 176 |
| 233 | 3300025924 | Ga0207694_10375311 | Ga0207694_103753111 | 176 |
| 234 | 3300025926 | Ga0207659_10194263 | Ga0207659_101942633 | 176 |
| 235 | 3300025927 | Ga0207687_10475150 | Ga0207687_104751502 | 176 |
| 236 | 3300025931 | Ga0207644_10354202 | Ga0207644_103542023 | 176 |
| 237 | 3300025933 | Ga0207706_10058547 | Ga0207706_100585471 | 176 |
| 238 | 3300025933 | Ga0207706_10306323 | Ga0207706_103063231 | 176 |
| 239 | 3300025935 | Ga0207709_10377901 | Ga0207709_103779012 | 176 |
| 240 | 3300025938 | Ga0207704_10170643 | Ga0207704_101706433 | 176 |
| 241 | 3300025940 | Ga0207691_10990864 | Ga0207691_109908641 | 176 |
| 242 | 3300025942 | Ga0207689_10238851 | Ga0207689_102388512 | 176 |
| 243 | 3300025944 | Ga0207661_10380218 | Ga0207661_103802183 | 176 |
| 244 | 3300025949 | Ga0207667_10000877 | Ga0207667_1000087743 | 176 |
| 245 | 3300025949 | Ga0207667_10047577 | Ga0207667_100475773 | 176 |
| 246 | 3300025949 | Ga0207667_10088375 | Ga0207667_100883753 | 176 |
| 247 | 3300025949 | Ga0207667_10358009 | Ga0207667_103580094 | 176 |
| 248 | 3300025960 | Ga0207651_10106272 | Ga0207651_101062722 | 176 |
| 249 | 3300025961 | Ga0207712_10158067 | Ga0207712_101580673 | 176 |
| 250 | 3300025972 | Ga0207668_10340869 | Ga0207668_103408693 | 176 |
| 251 | 3300025972 | Ga0207668_10718429 | Ga0207668_107184291 | 176 |
| 252 | 3300025981 | Ga0207640_10058682 | Ga0207640_100586824 | 176 |
| 253 | 3300025986 | Ga0207658_10476683 | Ga0207658_104766832 | 176 |
| 254 | 3300026041 | Ga0207639_10026524 | Ga0207639_100265246 | 176 |
| 255 | 3300026041 | Ga0207639_10058875 | Ga0207639_100588753 | 176 |
| 256 | 3300026041 | Ga0207639_10178462 | Ga0207639_101784622 | 176 |
| 257 | 3300026041 | Ga0207639_10200245 | Ga0207639_102002453 | 176 |
| 258 | 3300026041 | Ga0207639_10895592 | Ga0207639_108955922 | 176 |
| 259 | 3300026067 | Ga0207678_10098005 | Ga0207678_100980052 | 176 |
| 260 | 3300026067 | Ga0207678_10210936 | Ga0207678_102109361 | 176 |
| 261 | 3300026067 | Ga0207678_10260388 | Ga0207678_102603882 | 176 |
| 262 | 3300026067 | Ga0207678_10460391 | Ga0207678_104603912 | 176 |
| 263 | 3300026078 | Ga0207702_10023908 | Ga0207702_100239083 | 176 |
| 264 | 3300026078 | Ga0207702_10198970 | Ga0207702_101989701 | 176 |
| 265 | 3300026078 | Ga0207702_10565401 | Ga0207702_105654013 | 176 |
| 266 | 3300026088 | Ga0207641_10543028 | Ga0207641_105430284 | 176 |
| 267 | 3300026089 | Ga0207648_10217674 | Ga0207648_102176742 | 176 |
| 268 | 3300026089 | Ga0207648_10299591 | Ga0207648_102995913 | 176 |
| 269 | 3300026089 | Ga0207648_10357381 | Ga0207648_103573812 | 176 |
| 270 | 3300026089 | Ga0207648_10845726 | Ga0207648_108457261 | 176 |
| 271 | 3300026095 | Ga0207676_10347186 | Ga0207676_103471862 | 176 |
| 272 | 3300026116 | Ga0207674_10057512 | Ga0207674_100575125 | 176 |
| 273 | 3300026116 | Ga0207674_10133008 | Ga0207674_101330083 | 176 |
| 274 | 3300026116 | Ga0207674_10417767 | Ga0207674_104177673 | 176 |
| 275 | 3300026116 | Ga0207674_10621237 | Ga0207674_106212372 | 176 |
| 276 | 3300026121 | Ga0207683_10043859 | Ga0207683_100438595 | 176 |
| 277 | 3300026121 | Ga0207683_11014296 | Ga0207683_110142961 | 176 |
| 278 | 3300026142 | Ga0207698_10016172 | Ga0207698_100161723 | 176 |
| 279 | 3300026142 | Ga0207698_10035856 | Ga0207698_100358564 | 176 |
| 280 | 3300026142 | Ga0207698_10047659 | Ga0207698_100476593 | 176 |
| 281 | 3300026142 | Ga0207698_10394137 | Ga0207698_103941373 | 176 |
| 282 | 3300026142 | Ga0207698_10441553 | Ga0207698_104415533 | 176 |
| 283 | 3300027252 | Ga0209973_1014726 | Ga0209973_10147262 | 176 |
| 284 | 3300027378 | Ga0209981_1003112 | Ga0209981_10031124 | 176 |
| 285 | 3300027543 | Ga0209999_1001433 | Ga0209999_10014337 | 176 |
| 286 | 3300027665 | Ga0209983_1008868 | Ga0209983_10088683 | 176 |
| 287 | 3300027866 | Ga0209813_10090951 | Ga0209813_100909512 | 176 |
| 288 | 3300028379 | Ga0268266_10008349 | Ga0268266_1000834912 | 176 |
| 289 | 3300028379 | Ga0268266_10316468 | Ga0268266_103164683 | 176 |
| 290 | 3300028380 | Ga0268265_10023575 | Ga0268265_100235755 | 176 |
| 291 | 3300028381 | Ga0268264_10559536 | Ga0268264_105595362 | 176 |
| 292 | 3300028563 | Ga0265319_1019867 | Ga0265319_10198672 | 176 |
| 293 | 3300028563 | Ga0265319_1088226 | Ga0265319_10882262 | 176 |
| 294 | 3300028577 | Ga0265318_10028411 | Ga0265318_100284113 | 176 |
| 295 | 3300028786 | Ga0307517_10017315 | Ga0307517_100173154 | 176 |
| 296 | 3300028786 | Ga0307517_10153850 | Ga0307517_101538502 | 176 |
| 297 | 3300028794 | Ga0307515_10389197 | Ga0307515_103891972 | 176 |
| 298 | 3300028794 | Ga0307515_10583476 | Ga0307515_105834761 | 176 |
| 299 | 3300028800 | Ga0265338_10005488 | Ga0265338_1000548817 | 176 |
| 300 | 3300028800 | Ga0265338_10175726 | Ga0265338_101757261 | 176 |
| 301 | 3300028800 | Ga0265338_10360529 | Ga0265338_103605292 | 176 |
| 302 | 3300028800 | Ga0265338_10533449 | Ga0265338_105334491 | 176 |
| 303 | 3300031235 | Ga0265330_10037458 | Ga0265330_100374582 | 176 |
| 304 | 3300031235 | Ga0265330_10069359 | Ga0265330_100693592 | 176 |
| 305 | 3300031239 | Ga0265328_10043192 | Ga0265328_100431923 | 176 |
| 306 | 3300031239 | Ga0265328_10116568 | Ga0265328_101165682 | 176 |
| 307 | 3300031240 | Ga0265320_10031544 | Ga0265320_100315442 | 176 |
| 308 | 3300031241 | Ga0265325_10005965 | Ga0265325_1000596510 | 176 |
| 309 | 3300031241 | Ga0265325_10163790 | Ga0265325_101637902 | 176 |
| 310 | 3300031242 | Ga0265329_10023539 | Ga0265329_100235392 | 176 |
| 311 | 3300031247 | Ga0265340_10027855 | Ga0265340_100278553 | 176 |
| 312 | 3300031247 | Ga0265340_10054518 | Ga0265340_100545184 | 176 |
| 313 | 3300031249 | Ga0265339_10003829 | Ga0265339_1000382918 | 176 |
| 314 | 3300031249 | Ga0265339_10072571 | Ga0265339_100725713 | 176 |
| 315 | 3300031251 | Ga0265327_10002372 | Ga0265327_100023724 | 176 |
| 316 | 3300031251 | Ga0265327_10082224 | Ga0265327_100822242 | 176 |
| 317 | 3300031251 | Ga0265327_10133561 | Ga0265327_101335611 | 176 |
| 318 | 3300031456 | Ga0307513_10119626 | Ga0307513_101196263 | 176 |
| 319 | 3300031456 | Ga0307513_10209279 | Ga0307513_102092793 | 176 |
| 320 | 3300031595 | Ga0265313_10005744 | Ga0265313_100057447 | 176 |
| 321 | 3300031595 | Ga0265313_10010610 | Ga0265313_100106103 | 176 |
| 322 | 3300031616 | Ga0307508_10747184 | Ga0307508_107471841 | 176 |
| 323 | 3300031665 | Ga0316575_10174733 | Ga0316575_101747331 | 176 |
| 324 | 3300031711 | Ga0265314_10026660 | Ga0265314_100266606 | 176 |
| 325 | 3300031711 | Ga0265314_10122183 | Ga0265314_101221833 | 176 |
| 326 | 3300031712 | Ga0265342_10012909 | Ga0265342_100129095 | 176 |
| 327 | 3300031712 | Ga0265342_10175308 | Ga0265342_101753082 | 176 |
| 328 | 3300031712 | Ga0265342_10188784 | Ga0265342_101887842 | 176 |
| 329 | 3300031731 | Ga0307405_10233495 | Ga0307405_102334952 | 176 |
| 330 | 3300031733 | Ga0316577_10015566 | Ga0316577_100155664 | 176 |
| 331 | 3300031824 | Ga0307413_10234703 | Ga0307413_102347032 | 176 |
| 332 | 3300031901 | Ga0307406_10020179 | Ga0307406_100201795 | 176 |
| 333 | 3300031901 | Ga0307406_10220598 | Ga0307406_102205982 | 176 |
| 334 | 3300031903 | Ga0307407_10350768 | Ga0307407_103507683 | 176 |
| 335 | 3300031911 | Ga0307412_10501461 | Ga0307412_105014612 | 176 |
| 336 | 3300031911 | Ga0307412_10615991 | Ga0307412_106159911 | 176 |
| 337 | 3300031995 | Ga0307409_100160211 | Ga0307409_1001602111 | 176 |
| 338 | 3300031995 | Ga0307409_100183418 | Ga0307409_1001834183 | 176 |
| 339 | 3300032004 | Ga0307414_10158521 | Ga0307414_101585213 | 176 |
| 340 | 3300032004 | Ga0307414_10251061 | Ga0307414_102510613 | 176 |
| 341 | 3300032004 | Ga0307414_10279709 | Ga0307414_102797092 | 176 |
| 342 | 3300032004 | Ga0307414_10362365 | Ga0307414_103623651 | 176 |
| 343 | 3300032004 | Ga0307414_10503944 | Ga0307414_105039442 | 176 |
| 344 | 3300032004 | Ga0307414_10536895 | Ga0307414_105368952 | 176 |
| 345 | 3300032004 | Ga0307414_11017494 | Ga0307414_110174941 | 176 |
| 346 | 3300032005 | Ga0307411_10025036 | Ga0307411_100250361 | 176 |
| 347 | 3300032005 | Ga0307411_10362977 | Ga0307411_103629771 | 176 |
| 348 | 3300032126 | Ga0307415_100496592 | Ga0307415_1004965922 | 176 |
| 349 | 3300032126 | Ga0307415_100730290 | Ga0307415_1007302901 | 176 |
| 350 | 3300032168 | Ga0316593_10003346 | Ga0316593_100033462 | 176 |
| 351 | 3300032168 | Ga0316593_10049940 | Ga0316593_100499402 | 176 |
| 352 | 3300032168 | Ga0316593_10136180 | Ga0316593_101361802 | 176 |
| 353 | 3300033541 | Ga0316596_1014420 | Ga0316596_10144203 | 176 |
| 354 | 3300035084 | Ga0373928_0006334 | Ga0373928_0006334_1073_1603 | 176 |
| 355 | 3300035089 | Ga0373944_0011684 | Ga0373944_0011684_1644_2216 | 176 |
| 356 | 3300035171 | Ga0373946_0021471 | Ga0373946_0021471_1592_2158 | 176 |
| 357 | 3300035207 | Ga0373942_0011773 | Ga0373942_0011773_803_1333 | 176 |
| 358 | 3300036712 | Ga0316584_0276083 | Ga0316584_0276083_120_650 | 176 |
| 359 | 3300037068 | Ga0373925_0011853 | Ga0373925_0011853_4875_5444 | 176 |
| 360 | 3300037312 | Ga0395899_0124663 | Ga0395899_0124663_803_1333 | 176 |
| 361 | 3300037312 | Ga0395899_0135084 | Ga0395899_0135084_1049_1579 | 176 |
| 362 | 3300037312 | Ga0395899_0225003 | Ga0395899_0225003_106_675 | 176 |
| 363 | 3300037418 | Ga0395900_0001326 | Ga0395900_0001326_25188_25760 | 176 |
| 364 | 3300037418 | Ga0395900_0434395 | Ga0395900_0434395_135_665 | 176 |
| 365 | 3300037466 | Ga0395898_0048963 | Ga0395898_0048963_423_953 | 176 |
| 366 | 3300037466 | Ga0395898_0074152 | Ga0395898_0074152_1390_1920 | 176 |
| 367 | 3300037471 | Ga0395905_0000858 | Ga0395905_0000858_20348_20923 | 176 |
| 368 | 3300038443 | Ga0395901_0006588 | Ga0395901_0006588_2400_2972 | 176 |
| 369 | 3300038443 | Ga0395901_0133546 | Ga0395901_0133546_1943_2473 | 176 |
| 370 | 3300038443 | Ga0395901_0267197 | Ga0395901_0267197_884_1414 | 176 |
| 371 | 3300038443 | Ga0395901_0380795 | Ga0395901_0380795_347_919 | 176 |
| 372 | 3300039110 | Ga0400487_44160 | Ga0400487_44160_2750_3292 | 176 |
| 373 | 3300039437 | Ga0436365_0759160 | Ga0436365_0759160_134_706 | 176 |
| 374 | 3300039437 | Ga0436365_1043054 | Ga0436365_1043054_197_727 | 176 |
| 375 | 3300039438 | Ga0436360_0228618 | Ga0436360_0228618_71_643 | 176 |
| 376 | 3300039438 | Ga0436360_1227143 | Ga0436360_1227143_142_711 | 176 |
| 377 | 3300039447 | Ga0436361_0283636 | Ga0436361_0283636_71_643 | 176 |
| 378 | 3300039447 | Ga0436361_0743740 | Ga0436361_0743740_116_688 | 176 |
| 379 | 3300041413 | Ga0439465_0167991 | Ga0439465_0167991_98_628 | 176 |
| 380 | 3300041453 | Ga0451797_0660248 | Ga0451797_0660248_163_693 | 176 |
| 381 | 3300041492 | Ga0451835_0029965 | Ga0451835_0029965_15_545 | 176 |
| 382 | 3300041501 | Ga0451845_0932815 | Ga0451845_0932815_133_663 | 176 |
| 383 | 3300042001 | Ga0439441_132058 | Ga0439441_132058_39_569 | 176 |
| 384 | 3300042006 | Ga0439432_178502 | Ga0439432_178502_52_582 | 176 |
| 385 | 3300042438 | Ga0439459_0012158 | Ga0439459_0012158_924_1457 | 176 |
| 386 | 3300044658 | Ga0466972_0179438 | Ga0466972_0179438_51_584 | 176 |
| 387 | 3300044693 | Ga0466961_0172245 | Ga0466961_0172245_649_1224 | 176 |
| 388 | 3300044694 | Ga0466963_0419411 | Ga0466963_0419411_29_610 | 176 |
| 389 | 3300044719 | Ga0466971_0545625 | Ga0466971_0545625_31_561 | 176 |
| 390 | 3300045049 | Ga0466959_0017451 | Ga0466959_0017451_1357_1926 | 176 |
| 391 | 3300045976 | Ga0466967_0526237 | Ga0466967_0526237_419_976 | 176 |
| 392 | 3300046515 | Ga0495620_0147397 | Ga0495620_0147397_43_615 | 176 |
| 393 | 3300046523 | Ga0495644_0037224 | Ga0495644_0037224_1000_1566 | 176 |
| 394 | 3300046528 | Ga0495642_0100535 | Ga0495642_0100535_495_1061 | 176 |
| 395 | 3300046542 | Ga0495597_0296479 | Ga0495597_0296479_25_594 | 176 |
| 396 | 3300046558 | Ga0495633_0003352 | Ga0495633_0003352_6584_7159 | 176 |
| 397 | 3300046616 | Ga0495668_0077225 | Ga0495668_0077225_932_1501 | 176 |
| 398 | 3300046616 | Ga0495668_0079185 | Ga0495668_0079185_238_771 | 176 |
| 399 | 3300046648 | Ga0495611_0021759 | Ga0495611_0021759_1412_1978 | 176 |
| 400 | 3300046660 | Ga0495625_0016914 | Ga0495625_0016914_4513_5079 | 176 |
| 401 | 3300046660 | Ga0495625_0143909 | Ga0495625_0143909_62_631 | 176 |
| 402 | 3300046684 | Ga0495669_0035371 | Ga0495669_0035371_195_761 | 176 |
| 403 | 3300046694 | Ga0495649_0006906 | Ga0495649_0006906_5264_5842 | 176 |
| 404 | 3300046694 | Ga0495649_0137210 | Ga0495649_0137210_707_1237 | 176 |
| 405 | 3300047318 | Ga0495636_0180044 | Ga0495636_0180044_251_835 | 176 |
| 406 | 3300047320 | Ga0495672_0132747 | Ga0495672_0132747_246_809 | 176 |
| 407 | 3300047472 | Ga0495686_0014923 | Ga0495686_0014923_895_1458 | 176 |
| 408 | 3300047472 | Ga0495686_0051823 | Ga0495686_0051823_1526_2095 | 176 |
| 409 | 3300048907 | Ga0496104_0416016 | Ga0496104_0416016_380_946 | 176 |
| 410 | 3300048912 | Ga0496109_0159407 | Ga0496109_0159407_21_554 | 176 |
| 411 | 3300048913 | Ga0496110_0217866 | Ga0496110_0217866_355_888 | 176 |
| 412 | 3300048914 | Ga0496111_0041973 | Ga0496111_0041973_230_760 | 176 |
| 413 | 3300048916 | Ga0496113_0402749 | Ga0496113_0402749_356_931 | 176 |
| 414 | 3300048917 | Ga0496114_0993790 | Ga0496114_0993790_70_600 | 176 |
| 415 | 3300048919 | Ga0496116_0026200 | Ga0496116_0026200_3631_4206 | 176 |
| 416 | 3300048924 | Ga0496121_0035615 | Ga0496121_0035615_1450_1980 | 176 |
| 417 | 3300048924 | Ga0496121_0540723 | Ga0496121_0540723_121_651 | 176 |
| 418 | 3300048925 | Ga0496122_0021882 | Ga0496122_0021882_2535_3110 | 176 |
| 419 | 3300048926 | Ga0496123_0001897 | Ga0496123_0001897_17298_17873 | 176 |
| 420 | 3300048927 | Ga0496124_0132957 | Ga0496124_0132957_889_1419 | 176 |
| 421 | 3300048928 | Ga0496125_0000332 | Ga0496125_0000332_7472_8002 | 176 |
| 422 | 3300048928 | Ga0496125_0013173 | Ga0496125_0013173_6546_7121 | 176 |
| 423 | 3300048929 | Ga0496126_0178063 | Ga0496126_0178063_109_639 | 176 |
| 424 | 3300048929 | Ga0496126_0434148 | Ga0496126_0434148_317_847 | 176 |
| 425 | 3300049535 | Ga0501319_002929 | Ga0501319_002929_512_1087 | 176 |
| 426 | 3300049568 | Ga0501031_0031373 | Ga0501031_0031373_1241_1771 | 176 |
| 427 | 3300049568 | Ga0501031_0418698 | Ga0501031_0418698_146_676 | 176 |
| 428 | 3300049569 | Ga0501032_0000353 | Ga0501032_0000353_21866_22399 | 176 |
| 429 | 3300049570 | Ga0501033_0074646 | Ga0501033_0074646_627_1157 | 176 |
| 430 | 3300049570 | Ga0501033_0108928 | Ga0501033_0108928_975_1505 | 176 |
| 431 | 3300049570 | Ga0501033_0170158 | Ga0501033_0170158_66_596 | 176 |
| 432 | 3300049571 | Ga0501034_0002037 | Ga0501034_0002037_1909_2439 | 176 |
| 433 | 3300049571 | Ga0501034_0019877 | Ga0501034_0019877_1913_2443 | 176 |
| 434 | 3300049571 | Ga0501034_0086350 | Ga0501034_0086350_726_1328 | 176 |
| 435 | 3300049571 | Ga0501034_0136346 | Ga0501034_0136346_1347_1922 | 176 |
| 436 | 3300049571 | Ga0501034_0142332 | Ga0501034_0142332_1262_1792 | 176 |
| 437 | 3300049571 | Ga0501034_0264458 | Ga0501034_0264458_656_1186 | 176 |
| 438 | 3300049571 | Ga0501034_0283362 | Ga0501034_0283362_671_1201 | 176 |
| 439 | 3300049571 | Ga0501034_0666762 | Ga0501034_0666762_387_917 | 176 |
| 440 | 3300049572 | Ga0501036_0004376 | Ga0501036_0004376_5665_6195 | 176 |
| 441 | 3300049572 | Ga0501036_0364857 | Ga0501036_0364857_354_920 | 176 |
| 442 | 3300049572 | Ga0501036_0829203 | Ga0501036_0829203_164_694 | 176 |
| 443 | 3300049573 | Ga0501037_0009761 | Ga0501037_0009761_4566_5096 | 176 |
| 444 | 3300049573 | Ga0501037_0415367 | Ga0501037_0415367_284_814 | 176 |
| 445 | 3300049573 | Ga0501037_0502170 | Ga0501037_0502170_212_742 | 176 |
| 446 | 3300049574 | Ga0501038_0077633 | Ga0501038_0077633_1563_2093 | 176 |
| 447 | 3300049574 | Ga0501038_0875457 | Ga0501038_0875457_118_648 | 176 |
| 448 | 3300049575 | Ga0501039_0412867 | Ga0501039_0412867_166_696 | 176 |
| 449 | 3300049579 | Ga0501043_0093303 | Ga0501043_0093303_426_956 | 176 |
| 450 | 3300049579 | Ga0501043_0172198 | Ga0501043_0172198_21_569 | 176 |
| 451 | 3300049580 | Ga0501046_0090258 | Ga0501046_0090258_119_649 | 176 |
| 452 | 3300049581 | Ga0501047_0022580 | Ga0501047_0022580_4310_4840 | 176 |
| 453 | 3300049581 | Ga0501047_0101080 | Ga0501047_0101080_494_1024 | 176 |
| 454 | 3300049581 | Ga0501047_0198157 | Ga0501047_0198157_492_1094 | 176 |
| 455 | 3300049583 | Ga0501067_0005732 | Ga0501067_0005732_631_1224 | 176 |
| 456 | 3300049583 | Ga0501067_0063219 | Ga0501067_0063219_537_1094 | 176 |
| 457 | 3300049586 | Ga0501070_0005291 | Ga0501070_0005291_4622_5215 | 176 |
| 458 | 3300049586 | Ga0501070_0070868 | Ga0501070_0070868_1907_2464 | 176 |
| 459 | 3300049586 | Ga0501070_0109892 | Ga0501070_0109892_1223_1753 | 176 |
| 460 | 3300049586 | Ga0501070_0850910 | Ga0501070_0850910_167_697 | 176 |
| 461 | 3300049587 | Ga0501071_1020826 | Ga0501071_1020826_73_603 | 176 |
| 462 | 3300049588 | Ga0501072_0002118 | Ga0501072_0002118_2533_3090 | 176 |
| 463 | 3300049588 | Ga0501072_0050290 | Ga0501072_0050290_30_623 | 176 |
| 464 | 3300049589 | Ga0501073_0014097 | Ga0501073_0014097_1720_2277 | 176 |
| 465 | 3300049589 | Ga0501073_0100511 | Ga0501073_0100511_889_1419 | 176 |
| 466 | 3300049589 | Ga0501073_0232330 | Ga0501073_0232330_265_825 | 176 |
| 467 | 3300049590 | Ga0501074_0002236 | Ga0501074_0002236_6490_7083 | 176 |
| 468 | 3300049590 | Ga0501074_0127774 | Ga0501074_0127774_951_1508 | 176 |
| 469 | 3300049741 | Ga0501079_0259232 | Ga0501079_0259232_276_869 | 176 |
| 470 | 3300049742 | Ga0501080_0006112 | Ga0501080_0006112_4748_5341 | 176 |
| 471 | 3300049742 | Ga0501080_0043318 | Ga0501080_0043318_1238_1795 | 176 |
| 472 | 3300049742 | Ga0501080_0357176 | Ga0501080_0357176_496_1026 | 176 |
| 473 | 3300049744 | Ga0501083_0012769 | Ga0501083_0012769_4342_4935 | 176 |
| 474 | 3300049822 | Ga0501035_0090514 | Ga0501035_0090514_2034_2564 | 176 |
| 475 | 3300049822 | Ga0501035_0114657 | Ga0501035_0114657_511_1041 | 176 |
| 476 | 3300049822 | Ga0501035_0137247 | Ga0501035_0137247_1224_1754 | 176 |
| 477 | 3300049822 | Ga0501035_0549079 | Ga0501035_0549079_356_886 | 176 |
| 478 | 3300049823 | Ga0501044_0025232 | Ga0501044_0025232_1827_2357 | 176 |
| 479 | 3300049823 | Ga0501044_0064786 | Ga0501044_0064786_584_1114 | 176 |
| 480 | 3300049823 | Ga0501044_0167797 | Ga0501044_0167797_695_1225 | 176 |
| 481 | 3300049823 | Ga0501044_0406359 | Ga0501044_0406359_590_1120 | 176 |
| 482 | 3300049823 | Ga0501044_0495597 | Ga0501044_0495597_115_708 | 176 |
| 483 | 3300049824 | Ga0501045_0469858 | Ga0501045_0469858_109_639 | 176 |
| 484 | 3300050489 | nmdc:mga03683_77093_c1 | nmdc:mga03683_77093_c1_798_1328 | 176 |
| 485 | 3300050490 | nmdc:mga03n38_117316_c1 | nmdc:mga03n38_117316_c1_226_756 | 176 |
| 486 | 3300050491 | nmdc:mga00v17_187001_c1 | nmdc:mga00v17_187001_c1_49_582 | 176 |
| 487 | 3300050491 | nmdc:mga00v17_713256_c1 | nmdc:mga00v17_713256_c1_84_614 | 176 |
| 488 | 3300050491 | nmdc:mga00v17_72435_c1 | nmdc:mga00v17_72435_c1_824_1354 | 176 |
| 489 | 3300050493 | nmdc:mga0k408_199884_c1 | nmdc:mga0k408_199884_c1_460_993 | 176 |
| 490 | 3300050493 | nmdc:mga0k408_263869_c1 | nmdc:mga0k408_263869_c1_31_561 | 176 |
| 491 | 3300050493 | nmdc:mga0k408_294588_c1 | nmdc:mga0k408_294588_c1_101_634 | 176 |
| 492 | 3300050493 | nmdc:mga0k408_349461_c1 | nmdc:mga0k408_349461_c1_11_562 | 176 |
| 493 | 3300050493 | nmdc:mga0k408_94914_c1 | nmdc:mga0k408_94914_c1_635_1183 | 176 |
| 494 | 3300050494 | nmdc:mga06z11_174188_c1 | nmdc:mga06z11_174188_c1_330_881 | 176 |
| 495 | 3300050494 | nmdc:mga06z11_56646_c1 | nmdc:mga06z11_56646_c1_827_1357 | 176 |
| 496 | 3300050495 | nmdc:mga04h51_25967_c1 | nmdc:mga04h51_25967_c1_1150_1680 | 176 |
| 497 | 3300050496 | nmdc:mga07m45_410316_c1 | nmdc:mga07m45_410316_c1_207_758 | 176 |
| 498 | 3300050496 | nmdc:mga07m45_43800_c1 | nmdc:mga07m45_43800_c1_1803_2333 | 176 |
| 499 | 3300050515 | nmdc:mga0a205_603859_c1 | nmdc:mga0a205_603859_c1_218_751 | 176 |
| 500 | 3300050516 | nmdc:mga0sz30_47315_c1 | nmdc:mga0sz30_47315_c1_310_843 | 176 |
| 501 | 3300053087 | Ga0500643_000723 | Ga0500643_000723_21063_21632 | 176 |
| 502 | 3300053087 | Ga0500643_008293 | Ga0500643_008293_2266_2838 | 176 |
| 503 | 3300053088 | Ga0500644_0001107 | Ga0500644_0001107_1942_2511 | 176 |
| 504 | 3300053094 | Ga0500566_0387973 | Ga0500566_0387973_37_612 | 176 |
| 505 | 3300053096 | Ga0500641_0011889 | Ga0500641_0011889_151_720 | 176 |
| 506 | 3300053103 | Ga0500555_004874 | Ga0500555_004874_2808_3341 | 176 |
| 507 | 3300053104 | Ga0500556_0005007 | Ga0500556_0005007_1547_2119 | 176 |
| 508 | 3300053104 | Ga0500556_0009636 | Ga0500556_0009636_1777_2346 | 176 |
| 509 | 3300053104 | Ga0500556_0069962 | Ga0500556_0069962_679_1212 | 176 |
| 510 | 3300053104 | Ga0500556_0086223 | Ga0500556_0086223_204_737 | 176 |
| 511 | 3300053108 | Ga0500562_000681 | Ga0500562_000681_5046_5618 | 176 |
| 512 | 3300053108 | Ga0500562_090903 | Ga0500562_090903_156_725 | 176 |
| 513 | 3300053122 | Ga0500608_000939 | Ga0500608_000939_8992_9567 | 176 |
| 514 | 3300053136 | Ga0500559_0046691 | Ga0500559_0046691_831_1409 | 176 |
| 515 | 3300053136 | Ga0500559_0110960 | Ga0500559_0110960_490_1020 | 176 |
| 516 | 3300053136 | Ga0500559_0124663 | Ga0500559_0124663_519_1088 | 176 |
| 517 | 3300053136 | Ga0500559_0331992 | Ga0500559_0331992_82_654 | 176 |
| 518 | 3300053139 | Ga0500568_0030281 | Ga0500568_0030281_1385_1948 | 176 |
| 519 | 3300053151 | Ga0500604_0000349 | Ga0500604_0000349_1637_2167 | 176 |
| 520 | 3300053153 | Ga0500616_0056403 | Ga0500616_0056403_393_992 | 176 |
| 521 | 3300053153 | Ga0500616_0082672 | Ga0500616_0082672_698_1267 | 176 |
| 522 | 3300053156 | Ga0500622_0008596 | Ga0500622_0008596_2352_2921 | 176 |
| 523 | 3300053156 | Ga0500622_0150322 | Ga0500622_0150322_90_659 | 176 |
| 524 | 3300053157 | Ga0500624_003122 | Ga0500624_003122_274_804 | 176 |
| 525 | 3300053158 | Ga0500627_0207561 | Ga0500627_0207561_238_807 | 176 |
| 526 | 3300053161 | Ga0500634_0000076 | Ga0500634_0000076_22369_22899 | 176 |
| 527 | 3300053730 | Ga0500645_003194 | Ga0500645_003194_2817_3386 | 176 |
| 528 | 3300053730 | Ga0500645_011120 | Ga0500645_011120_1549_2121 | 176 |
| 529 | 3300053730 | Ga0500645_116944 | Ga0500645_116944_126_695 | 176 |
| 530 | 3300054114 | Ga0501084_0820264 | Ga0501084_0820264_240_770 | 176 |
| 531 | 3300059477 | Ga0587084_060894 | Ga0587084_060894_116_646 | 176 |
| 532 | 3300059477 | Ga0587084_098001 | Ga0587084_098001_31_561 | 176 |
| 533 | 3300059490 | Ga0587066_016517 | Ga0587066_016517_370_900 | 176 |
| 534 | 3300059491 | Ga0587070_017442 | Ga0587070_017442_336_866 | 176 |
| 535 | 3300059491 | Ga0587070_032366 | Ga0587070_032366_282_812 | 176 |
| 536 | 3300059491 | Ga0587070_128421 | Ga0587070_128421_53_583 | 176 |
| 537 | 3300059493 | Ga0587077_009922 | Ga0587077_009922_16_546 | 176 |
| 538 | 3300059493 | Ga0587077_018511 | Ga0587077_018511_590_1120 | 176 |
| 539 | 3300059493 | Ga0587077_050643 | Ga0587077_050643_50_580 | 176 |
| 540 | 3300059493 | Ga0587077_056346 | Ga0587077_056346_14_547 | 176 |
| 541 | 3300059493 | Ga0587077_056411 | Ga0587077_056411_22_552 | 176 |
| 542 | 3300059503 | Ga0587080_013869 | Ga0587080_013869_306_836 | 176 |
| 543 | 3300059504 | Ga0587082_019313 | Ga0587082_019313_287_817 | 176 |
| 544 | 3300059504 | Ga0587082_030216 | Ga0587082_030216_112_642 | 176 |
| 545 | 3300059506 | Ga0587085_024532 | Ga0587085_024532_173_703 | 176 |
| 546 | 3300059507 | Ga0587086_011556 | Ga0587086_011556_497_1027 | 176 |
| 547 | 3300059507 | Ga0587086_019450 | Ga0587086_019450_63_593 | 176 |
| 548 | 3300059508 | Ga0587088_070995 | Ga0587088_070995_17_547 | 176 |
| 549 | 3300059511 | Ga0587091_006642 | Ga0587091_006642_1059_1589 | 176 |
| 550 | 3300059512 | Ga0587092_057966 | Ga0587092_057966_162_692 | 176 |
| 551 | 3300059605 | Ga0587106_009910 | Ga0587106_009910_383_913 | 176 |
| 552 | 3300059605 | Ga0587106_019344 | Ga0587106_019344_173_703 | 176 |
| 553 | 3300059623 | Ga0587101_010360 | Ga0587101_010360_90_620 | 176 |
| 554 | 3300059623 | Ga0587101_020262 | Ga0587101_020262_381_911 | 176 |
| 555 | 3300059624 | Ga0587109_015552 | Ga0587109_015552_292_822 | 176 |
| 556 | 3300059624 | Ga0587109_040342 | Ga0587109_040342_287_817 | 176 |
| 557 | 3300059629 | Ga0587127_003572 | Ga0587127_003572_384_914 | 176 |
| 558 | 3300059630 | Ga0587128_015576 | Ga0587128_015576_376_906 | 176 |
| 559 | 3300059630 | Ga0587128_105633 | Ga0587128_105633_35_565 | 176 |
| 560 | 3300059639 | Ga0587062_003520 | Ga0587062_003520_118_648 | 176 |
| 561 | 3300059639 | Ga0587062_010141 | Ga0587062_010141_345_875 | 176 |
| 562 | 3300059640 | Ga0587067_019647 | Ga0587067_019647_303_833 | 176 |
| 563 | 3300059641 | Ga0587068_012481 | Ga0587068_012481_377_907 | 176 |
| 564 | 3300059642 | Ga0587069_006174 | Ga0587069_006174_500_1030 | 176 |
| 565 | 3300059643 | Ga0587072_004181 | Ga0587072_004181_283_813 | 176 |
| 566 | 3300059643 | Ga0587072_027718 | Ga0587072_027718_225_755 | 176 |
| 567 | 3300059644 | Ga0587075_016471 | Ga0587075_016471_105_635 | 176 |
| 568 | 3300059644 | Ga0587075_073567 | Ga0587075_073567_40_570 | 176 |
| 569 | 3300059644 | Ga0587075_073891 | Ga0587075_073891_60_590 | 176 |
| 570 | 3300059645 | Ga0587076_026837 | Ga0587076_026837_172_702 | 176 |
| 571 | 3300059645 | Ga0587076_038489 | Ga0587076_038489_63_593 | 176 |
| 572 | 3300059645 | Ga0587076_114693 | Ga0587076_114693_62_592 | 176 |
| 573 | 3300059646 | Ga0587078_007400 | Ga0587078_007400_295_825 | 176 |
| 574 | 3300059648 | Ga0587100_007304 | Ga0587100_007304_49_579 | 176 |
| 575 | 3300059652 | Ga0587107_007979 | Ga0587107_007979_507_1037 | 176 |
| 576 | 3300059652 | Ga0587107_022463 | Ga0587107_022463_72_602 | 176 |
| 577 | 3300059660 | Ga0587124_002826 | Ga0587124_002826_154_684 | 176 |
| 578 | 3300059660 | Ga0587124_006690 | Ga0587124_006690_80_610 | 176 |
| 579 | 3300060344 | Ga0587071_038084 | Ga0587071_038084_344_874 | 176 |
| 580 | 3300060346 | Ga0587111_0004584 | Ga0587111_0004584_1080_1610 | 176 |
| 581 | 3300060346 | Ga0587111_0005023 | Ga0587111_0005023_603_1136 | 176 |
| 582 | 3300060346 | Ga0587111_0014909 | Ga0587111_0014909_407_937 | 176 |
| 583 | 3300060346 | Ga0587111_0045636 | Ga0587111_0045636_61_591 | 176 |
| 584 | 3300060353 | Ga0501082_0012036 | Ga0501082_0012036_6815_7357 | 176 |
| 585 | 3300061719 | Ga0466962_0100180 | Ga0466962_0100180_267_842 | 176 |
| 586 | 3300061734 | Ga0530510_0650489 | Ga0530510_0650489_196_744 | 176 |
| 587 | iso_pu_bacteria | 2643221574 | 2643883449 | 176 |
| 588 | iso_pu_bacteria | 2643221598 | 2644000523 | 176 |
| 589 | iso_pu_bacteria | 2643221663 | 2644353969 | 176 |
| 590 | iso_pu_bacteria | 2739367756 | 2739791481 | 176 |
| 591 | iso_pu_bacteria | 2928972540 | 2928975369 | 176 |
| 592 | iso_pu_bacteria | 2941485952 | 2941486899 | 176 |
| 593 | iso_pu_bacteria | 2977240413 | 2977241642 | 176 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2kvq-assembly1.cif.gz_G | solution structure of nuse:nusg-ctd complex | 0.9541 | 123 | 176 |
| 8exy-assembly1.cif.gz_G | m. tuberculosis rnap paused complex with b. subtilis nusg and gmpcpp | 0.9191 | 4 | 108 |
| 5xfq-assembly1.cif.gz_B | ternary complex of phf1, a dna duplex and a histone peptide | 0.9099 | 123 | 175 |
| 2e70-assembly1.cif.gz_A | solution structure of the fifth kow motif of human transcription elongation factor spt5 | 0.9077 | 125 | 176 |
| 5xfp-assembly3.cif.gz_E | binary complex of phf1 and a double stranded dna | 0.9077 | 123 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q10BA7_272_328_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9721 | 122 | 176 | 2.30.30.30 |
| 2xhcA03 | Mainly Beta;Roll;SH3 type barrels.; | 0.9605 | 121 | 176 | 2.30.30.30 |
| 2kvqG00 | Mainly Beta;Roll;SH3 type barrels.; | 0.9541 | 123 | 176 | 2.30.30.30 |
| af_P9WIU9_43_152_3.30.70.940 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain | 0.9518 | 2 | 107 | 3.30.70.940 |
| 2xhcA03 | Mainly Beta;Roll;SH3 type barrels.; | 0.9444 | 121 | 176 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3R7WK22-F1-model_v4 | deleted | 0.9939 | 123 | 176 |
|
| AF-A0A4Q6CKU3-F1-model_v4 | Transcription termination/antitermination protein NusG | 0.9915 | 120 | 176 |
GO:0005829
GO:0006353 GO:0031564 GO:0032784 |
| AF-A0A3R7WK22-F1-model_v4 | deleted | 0.976 | 123 | 176 |
|
| AF-A0A4Q6CKU3-F1-model_v4 | Transcription termination/antitermination protein NusG | 0.9745 | 120 | 176 |
GO:0005829
GO:0006353 GO:0031564 GO:0032784 |
| AF-A0A432IT60-F1-model_v4 | deleted | 0.9688 | 3 | 73 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar