F467282
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 593 | 419 | 473 | 169 |
Family's Representative Sequence
| Representative Sequence | 3300053177|Ga0500636_0002418|Ga0500636_0002418_3181_3801 |
| Length | 206 |
| Sequence | LPKRKTGTRFFAQCSGLIRSAALSATGIVACPKKVETMDVTALRALQAPLKDQYRETPDAAVITLKARGELDDQHIACKVETGRAIALAGLHPATGGSGAELCSGDMLLEALVACAGVTLKAVATALEIELKKGTVRAEGDLDFRGTLGVAKDAPVGFKAIRLSFDVETDAPQEKLDTLLKLTERYCVVFQTLNVKPQLSAELRQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 3 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 7 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 8 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 9 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 10 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 11 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 12 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 13 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 14 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 15 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 16 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 17 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 18 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 19 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 20 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 21 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 22 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 23 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 24 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 25 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 26 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 27 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 28 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 29 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 30 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 31 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 32 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 33 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 34 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 35 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 36 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 37 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 38 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 39 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 40 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 41 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 42 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 43 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 44 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 45 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 46 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 47 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 48 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 49 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 50 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 51 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 52 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 53 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 54 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 55 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 56 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 57 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 58 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 59 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 60 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 61 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 62 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 63 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 64 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 65 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 66 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 67 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 68 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 69 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 70 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 71 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 72 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 73 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 74 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 75 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 76 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 77 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 78 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 79 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 80 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 81 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 82 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 83 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 84 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 85 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 86 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 87 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 88 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 89 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 90 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 91 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 92 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 93 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 94 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 95 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 96 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 97 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 98 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 99 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 100 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 101 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 102 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 103 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 104 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 105 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 106 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 107 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 108 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 109 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 110 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 111 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 112 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 113 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 114 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 115 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 116 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 117 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 118 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 121 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 123 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 128 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 133 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 136 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 139 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 140 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 141 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 143 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 147 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 148 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 150 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 151 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 152 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 153 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 154 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 155 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 156 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 157 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 158 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 159 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 161 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 162 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 163 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 164 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 165 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 166 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 167 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 169 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 170 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 171 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 173 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 181 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 182 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 190 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 193 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 194 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 195 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 196 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 197 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 198 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 199 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 200 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 209 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 246 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 247 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 248 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 249 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 252 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 253 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 254 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 255 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 256 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 257 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 258 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 259 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 260 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 261 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 262 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 263 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 264 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 268 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 271 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 272 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 273 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 274 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 275 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 276 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 277 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 278 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 279 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 280 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 281 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 282 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 283 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 284 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 285 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 330 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 331 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 332 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 333 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 336 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 337 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 338 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 339 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 340 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 341 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 342 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 343 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 344 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 345 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 346 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 347 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 348 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 349 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 350 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 351 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 352 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 366 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 367 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 369 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 374 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 375 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 376 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 377 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 379 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 380 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 381 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 382 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 383 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 384 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 385 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 386 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 387 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 388 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 389 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 390 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 391 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 392 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 393 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 394 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 396 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 397 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 398 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 399 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 400 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 401 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 402 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 403 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 404 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 405 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 407 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 408 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 409 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 411 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 412 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 413 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 414 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 415 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 416 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 417 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 418 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 419 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.43 |
| Metatranscriptomes | 0.34 |
| Isolates | 20.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.55 |
| Nodule | 15.01 |
| Rhizoplane | 7.93 |
| Rhizosphere | 45.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1021976 | 3300002987 | Bacteria | 1190 |
| 2 | JGI25151J46595_10000021 | 3300003187 | Bacteria | 227826 |
| 3 | JGI25153J46596_10000133 | 3300003215 | Bacteria | 79398 |
| 4 | JGI25153J46596_10001375 | 3300003215 | Bacteria | 14553 |
| 5 | JGI25153J46596_10015196 | 3300003215 | Bacteria | 3152 |
| 6 | JGI25160J50197_1001189 | 3300003354 | Bacteria | 13266 |
| 7 | Ga0055526_1001254 | 3300003771 | Bacteria | 18211 |
| 8 | Ga0055526_1001771 | 3300003771 | Bacteria | 14997 |
| 9 | Ga0055524_1000011 | 3300003775 | Bacteria | 261442 |
| 10 | Ga0065165_1000150 | 3300005262 | Bacteria | 121992 |
| 11 | Ga0065165_1053766 | 3300005262 | Bacteria | 1132 |
| 12 | Ga0070658_10811070 | 3300005327 | Bacteria | 813 |
| 13 | Ga0070670_100075398 | 3300005331 | Bacteria | 2898 |
| 14 | Ga0068868_100003650 | 3300005338 | Bacteria | 10741 |
| 15 | Ga0070660_100492174 | 3300005339 | Bacteria | 1020 |
| 16 | Ga0070689_100000018 | 3300005340 | Bacteria | 153256 |
| 17 | Ga0070668_100464360 | 3300005347 | Bacteria | 1091 |
| 18 | Ga0070668_100516691 | 3300005347 | Bacteria | 1036 |
| 19 | Ga0070675_100083801 | 3300005354 | Bacteria | 2662 |
| 20 | Ga0070675_100128215 | 3300005354 | Bacteria | 2160 |
| 21 | Ga0070675_100298987 | 3300005354 | Bacteria | 1418 |
| 22 | Ga0070675_100299578 | 3300005354 | Bacteria | 1416 |
| 23 | Ga0070671_100015653 | 3300005355 | Bacteria | 6129 |
| 24 | Ga0070671_100141019 | 3300005355 | Unclassified | 2034 |
| 25 | Ga0070673_100090930 | 3300005364 | Bacteria | 2494 |
| 26 | Ga0070688_100122177 | 3300005365 | Bacteria | 1746 |
| 27 | Ga0070659_100994064 | 3300005366 | Bacteria | 736 |
| 28 | Ga0070709_10018422 | 3300005434 | Bacteria | 4021 |
| 29 | Ga0070714_100017599 | 3300005435 | Bacteria | 5792 |
| 30 | Ga0070713_100018232 | 3300005436 | Bacteria | 5333 |
| 31 | Ga0070713_100251505 | 3300005436 | Bacteria | 1612 |
| 32 | Ga0070710_10083796 | 3300005437 | Unclassified | 1867 |
| 33 | Ga0070705_100417546 | 3300005440 | Bacteria | 998 |
| 34 | Ga0070700_100812870 | 3300005441 | Bacteria | 754 |
| 35 | Ga0070694_100728250 | 3300005444 | Bacteria | 808 |
| 36 | Ga0070663_100096378 | 3300005455 | Bacteria | 2200 |
| 37 | Ga0070663_100234570 | 3300005455 | Bacteria | 1446 |
| 38 | Ga0070678_100745913 | 3300005456 | Bacteria | 885 |
| 39 | Ga0070678_101010449 | 3300005456 | Bacteria | 765 |
| 40 | Ga0068867_100044224 | 3300005459 | Bacteria | 3262 |
| 41 | Ga0068867_101540674 | 3300005459 | Bacteria | 620 |
| 42 | Ga0070685_10013703 | 3300005466 | Bacteria | 4283 |
| 43 | Ga0070684_100273139 | 3300005535 | Bacteria | 1548 |
| 44 | Ga0070684_100424240 | 3300005535 | Bacteria | 1228 |
| 45 | Ga0070672_100216621 | 3300005543 | Bacteria | 1605 |
| 46 | Ga0070672_100416870 | 3300005543 | Bacteria | 1153 |
| 47 | Ga0070686_100030101 | 3300005544 | Bacteria | 3308 |
| 48 | Ga0070696_100008909 | 3300005546 | Bacteria | 6717 |
| 49 | Ga0070693_100624624 | 3300005547 | Bacteria | 781 |
| 50 | Ga0070665_100027310 | 3300005548 | Bacteria | 5749 |
| 51 | Ga0070704_100024848 | 3300005549 | Bacteria | 3936 |
| 52 | Ga0068856_100227664 | 3300005614 | Bacteria | 1880 |
| 53 | Ga0068856_100294832 | 3300005614 | Unclassified | 1639 |
| 54 | Ga0070702_100141784 | 3300005615 | Bacteria | 1531 |
| 55 | Ga0068852_100076609 | 3300005616 | Bacteria | 2953 |
| 56 | Ga0068859_100362045 | 3300005617 | Bacteria | 1545 |
| 57 | Ga0068864_101191853 | 3300005618 | Bacteria | 760 |
| 58 | Ga0068866_10209299 | 3300005718 | Bacteria | 1170 |
| 59 | Ga0068863_100407461 | 3300005841 | Bacteria | 1331 |
| 60 | Ga0068863_101461066 | 3300005841 | Bacteria | 692 |
| 61 | Ga0068858_101139955 | 3300005842 | Bacteria | 766 |
| 62 | Ga0068860_100400687 | 3300005843 | Bacteria | 1357 |
| 63 | Ga0068860_100926396 | 3300005843 | Bacteria | 888 |
| 64 | Ga0068862_100004007 | 3300005844 | Bacteria | 12490 |
| 65 | Ga0068862_100365703 | 3300005844 | Bacteria | 1341 |
| 66 | Ga0081455_10043443 | 3300005937 | Bacteria | 3930 |
| 67 | Ga0081455_10124402 | 3300005937 | Bacteria | 2026 |
| 68 | Ga0081540_1081219 | 3300005983 | Bacteria | 1459 |
| 69 | Ga0070717_10005153 | 3300006028 | Bacteria | 9528 |
| 70 | Ga0075365_10017968 | 3300006038 | Bacteria | 4339 |
| 71 | Ga0075365_10027319 | 3300006038 | Bacteria | 3630 |
| 72 | Ga0075365_10164656 | 3300006038 | Bacteria | 1546 |
| 73 | Ga0075365_10405718 | 3300006038 | Bacteria | 962 |
| 74 | Ga0075365_11004602 | 3300006038 | Bacteria | 588 |
| 75 | Ga0075368_10318850 | 3300006042 | Bacteria | 673 |
| 76 | Ga0075364_10133114 | 3300006051 | Bacteria | 1669 |
| 77 | Ga0075364_10490732 | 3300006051 | Bacteria | 840 |
| 78 | Ga0070716_100121943 | 3300006173 | Unclassified | 1633 |
| 79 | Ga0070716_100231711 | 3300006173 | Bacteria | 1247 |
| 80 | Ga0075362_10257900 | 3300006177 | Bacteria | 858 |
| 81 | Ga0075369_10061400 | 3300006186 | Bacteria | 1640 |
| 82 | Ga0075369_10077135 | 3300006186 | Bacteria | 1474 |
| 83 | Ga0075366_10054826 | 3300006195 | Bacteria | 2367 |
| 84 | Ga0075366_10091254 | 3300006195 | Bacteria | 1825 |
| 85 | Ga0097621_100085078 | 3300006237 | Bacteria | 2637 |
| 86 | Ga0097621_100335347 | 3300006237 | Bacteria | 1342 |
| 87 | Ga0075370_10052635 | 3300006353 | Bacteria | 2310 |
| 88 | Ga0075370_10247437 | 3300006353 | Bacteria | 1056 |
| 89 | Ga0068871_100021632 | 3300006358 | Bacteria | 4947 |
| 90 | Ga0075434_100011878 | 3300006871 | Bacteria | 8233 |
| 91 | Ga0075434_100339422 | 3300006871 | Bacteria | 1523 |
| 92 | Ga0097620_100362038 | 3300006931 | Bacteria | 1545 |
| 93 | Ga0099823_1013263 | 3300006944 | Bacteria | 8300 |
| 94 | Ga0105240_10009401 | 3300009093 | Bacteria | 13842 |
| 95 | Ga0105240_10076360 | 3300009093 | Bacteria | 4130 |
| 96 | Ga0105240_10077368 | 3300009093 | Bacteria | 4098 |
| 97 | Ga0105240_10430678 | 3300009093 | Bacteria | 1480 |
| 98 | Ga0105240_10670205 | 3300009093 | Bacteria | 1135 |
| 99 | Ga0105247_10160516 | 3300009101 | Bacteria | 1488 |
| 100 | Ga0105247_10786876 | 3300009101 | Bacteria | 724 |
| 101 | Ga0105241_10131101 | 3300009174 | Bacteria | 2030 |
| 102 | Ga0105241_10187922 | 3300009174 | Bacteria | 1718 |
| 103 | Ga0105248_10806788 | 3300009177 | Bacteria | 1059 |
| 104 | Ga0105237_10133511 | 3300009545 | Bacteria | 2477 |
| 105 | Ga0105249_10014538 | 3300009553 | Bacteria | 6958 |
| 106 | Ga0105249_10914868 | 3300009553 | Bacteria | 944 |
| 107 | Ga0105239_10079271 | 3300010375 | Bacteria | 3614 |
| 108 | Ga0105239_10367297 | 3300010375 | Bacteria | 1626 |
| 109 | Ga0157314_1014240 | 3300012500 | Bacteria | 738 |
| 110 | Ga0171462_1015 | 3300013250 | Bacteria | 169578 |
| 111 | Ga0157374_10203265 | 3300013296 | Bacteria | 1940 |
| 112 | Ga0157374_10848455 | 3300013296 | Bacteria | 930 |
| 113 | Ga0157378_10274569 | 3300013297 | Bacteria | 1622 |
| 114 | Ga0163162_10927960 | 3300013306 | Bacteria | 982 |
| 115 | Ga0157372_11862187 | 3300013307 | Bacteria | 692 |
| 116 | Ga0157375_12225208 | 3300013308 | Bacteria | 653 |
| 117 | Ga0163163_10004923 | 3300014325 | Bacteria | 11488 |
| 118 | Ga0163163_10047869 | 3300014325 | Bacteria | 4203 |
| 119 | Ga0163163_10308330 | 3300014325 | Bacteria | 1635 |
| 120 | Ga0163163_10733616 | 3300014325 | Bacteria | 1051 |
| 121 | Ga0157380_10019928 | 3300014326 | Bacteria | 5005 |
| 122 | Ga0182008_10534830 | 3300014497 | Bacteria | 649 |
| 123 | Ga0157379_10170305 | 3300014968 | Bacteria | 1966 |
| 124 | Ga0157379_10252918 | 3300014968 | Bacteria | 1600 |
| 125 | Ga0163161_10552857 | 3300017792 | Bacteria | 944 |
| 126 | Ga0163161_11383257 | 3300017792 | Bacteria | 614 |
| 127 | Ga0206354_10108602 | 3300020081 | Bacteria | 1158 |
| 128 | Ga0206354_10359821 | 3300020081 | Bacteria | 631 |
| 129 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 130 | Ga0214542_1000003 | 3300021321 | Bacteria | 435700 |
| 131 | Ga0214545_1000004 | 3300021324 | Bacteria | 453352 |
| 132 | Ga0214543_1000007 | 3300021327 | Bacteria | 414744 |
| 133 | Ga0213874_10002498 | 3300021377 | Bacteria | 3969 |
| 134 | Ga0213876_10007769 | 3300021384 | Bacteria | 5821 |
| 135 | Ga0213876_10009062 | 3300021384 | Bacteria | 5359 |
| 136 | Ga0213876_10029125 | 3300021384 | Bacteria | 2911 |
| 137 | Ga0213875_10021992 | 3300021388 | Bacteria | 3052 |
| 138 | Ga0213875_10076933 | 3300021388 | Bacteria | 1557 |
| 139 | Ga0213875_10377973 | 3300021388 | Bacteria | 674 |
| 140 | Ga0209233_1021879 | 3300025261 | Bacteria | 1646 |
| 141 | Ga0209673_1049107 | 3300025273 | Bacteria | 1130 |
| 142 | Ga0209130_1000187 | 3300025284 | Bacteria | 87082 |
| 143 | Ga0209675_1005741 | 3300025291 | Bacteria | 5121 |
| 144 | Ga0209025_1000010 | 3300025294 | Bacteria | 986612 |
| 145 | Ga0209025_1003913 | 3300025294 | Bacteria | 13420 |
| 146 | Ga0209025_1062867 | 3300025294 | Bacteria | 1374 |
| 147 | Ga0209025_1070283 | 3300025294 | Bacteria | 1247 |
| 148 | Ga0209564_1000019 | 3300025295 | Bacteria | 573686 |
| 149 | Ga0209564_1000369 | 3300025295 | Bacteria | 83878 |
| 150 | Ga0209758_1000005 | 3300025297 | Bacteria | 1368918 |
| 151 | Ga0209758_1002632 | 3300025297 | Bacteria | 17829 |
| 152 | Ga0209758_1016086 | 3300025297 | Bacteria | 3822 |
| 153 | Ga0209758_1039208 | 3300025297 | Bacteria | 1804 |
| 154 | Ga0209758_1078121 | 3300025297 | Bacteria | 1012 |
| 155 | Ga0209050_1019524 | 3300025298 | Bacteria | 2569 |
| 156 | Ga0209050_1064198 | 3300025298 | Bacteria | 852 |
| 157 | Ga0209256_1000317 | 3300025299 | Bacteria | 83179 |
| 158 | Ga0209256_1050348 | 3300025299 | Bacteria | 1010 |
| 159 | Ga0207426_1000201 | 3300025302 | Bacteria | 143975 |
| 160 | Ga0207426_1011144 | 3300025302 | Bacteria | 3444 |
| 161 | Ga0207426_1018295 | 3300025302 | Bacteria | 2472 |
| 162 | Ga0209257_1000391 | 3300025304 | Bacteria | 87258 |
| 163 | Ga0209257_1065298 | 3300025304 | Bacteria | 976 |
| 164 | Ga0207692_10081313 | 3300025898 | Unclassified | 1733 |
| 165 | Ga0207692_10628966 | 3300025898 | Bacteria | 692 |
| 166 | Ga0207680_10198228 | 3300025903 | Bacteria | 1367 |
| 167 | Ga0207699_10115358 | 3300025906 | Unclassified | 1728 |
| 168 | Ga0207654_10044547 | 3300025911 | Bacteria | 2521 |
| 169 | Ga0207695_10000065 | 3300025913 | Bacteria | 336949 |
| 170 | Ga0207695_10055253 | 3300025913 | Bacteria | 4139 |
| 171 | Ga0207695_10414864 | 3300025913 | Bacteria | 1231 |
| 172 | Ga0207671_10017405 | 3300025914 | Bacteria | 5543 |
| 173 | Ga0207662_10112981 | 3300025918 | Bacteria | 1695 |
| 174 | Ga0207657_10185324 | 3300025919 | Bacteria | 1681 |
| 175 | Ga0207652_10104076 | 3300025921 | Bacteria | 2510 |
| 176 | Ga0207650_10095627 | 3300025925 | Bacteria | 2277 |
| 177 | Ga0207650_10836010 | 3300025925 | Bacteria | 781 |
| 178 | Ga0207659_10159977 | 3300025926 | Bacteria | 1767 |
| 179 | Ga0207659_10263559 | 3300025926 | Bacteria | 1403 |
| 180 | Ga0207700_10040741 | 3300025928 | Bacteria | 3392 |
| 181 | Ga0207664_10028898 | 3300025929 | Bacteria | 4218 |
| 182 | Ga0207644_10052406 | 3300025931 | Bacteria | 2932 |
| 183 | Ga0207644_10538122 | 3300025931 | Unclassified | 966 |
| 184 | Ga0207644_10656374 | 3300025931 | Bacteria | 873 |
| 185 | Ga0207706_10237822 | 3300025933 | Bacteria | 1592 |
| 186 | Ga0207670_10000001 | 3300025936 | Bacteria | 949312 |
| 187 | Ga0207670_10026049 | 3300025936 | Bacteria | 3681 |
| 188 | Ga0207665_10136391 | 3300025939 | Unclassified | 1746 |
| 189 | Ga0207665_10405791 | 3300025939 | Bacteria | 1038 |
| 190 | Ga0207691_10005607 | 3300025940 | Bacteria | 12133 |
| 191 | Ga0207691_10129493 | 3300025940 | Bacteria | 2230 |
| 192 | Ga0207679_11454512 | 3300025945 | Bacteria | 629 |
| 193 | Ga0207667_10753042 | 3300025949 | Bacteria | 973 |
| 194 | Ga0207651_10000751 | 3300025960 | Bacteria | 13926 |
| 195 | Ga0207651_10121773 | 3300025960 | Bacteria | 1980 |
| 196 | Ga0207651_10212262 | 3300025960 | Bacteria | 1559 |
| 197 | Ga0207712_10007361 | 3300025961 | Bacteria | 6949 |
| 198 | Ga0207712_11364006 | 3300025961 | Bacteria | 634 |
| 199 | Ga0207668_10411807 | 3300025972 | Bacteria | 1145 |
| 200 | Ga0207668_11362324 | 3300025972 | Bacteria | 639 |
| 201 | Ga0207640_10813913 | 3300025981 | Bacteria | 810 |
| 202 | Ga0207658_10039079 | 3300025986 | Bacteria | 3423 |
| 203 | Ga0207677_10004986 | 3300026023 | Bacteria | 7167 |
| 204 | Ga0207678_10744374 | 3300026067 | Bacteria | 864 |
| 205 | Ga0207708_10244255 | 3300026075 | Bacteria | 1445 |
| 206 | Ga0207708_10409273 | 3300026075 | Bacteria | 1123 |
| 207 | Ga0207708_11100282 | 3300026075 | Bacteria | 693 |
| 208 | Ga0207702_10250907 | 3300026078 | Bacteria | 1662 |
| 209 | Ga0207702_10490535 | 3300026078 | Bacteria | 1197 |
| 210 | Ga0207641_11541881 | 3300026088 | Bacteria | 666 |
| 211 | Ga0207648_10031123 | 3300026089 | Bacteria | 4719 |
| 212 | Ga0207648_10316570 | 3300026089 | Bacteria | 1402 |
| 213 | Ga0207648_11460127 | 3300026089 | Bacteria | 643 |
| 214 | Ga0207676_10167880 | 3300026095 | Bacteria | 1909 |
| 215 | Ga0207683_10054965 | 3300026121 | Bacteria | 3491 |
| 216 | Ga0207683_10246280 | 3300026121 | Bacteria | 1631 |
| 217 | Ga0207698_10104979 | 3300026142 | Bacteria | 2353 |
| 218 | Ga0209389_1010635 | 3300027296 | Bacteria | 8306 |
| 219 | Ga0209489_112010 | 3300027361 | Bacteria | 8306 |
| 220 | Ga0209700_110939 | 3300027363 | Bacteria | 8919 |
| 221 | Ga0207428_10035875 | 3300027907 | Bacteria | 4050 |
| 222 | Ga0268266_10006781 | 3300028379 | Bacteria | 10439 |
| 223 | Ga0268265_11749033 | 3300028380 | Bacteria | 628 |
| 224 | Ga0265318_10067478 | 3300028577 | Bacteria | 1328 |
| 225 | Ga0307515_10178960 | 3300028794 | Bacteria | 2079 |
| 226 | Ga0265320_10269587 | 3300031240 | Bacteria | 754 |
| 227 | Ga0307513_10036871 | 3300031456 | Bacteria | 5447 |
| 228 | Ga0307513_10129247 | 3300031456 | Bacteria | 2475 |
| 229 | Ga0307408_100052585 | 3300031548 | Bacteria | 2938 |
| 230 | Ga0307408_100225750 | 3300031548 | Bacteria | 1531 |
| 231 | Ga0307508_10082799 | 3300031616 | Bacteria | 2791 |
| 232 | Ga0307406_10141603 | 3300031901 | Bacteria | 1703 |
| 233 | Ga0307406_10324944 | 3300031901 | Bacteria | 1192 |
| 234 | Ga0307412_10212845 | 3300031911 | Bacteria | 1476 |
| 235 | Ga0307409_101744072 | 3300031995 | Bacteria | 651 |
| 236 | Ga0307416_100878294 | 3300032002 | Bacteria | 996 |
| 237 | Ga0307416_102132942 | 3300032002 | Bacteria | 662 |
| 238 | Ga0307415_100643481 | 3300032126 | Bacteria | 949 |
| 239 | Ga0307415_101320184 | 3300032126 | Bacteria | 684 |
| 240 | Ga0307510_10016772 | 3300033180 | Bacteria | 8640 |
| 241 | Ga0307510_10070055 | 3300033180 | Bacteria | 3506 |
| 242 | Ga0373957_0079320 | 3300035120 | Bacteria | 1294 |
| 243 | Ga0373946_0030522 | 3300035171 | Bacteria | 2152 |
| 244 | Ga0373955_0110620 | 3300035172 | Bacteria | 1588 |
| 245 | Ga0373931_0472589 | 3300035691 | Bacteria | 805 |
| 246 | Ga0373933_0120135 | 3300035724 | Bacteria | 1645 |
| 247 | Ga0373933_0526077 | 3300035724 | Bacteria | 775 |
| 248 | Ga0373937_0197415 | 3300036401 | Bacteria | 1891 |
| 249 | Ga0373925_0268148 | 3300037068 | Bacteria | 1373 |
| 250 | Ga0373925_0898809 | 3300037068 | Bacteria | 730 |
| 251 | Ga0395898_1118688 | 3300037466 | Bacteria | 720 |
| 252 | Ga0395905_0081569 | 3300037471 | Bacteria | 3031 |
| 253 | Ga0436364_0197909 | 3300037853 | Bacteria | 872 |
| 254 | Ga0436364_0497276 | 3300037853 | Bacteria | 1333 |
| 255 | Ga0436364_0532601 | 3300037853 | Bacteria | 664 |
| 256 | Ga0436364_1099918 | 3300037853 | Bacteria | 3218 |
| 257 | Ga0237819_26476 | 3300038705 | Bacteria | 540 |
| 258 | Ga0237816_00722 | 3300039145 | Bacteria | 2784 |
| 259 | Ga0436365_0088001 | 3300039437 | Bacteria | 1551 |
| 260 | Ga0436365_0277390 | 3300039437 | Bacteria | 3720 |
| 261 | Ga0436365_0678611 | 3300039437 | Bacteria | 2527 |
| 262 | Ga0436365_1886658 | 3300039437 | Bacteria | 26869 |
| 263 | Ga0436360_0652803 | 3300039438 | Bacteria | 5557 |
| 264 | Ga0436361_0425765 | 3300039447 | Bacteria | 1311 |
| 265 | Ga0436361_0500698 | 3300039447 | Bacteria | 1074 |
| 266 | Ga0436361_1079383 | 3300039447 | Bacteria | 2820 |
| 267 | Ga0436363_0699892 | 3300039450 | Bacteria | 10776 |
| 268 | Ga0436363_0700629 | 3300039450 | Bacteria | 1028 |
| 269 | Ga0436363_1011916 | 3300039450 | Bacteria | 2000 |
| 270 | Ga0451843_1323642 | 3300041509 | Bacteria | 1277 |
| 271 | Ga0450900_028879 | 3300042136 | Bacteria | 800 |
| 272 | Ga0466972_0072916 | 3300044658 | Bacteria | 1637 |
| 273 | Ga0466968_0053024 | 3300044735 | Bacteria | 1736 |
| 274 | Ga0466968_0066967 | 3300044735 | Bacteria | 1556 |
| 275 | Ga0466960_0200173 | 3300044901 | Bacteria | 1091 |
| 276 | Ga0466960_0391389 | 3300044901 | Bacteria | 799 |
| 277 | Ga0466960_0465994 | 3300044901 | Bacteria | 736 |
| 278 | Ga0466967_0282371 | 3300045976 | Bacteria | 1593 |
| 279 | Ga0495592_0538314 | 3300046454 | Bacteria | 720 |
| 280 | Ga0495603_0123288 | 3300046455 | Bacteria | 1510 |
| 281 | Ga0495638_0001760 | 3300046460 | Bacteria | 18968 |
| 282 | Ga0495638_0361783 | 3300046460 | Bacteria | 763 |
| 283 | Ga0495651_0001917 | 3300046462 | Bacteria | 16106 |
| 284 | Ga0495605_0148332 | 3300046474 | Bacteria | 1048 |
| 285 | Ga0495639_0048418 | 3300046475 | Bacteria | 1927 |
| 286 | Ga0495664_0011217 | 3300046477 | Bacteria | 5047 |
| 287 | Ga0495594_0228874 | 3300046499 | Bacteria | 1060 |
| 288 | Ga0495583_0230360 | 3300046506 | Bacteria | 747 |
| 289 | Ga0495606_0375969 | 3300046507 | Bacteria | 746 |
| 290 | Ga0495620_0138662 | 3300046515 | Bacteria | 952 |
| 291 | Ga0495628_0103487 | 3300046516 | Bacteria | 2195 |
| 292 | Ga0495643_0050420 | 3300046522 | Bacteria | 2242 |
| 293 | Ga0495652_0025465 | 3300046529 | Bacteria | 5233 |
| 294 | Ga0495652_0514286 | 3300046529 | Bacteria | 828 |
| 295 | Ga0495640_0011710 | 3300046533 | Bacteria | 6735 |
| 296 | Ga0495640_0376595 | 3300046533 | Bacteria | 874 |
| 297 | Ga0495587_0009486 | 3300046536 | Bacteria | 6236 |
| 298 | Ga0495598_0314227 | 3300046537 | Bacteria | 595 |
| 299 | Ga0495609_0058978 | 3300046538 | Bacteria | 1697 |
| 300 | Ga0495645_0037519 | 3300046543 | Bacteria | 3533 |
| 301 | Ga0495622_0079208 | 3300046557 | Bacteria | 1512 |
| 302 | Ga0495667_0009591 | 3300046559 | Bacteria | 6564 |
| 303 | Ga0495634_0042998 | 3300046642 | Bacteria | 3063 |
| 304 | Ga0495634_0065794 | 3300046642 | Bacteria | 2401 |
| 305 | Ga0495625_0071460 | 3300046660 | Bacteria | 2435 |
| 306 | Ga0495635_0001881 | 3300046663 | Bacteria | 14234 |
| 307 | Ga0495635_0099874 | 3300046663 | Bacteria | 1983 |
| 308 | Ga0495661_0168011 | 3300046665 | Bacteria | 1172 |
| 309 | Ga0495661_0419745 | 3300046665 | Bacteria | 648 |
| 310 | Ga0495588_0075640 | 3300046674 | Bacteria | 1754 |
| 311 | Ga0495588_0082234 | 3300046674 | Bacteria | 1682 |
| 312 | Ga0495657_0004727 | 3300046675 | Bacteria | 10849 |
| 313 | Ga0495599_0011007 | 3300046678 | Bacteria | 5551 |
| 314 | Ga0495623_0022868 | 3300046679 | Bacteria | 4036 |
| 315 | Ga0495613_0027850 | 3300046689 | Bacteria | 4206 |
| 316 | Ga0495624_0022395 | 3300046690 | Bacteria | 4176 |
| 317 | Ga0495600_0004439 | 3300046809 | Bacteria | 8392 |
| 318 | Ga0495600_0007347 | 3300046809 | Bacteria | 6734 |
| 319 | Ga0495581_0063802 | 3300047315 | Bacteria | 2128 |
| 320 | Ga0495581_0174984 | 3300047315 | Bacteria | 1255 |
| 321 | Ga0495604_0002141 | 3300047317 | Bacteria | 15889 |
| 322 | Ga0495604_0026793 | 3300047317 | Bacteria | 4587 |
| 323 | Ga0495674_0018376 | 3300047319 | Bacteria | 6508 |
| 324 | Ga0495676_0049909 | 3300047321 | Bacteria | 3360 |
| 325 | Ga0495680_0019780 | 3300047322 | Bacteria | 5678 |
| 326 | Ga0495683_0244379 | 3300047323 | Bacteria | 790 |
| 327 | Ga0495675_0027393 | 3300047444 | Bacteria | 3630 |
| 328 | Ga0495686_0020180 | 3300047472 | Bacteria | 4446 |
| 329 | Ga0495686_0634721 | 3300047472 | Bacteria | 550 |
| 330 | Ga0495602_0074836 | 3300048088 | Bacteria | 2876 |
| 331 | Ga0496100_0134242 | 3300048903 | Bacteria | 1747 |
| 332 | Ga0496100_0152731 | 3300048903 | Bacteria | 1649 |
| 333 | Ga0496100_0494916 | 3300048903 | Bacteria | 941 |
| 334 | Ga0496101_0131222 | 3300048904 | Bacteria | 1903 |
| 335 | Ga0496101_0272801 | 3300048904 | Bacteria | 1321 |
| 336 | Ga0496101_0428910 | 3300048904 | Bacteria | 1042 |
| 337 | Ga0496101_0667172 | 3300048904 | Bacteria | 821 |
| 338 | Ga0496102_0070802 | 3300048905 | Bacteria | 3202 |
| 339 | Ga0496104_0006361 | 3300048907 | Bacteria | 10389 |
| 340 | Ga0496104_0021759 | 3300048907 | Bacteria | 5889 |
| 341 | Ga0496104_0022524 | 3300048907 | Bacteria | 5787 |
| 342 | Ga0496104_0251380 | 3300048907 | Bacteria | 1680 |
| 343 | Ga0496104_0361991 | 3300048907 | Unclassified | 1363 |
| 344 | Ga0496104_0398200 | 3300048907 | Bacteria | 1289 |
| 345 | Ga0496104_0632394 | 3300048907 | Bacteria | 979 |
| 346 | Ga0496105_0005021 | 3300048908 | Bacteria | 10018 |
| 347 | Ga0496105_0147028 | 3300048908 | Bacteria | 1938 |
| 348 | Ga0496105_0191474 | 3300048908 | Unclassified | 1672 |
| 349 | Ga0496106_0059587 | 3300048909 | Bacteria | 2892 |
| 350 | Ga0496106_0230376 | 3300048909 | Bacteria | 1479 |
| 351 | Ga0496106_0549762 | 3300048909 | Bacteria | 926 |
| 352 | Ga0496107_0173502 | 3300048910 | Bacteria | 1600 |
| 353 | Ga0496107_0354899 | 3300048910 | Unclassified | 1091 |
| 354 | Ga0496108_0010916 | 3300048911 | Bacteria | 7375 |
| 355 | Ga0496108_0071778 | 3300048911 | Bacteria | 2922 |
| 356 | Ga0496108_0573538 | 3300048911 | Bacteria | 984 |
| 357 | Ga0496108_0588931 | 3300048911 | Bacteria | 969 |
| 358 | Ga0496108_0780298 | 3300048911 | Bacteria | 825 |
| 359 | Ga0496109_0001443 | 3300048912 | Bacteria | 19754 |
| 360 | Ga0496110_0024131 | 3300048913 | Bacteria | 5180 |
| 361 | Ga0496110_0228404 | 3300048913 | Bacteria | 1692 |
| 362 | Ga0496110_0419356 | 3300048913 | Bacteria | 1220 |
| 363 | Ga0496110_1133173 | 3300048913 | Bacteria | 691 |
| 364 | Ga0496111_0436011 | 3300048914 | Bacteria | 967 |
| 365 | Ga0496112_0001558 | 3300048915 | Bacteria | 17713 |
| 366 | Ga0496112_1010461 | 3300048915 | Bacteria | 751 |
| 367 | Ga0496113_0001483 | 3300048916 | Bacteria | 13114 |
| 368 | Ga0496113_0010571 | 3300048916 | Bacteria | 6107 |
| 369 | Ga0496113_0280507 | 3300048916 | Bacteria | 1332 |
| 370 | Ga0496114_0000290 | 3300048917 | Bacteria | 36753 |
| 371 | Ga0496114_0440600 | 3300048917 | Bacteria | 1154 |
| 372 | Ga0496114_0949437 | 3300048917 | Bacteria | 742 |
| 373 | Ga0496114_1298827 | 3300048917 | Bacteria | 614 |
| 374 | Ga0496115_0003155 | 3300048918 | Bacteria | 11852 |
| 375 | Ga0496115_0019865 | 3300048918 | Bacteria | 5176 |
| 376 | Ga0496115_0057623 | 3300048918 | Bacteria | 3125 |
| 377 | Ga0496115_0639186 | 3300048918 | Bacteria | 842 |
| 378 | Ga0496116_0273267 | 3300048919 | Bacteria | 824 |
| 379 | Ga0496117_0235143 | 3300048920 | Bacteria | 1010 |
| 380 | Ga0496118_0175217 | 3300048921 | Bacteria | 1304 |
| 381 | Ga0496119_0022738 | 3300048922 | Bacteria | 4476 |
| 382 | Ga0496120_0036896 | 3300048923 | Bacteria | 2904 |
| 383 | Ga0496121_0051244 | 3300048924 | Bacteria | 3478 |
| 384 | Ga0496122_0007615 | 3300048925 | Bacteria | 11968 |
| 385 | Ga0496122_0100923 | 3300048925 | Bacteria | 1929 |
| 386 | Ga0496122_0278299 | 3300048925 | Bacteria | 916 |
| 387 | Ga0496123_0055689 | 3300048926 | Bacteria | 2591 |
| 388 | Ga0496124_0082577 | 3300048927 | Bacteria | 2637 |
| 389 | Ga0496124_0087867 | 3300048927 | Bacteria | 2542 |
| 390 | Ga0496125_0082641 | 3300048928 | Bacteria | 2447 |
| 391 | Ga0496125_0105615 | 3300048928 | Bacteria | 2058 |
| 392 | Ga0496126_0031654 | 3300048929 | Bacteria | 4992 |
| 393 | Ga0496126_0111250 | 3300048929 | Bacteria | 2385 |
| 394 | Ga0496126_0302353 | 3300048929 | Bacteria | 1319 |
| 395 | Ga0496126_0853138 | 3300048929 | Bacteria | 694 |
| 396 | Ga0501031_0198575 | 3300049568 | Bacteria | 1309 |
| 397 | Ga0501037_0022439 | 3300049573 | Bacteria | 4669 |
| 398 | Ga0501038_0553451 | 3300049574 | Bacteria | 874 |
| 399 | Ga0501039_0119308 | 3300049575 | Bacteria | 2066 |
| 400 | Ga0501040_0140528 | 3300049576 | Bacteria | 1701 |
| 401 | Ga0501042_0069013 | 3300049578 | Bacteria | 2528 |
| 402 | Ga0501046_0024593 | 3300049580 | Bacteria | 4939 |
| 403 | Ga0501048_0247788 | 3300049582 | Bacteria | 1264 |
| 404 | Ga0501070_0803033 | 3300049586 | Bacteria | 739 |
| 405 | Ga0501075_0226169 | 3300049591 | Bacteria | 1427 |
| 406 | Ga0501076_0154250 | 3300049592 | Bacteria | 1869 |
| 407 | Ga0501044_0642380 | 3300049823 | Bacteria | 951 |
| 408 | Ga0501045_0040032 | 3300049824 | Bacteria | 3410 |
| 409 | nmdc:mga03n38_249516_c1 | 3300050490 | Bacteria | 937 |
| 410 | nmdc:mga00v17_27926_c1 | 3300050491 | Bacteria | 3299 |
| 411 | nmdc:mga00v17_349596_c1 | 3300050491 | Bacteria | 961 |
| 412 | nmdc:mga0yw44_147163_c1 | 3300050492 | Bacteria | 1534 |
| 413 | nmdc:mga0yw44_26350_c1 | 3300050492 | Bacteria | 3320 |
| 414 | nmdc:mga0yw44_44148_c1 | 3300050492 | Bacteria | 2665 |
| 415 | nmdc:mga07m45_53861_c1 | 3300050496 | Bacteria | 2274 |
| 416 | nmdc:mga07m45_78980_c1 | 3300050496 | Bacteria | 1878 |
| 417 | nmdc:mga0qj67_1105113_c1 | 3300050509 | Bacteria | 619 |
| 418 | nmdc:mga08y16_66783_c1 | 3300050511 | Bacteria | 3754 |
| 419 | nmdc:mga0n895_18008_c1 | 3300050512 | Bacteria | 6528 |
| 420 | nmdc:mga08x19_95333_c1 | 3300050514 | Bacteria | 1968 |
| 421 | nmdc:mga0sz30_102683_c1 | 3300050516 | Bacteria | 1250 |
| 422 | nmdc:mga0sz30_135110_c1 | 3300050516 | Bacteria | 1088 |
| 423 | nmdc:mga0sz30_44043_c1 | 3300050516 | Bacteria | 1879 |
| 424 | nmdc:mga0sz30_86805_c1 | 3300050516 | Bacteria | 1358 |
| 425 | Ga0500610_0142079 | 3300053079 | Bacteria | 1211 |
| 426 | Ga0500578_0087490 | 3300053086 | Bacteria | 1979 |
| 427 | Ga0500643_000163 | 3300053087 | Bacteria | 66676 |
| 428 | Ga0500644_0225983 | 3300053088 | Bacteria | 782 |
| 429 | Ga0500646_0026278 | 3300053090 | Bacteria | 1577 |
| 430 | Ga0500651_0413484 | 3300053093 | Bacteria | 756 |
| 431 | Ga0500566_0000224 | 3300053094 | Bacteria | 30350 |
| 432 | Ga0500566_0096883 | 3300053094 | Bacteria | 1623 |
| 433 | Ga0500641_0002734 | 3300053096 | Bacteria | 6227 |
| 434 | Ga0500641_0016388 | 3300053096 | Bacteria | 2760 |
| 435 | Ga0500650_0045589 | 3300053098 | Bacteria | 2031 |
| 436 | Ga0500650_0112302 | 3300053098 | Bacteria | 1272 |
| 437 | Ga0500650_0118657 | 3300053098 | Bacteria | 1234 |
| 438 | Ga0500554_053541 | 3300053102 | Bacteria | 1277 |
| 439 | Ga0500555_001084 | 3300053103 | Bacteria | 9093 |
| 440 | Ga0500556_0027049 | 3300053104 | Bacteria | 1911 |
| 441 | Ga0500562_110308 | 3300053108 | Bacteria | 750 |
| 442 | Ga0500569_164298 | 3300053109 | Bacteria | 752 |
| 443 | Ga0500572_042735 | 3300053111 | Bacteria | 1322 |
| 444 | Ga0500594_0036703 | 3300053118 | Bacteria | 1320 |
| 445 | Ga0500595_005537 | 3300053119 | Bacteria | 5504 |
| 446 | Ga0500595_040507 | 3300053119 | Bacteria | 1502 |
| 447 | Ga0500608_046197 | 3300053122 | Bacteria | 2092 |
| 448 | Ga0500642_0007538 | 3300053130 | Bacteria | 3665 |
| 449 | Ga0500642_0008075 | 3300053130 | Bacteria | 3578 |
| 450 | Ga0500559_0063420 | 3300053136 | Bacteria | 1651 |
| 451 | Ga0500564_034892 | 3300053138 | Bacteria | 2322 |
| 452 | Ga0500568_0053420 | 3300053139 | Bacteria | 1583 |
| 453 | Ga0500577_0206153 | 3300053142 | Bacteria | 849 |
| 454 | Ga0500588_0001796 | 3300053146 | Bacteria | 4178 |
| 455 | Ga0500588_0008929 | 3300053146 | Bacteria | 2362 |
| 456 | Ga0500588_0021991 | 3300053146 | Bacteria | 1730 |
| 457 | Ga0500590_107781 | 3300053148 | Bacteria | 1327 |
| 458 | Ga0500604_0003195 | 3300053151 | Bacteria | 4404 |
| 459 | Ga0500604_0045994 | 3300053151 | Bacteria | 1333 |
| 460 | Ga0500616_0000705 | 3300053153 | Bacteria | 38798 |
| 461 | Ga0500616_0060070 | 3300053153 | Bacteria | 1972 |
| 462 | Ga0500619_056515 | 3300053154 | Bacteria | 1282 |
| 463 | Ga0500622_0022826 | 3300053156 | Bacteria | 3313 |
| 464 | Ga0500624_074124 | 3300053157 | Bacteria | 670 |
| 465 | Ga0500633_0062579 | 3300053160 | Bacteria | 1312 |
| 466 | Ga0500636_0000330 | 3300053177 | Bacteria | 26259 |
| 467 | Ga0500636_0002418 | 3300053177 | Bacteria | 10334 |
| 468 | Ga0500609_000476 | 3300053731 | Bacteria | 5969 |
| 469 | Ga0500609_001275 | 3300053731 | Bacteria | 3727 |
| 470 | Ga0500609_011550 | 3300053731 | Bacteria | 1193 |
| 471 | Ga0500599_012579 | 3300053736 | Bacteria | 1138 |
| 472 | Ga0500601_001460 | 3300053737 | Bacteria | 2595 |
| 473 | Ga0501084_0073475 | 3300054114 | Bacteria | 2864 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025939 | Ga0207665_10405791 | Ga0207665_104057912 | 151 |
| 2 | iso_pu_bacteria | 2507262055 | 2507504937 | 165 |
| 3 | iso_pu_bacteria | 2508501050 | 2508727602 | 165 |
| 4 | iso_pu_bacteria | 2508501114 | 2509077487 | 165 |
| 5 | iso_pu_bacteria | 2511231028 | 2511401386 | 165 |
| 6 | iso_pu_bacteria | 2513237092 | 2513623374 | 165 |
| 7 | iso_pu_bacteria | 2513237139 | 2513873818 | 165 |
| 8 | iso_pu_bacteria | 2513237161 | 2514015340 | 165 |
| 9 | iso_pu_bacteria | 2517093001 | 2517102292 | 165 |
| 10 | iso_pu_bacteria | 2528768022 | 2528851958 | 165 |
| 11 | iso_pu_bacteria | 2545555834 | 2545678069 | 165 |
| 12 | iso_pu_bacteria | 2595698237 | 2596373538 | 165 |
| 13 | iso_pu_bacteria | 2617270735 | 2617351799 | 165 |
| 14 | iso_pu_bacteria | 2617270741 | 2617374026 | 165 |
| 15 | iso_pu_bacteria | 2643221733 | 2644730869 | 165 |
| 16 | iso_pu_bacteria | 2643221734 | 2644736032 | 165 |
| 17 | iso_pu_bacteria | 2643221736 | 2644742586 | 165 |
| 18 | iso_pu_bacteria | 2738541281 | 2738745530 | 165 |
| 19 | iso_pu_bacteria | 2738543032 | 2739354760 | 165 |
| 20 | iso_pu_bacteria | 2773857925 | 2774868728 | 165 |
| 21 | iso_pu_bacteria | 2775506901 | 2776258335 | 165 |
| 22 | iso_pu_bacteria | 2791355196 | 2793063020 | 165 |
| 23 | iso_pu_bacteria | 2802429603 | 2805915901 | 165 |
| 24 | iso_pu_bacteria | 2818991467 | 2819722087 | 165 |
| 25 | iso_pu_bacteria | 2824661429 | 2824670084 | 165 |
| 26 | iso_pu_bacteria | 2824671348 | 2824679108 | 165 |
| 27 | iso_pu_bacteria | 2824687955 | 2824695718 | 165 |
| 28 | iso_pu_bacteria | 2824696289 | 2824701633 | 165 |
| 29 | iso_pu_bacteria | 2824704595 | 2824713651 | 165 |
| 30 | iso_pu_bacteria | 2824732956 | 2824739262 | 165 |
| 31 | iso_pu_bacteria | 2824746037 | 2824748925 | 165 |
| 32 | iso_pu_bacteria | 2824753945 | 2824760561 | 165 |
| 33 | iso_pu_bacteria | 2824763712 | 2824771025 | 165 |
| 34 | iso_pu_bacteria | 2824773399 | 2824774844 | 165 |
| 35 | iso_pu_bacteria | 2829745981 | 2829750703 | 165 |
| 36 | iso_pu_bacteria | 2835312727 | 2835318528 | 165 |
| 37 | iso_pu_bacteria | 2838122688 | 2838124215 | 165 |
| 38 | iso_pu_bacteria | 2841760612 | 2841763991 | 165 |
| 39 | iso_pu_bacteria | 2841911363 | 2841915525 | 165 |
| 40 | iso_pu_bacteria | 2841917233 | 2841920727 | 165 |
| 41 | iso_pu_bacteria | 2841941048 | 2841944561 | 165 |
| 42 | iso_pu_bacteria | 2841949485 | 2841951699 | 165 |
| 43 | iso_pu_bacteria | 2841957949 | 2841964840 | 165 |
| 44 | iso_pu_bacteria | 2841966195 | 2841969339 | 165 |
| 45 | iso_pu_bacteria | 2841974524 | 2841980264 | 165 |
| 46 | iso_pu_bacteria | 2841983080 | 2841985514 | 165 |
| 47 | iso_pu_bacteria | 2842038055 | 2842043786 | 165 |
| 48 | iso_pu_bacteria | 2842045827 | 2842052224 | 165 |
| 49 | iso_pu_bacteria | 2844104063 | 2844108554 | 165 |
| 50 | iso_pu_bacteria | 2844315083 | 2844321915 | 165 |
| 51 | iso_pu_bacteria | 2847939898 | 2847941852 | 165 |
| 52 | iso_pu_bacteria | 2851182111 | 2851185234 | 165 |
| 53 | iso_pu_bacteria | 2851246043 | 2851250426 | 165 |
| 54 | iso_pu_bacteria | 2861691609 | 2861695916 | 165 |
| 55 | iso_pu_bacteria | 2874612657 | 2874618479 | 165 |
| 56 | iso_pu_bacteria | 2874620515 | 2874624508 | 165 |
| 57 | iso_pu_bacteria | 2874628541 | 2874629128 | 165 |
| 58 | iso_pu_bacteria | 2879099564 | 2879107321 | 165 |
| 59 | iso_pu_bacteria | 2882456835 | 2882457563 | 165 |
| 60 | iso_pu_bacteria | 2884298095 | 2884301344 | 165 |
| 61 | iso_pu_bacteria | 2889306138 | 2889311485 | 165 |
| 62 | iso_pu_bacteria | 2894232714 | 2894235974 | 165 |
| 63 | iso_pu_bacteria | 2902405164 | 2902411663 | 165 |
| 64 | iso_pu_bacteria | 2903727486 | 2903727537 | 165 |
| 65 | iso_pu_bacteria | 2904666416 | 2904672153 | 165 |
| 66 | iso_pu_bacteria | 2904711408 | 2904718166 | 165 |
| 67 | iso_pu_bacteria | 2906602504 | 2906602973 | 165 |
| 68 | iso_pu_bacteria | 2908775508 | 2908776503 | 165 |
| 69 | iso_pu_bacteria | 2917699015 | 2917701902 | 165 |
| 70 | iso_pu_bacteria | 2928125067 | 2928128570 | 165 |
| 71 | iso_pu_bacteria | 2929615660 | 2929623800 | 165 |
| 72 | iso_pu_bacteria | 2929624759 | 2929629031 | 165 |
| 73 | iso_pu_bacteria | 2932784394 | 2932786443 | 165 |
| 74 | iso_pu_bacteria | 2932809354 | 2932812483 | 165 |
| 75 | iso_pu_bacteria | 2932818245 | 2932822845 | 165 |
| 76 | iso_pu_bacteria | 2932828146 | 2932829680 | 165 |
| 77 | iso_pu_bacteria | 2933577622 | 2933585679 | 165 |
| 78 | iso_pu_bacteria | 2935616580 | 2935618200 | 165 |
| 79 | iso_pu_bacteria | 2935638405 | 2935641404 | 165 |
| 80 | iso_pu_bacteria | 2935648319 | 2935652897 | 165 |
| 81 | iso_pu_bacteria | 2935656913 | 2935661480 | 165 |
| 82 | iso_pu_bacteria | 2935665750 | 2935669538 | 165 |
| 83 | iso_pu_bacteria | 2935675223 | 2935677864 | 165 |
| 84 | iso_pu_bacteria | 2935684952 | 2935689687 | 165 |
| 85 | iso_pu_bacteria | 2935694250 | 2935698225 | 165 |
| 86 | iso_pu_bacteria | 2935703347 | 2935707363 | 165 |
| 87 | iso_pu_bacteria | 2935713505 | 2935717207 | 165 |
| 88 | iso_pu_bacteria | 2935722832 | 2935724124 | 165 |
| 89 | iso_pu_bacteria | 2935732158 | 2935738622 | 165 |
| 90 | iso_pu_bacteria | 2935741537 | 2935749130 | 165 |
| 91 | iso_pu_bacteria | 2935750917 | 2935757041 | 165 |
| 92 | iso_pu_bacteria | 2935760218 | 2935764348 | 165 |
| 93 | iso_pu_bacteria | 2935801545 | 2935804258 | 165 |
| 94 | iso_pu_bacteria | 2935827899 | 2935831135 | 165 |
| 95 | iso_pu_bacteria | 2935837841 | 2935841744 | 165 |
| 96 | iso_pu_bacteria | 2935855204 | 2935856301 | 165 |
| 97 | iso_pu_bacteria | 2935864058 | 2935866367 | 165 |
| 98 | iso_pu_bacteria | 2935873716 | 2935874674 | 165 |
| 99 | iso_pu_bacteria | 2935959822 | 2935962368 | 165 |
| 100 | iso_pu_bacteria | 2935984226 | 2935984878 | 165 |
| 101 | iso_pu_bacteria | 2935992306 | 2935994132 | 165 |
| 102 | iso_pu_bacteria | 2936002035 | 2936004857 | 165 |
| 103 | iso_pu_bacteria | 2936011229 | 2936015791 | 165 |
| 104 | iso_pu_bacteria | 2936019824 | 2936024425 | 165 |
| 105 | iso_pu_bacteria | 2936028420 | 2936031688 | 165 |
| 106 | iso_pu_bacteria | 2936046547 | 2936051510 | 165 |
| 107 | iso_pu_bacteria | 2936055302 | 2936056049 | 165 |
| 108 | iso_pu_bacteria | 2940556831 | 2940562955 | 165 |
| 109 | iso_pu_bacteria | 2941538514 | 2941543817 | 165 |
| 110 | iso_pu_bacteria | 3005718088 | 3005725037 | 165 |
| 111 | iso_pu_bacteria | 641522639 | 641642416 | 165 |
| 112 | iso_pu_bacteria | 643348564 | 643598895 | 165 |
| 113 | iso_pu_bacteria | 8006926726 | 8006932777 | 165 |
| 114 | iso_pu_bacteria | 8016630954 | 8016635985 | 165 |
| 115 | iso_pu_bacteria | 8017057580 | 8017058142 | 165 |
| 116 | iso_pu_bacteria | 8019586578 | 8019595680 | 165 |
| 117 | iso_pu_bacteria | 8019608314 | 8019612450 | 165 |
| 118 | iso_pu_bacteria | 8019648815 | 8019652782 | 165 |
| 119 | iso_pu_bacteria | 8055742211 | 8055751101 | 165 |
| 120 | iso_pu_bacteria | 8057529695 | 8057534084 | 165 |
| 121 | 3300005331 | Ga0070670_100075398 | Ga0070670_1000753983 | 166 |
| 122 | 3300005354 | Ga0070675_100128215 | Ga0070675_1001282153 | 166 |
| 123 | 3300005543 | Ga0070672_100216621 | Ga0070672_1002166213 | 166 |
| 124 | 3300005618 | Ga0068864_101191853 | Ga0068864_1011918532 | 166 |
| 125 | 3300025925 | Ga0207650_10095627 | Ga0207650_100956273 | 166 |
| 126 | 3300025940 | Ga0207691_10129493 | Ga0207691_101294933 | 166 |
| 127 | 3300025960 | Ga0207651_10212262 | Ga0207651_102122623 | 166 |
| 128 | 3300032002 | Ga0307416_102132942 | Ga0307416_1021329421 | 167 |
| 129 | 3300037853 | Ga0436364_0497276 | Ga0436364_0497276_127_648 | 167 |
| 130 | 3300005366 | Ga0070659_100994064 | Ga0070659_1009940641 | 168 |
| 131 | 3300005440 | Ga0070705_100417546 | Ga0070705_1004175461 | 168 |
| 132 | 3300005444 | Ga0070694_100728250 | Ga0070694_1007282502 | 168 |
| 133 | 3300005546 | Ga0070696_100008909 | Ga0070696_1000089093 | 168 |
| 134 | 3300005549 | Ga0070704_100024848 | Ga0070704_1000248482 | 168 |
| 135 | 3300005617 | Ga0068859_100362045 | Ga0068859_1003620452 | 168 |
| 136 | 3300005842 | Ga0068858_101139955 | Ga0068858_1011399551 | 168 |
| 137 | 3300005843 | Ga0068860_100400687 | Ga0068860_1004006872 | 168 |
| 138 | 3300005843 | Ga0068860_100926396 | Ga0068860_1009263961 | 168 |
| 139 | 3300005844 | Ga0068862_100365703 | Ga0068862_1003657032 | 168 |
| 140 | 3300006038 | Ga0075365_11004602 | Ga0075365_110046021 | 168 |
| 141 | 3300006042 | Ga0075368_10318850 | Ga0075368_103188501 | 168 |
| 142 | 3300006177 | Ga0075362_10257900 | Ga0075362_102579001 | 168 |
| 143 | 3300006195 | Ga0075366_10054826 | Ga0075366_100548263 | 168 |
| 144 | 3300006353 | Ga0075370_10052635 | Ga0075370_100526351 | 168 |
| 145 | 3300006931 | Ga0097620_100362038 | Ga0097620_1003620382 | 168 |
| 146 | 3300009101 | Ga0105247_10160516 | Ga0105247_101605162 | 168 |
| 147 | 3300009177 | Ga0105248_10806788 | Ga0105248_108067881 | 168 |
| 148 | 3300009553 | Ga0105249_10014538 | Ga0105249_100145385 | 168 |
| 149 | 3300009553 | Ga0105249_10914868 | Ga0105249_109148682 | 168 |
| 150 | 3300013296 | Ga0157374_10203265 | Ga0157374_102032652 | 168 |
| 151 | 3300014325 | Ga0163163_10047869 | Ga0163163_100478693 | 168 |
| 152 | 3300014968 | Ga0157379_10170305 | Ga0157379_101703052 | 168 |
| 153 | 3300014968 | Ga0157379_10252918 | Ga0157379_102529182 | 168 |
| 154 | 3300021384 | Ga0213876_10029125 | Ga0213876_100291253 | 168 |
| 155 | 3300021388 | Ga0213875_10076933 | Ga0213875_100769332 | 168 |
| 156 | 3300025961 | Ga0207712_10007361 | Ga0207712_100073613 | 168 |
| 157 | 3300028380 | Ga0268265_11749033 | Ga0268265_117490331 | 168 |
| 158 | 3300037853 | Ga0436364_0532601 | Ga0436364_0532601_55_561 | 168 |
| 159 | 3300039437 | Ga0436365_0277390 | Ga0436365_0277390_3176_3691 | 168 |
| 160 | 3300048907 | Ga0496104_0251380 | Ga0496104_0251380_184_690 | 168 |
| 161 | 3300048917 | Ga0496114_1298827 | Ga0496114_1298827_80_586 | 168 |
| 162 | 3300049568 | Ga0501031_0198575 | Ga0501031_0198575_168_680 | 168 |
| 163 | 3300049574 | Ga0501038_0553451 | Ga0501038_0553451_30_542 | 168 |
| 164 | 3300049575 | Ga0501039_0119308 | Ga0501039_0119308_497_1009 | 168 |
| 165 | 3300049576 | Ga0501040_0140528 | Ga0501040_0140528_720_1232 | 168 |
| 166 | 3300049578 | Ga0501042_0069013 | Ga0501042_0069013_1466_1978 | 168 |
| 167 | 3300049580 | Ga0501046_0024593 | Ga0501046_0024593_2210_2722 | 168 |
| 168 | 3300049582 | Ga0501048_0247788 | Ga0501048_0247788_641_1153 | 168 |
| 169 | 3300049586 | Ga0501070_0803033 | Ga0501070_0803033_82_588 | 168 |
| 170 | 3300049591 | Ga0501075_0226169 | Ga0501075_0226169_873_1385 | 168 |
| 171 | 3300049824 | Ga0501045_0040032 | Ga0501045_0040032_836_1348 | 168 |
| 172 | 3300050509 | nmdc:mga0qj67_1105113_c1 | nmdc:mga0qj67_1105113_c1_26_532 | 168 |
| 173 | 3300054114 | Ga0501084_0073475 | Ga0501084_0073475_1839_2351 | 168 |
| 174 | 3300002987 | JGI25159J45721_1021976 | JGI25159J45721_10219762 | 169 |
| 175 | 3300003187 | JGI25151J46595_10000021 | JGI25151J46595_1000002122 | 169 |
| 176 | 3300003215 | JGI25153J46596_10000133 | JGI25153J46596_100001339 | 169 |
| 177 | 3300003215 | JGI25153J46596_10001375 | JGI25153J46596_1000137515 | 169 |
| 178 | 3300003215 | JGI25153J46596_10015196 | JGI25153J46596_100151962 | 169 |
| 179 | 3300003354 | JGI25160J50197_1001189 | JGI25160J50197_10011893 | 169 |
| 180 | 3300003771 | Ga0055526_1001254 | Ga0055526_100125411 | 169 |
| 181 | 3300003771 | Ga0055526_1001771 | Ga0055526_100177111 | 169 |
| 182 | 3300003775 | Ga0055524_1000011 | Ga0055524_1000011177 | 169 |
| 183 | 3300005262 | Ga0065165_1000150 | Ga0065165_100015036 | 169 |
| 184 | 3300005262 | Ga0065165_1053766 | Ga0065165_10537662 | 169 |
| 185 | 3300005327 | Ga0070658_10811070 | Ga0070658_108110701 | 169 |
| 186 | 3300005338 | Ga0068868_100003650 | Ga0068868_10000365011 | 169 |
| 187 | 3300005339 | Ga0070660_100492174 | Ga0070660_1004921742 | 169 |
| 188 | 3300005340 | Ga0070689_100000018 | Ga0070689_1000000189 | 169 |
| 189 | 3300005347 | Ga0070668_100464360 | Ga0070668_1004643602 | 169 |
| 190 | 3300005347 | Ga0070668_100516691 | Ga0070668_1005166912 | 169 |
| 191 | 3300005354 | Ga0070675_100083801 | Ga0070675_1000838014 | 169 |
| 192 | 3300005354 | Ga0070675_100298987 | Ga0070675_1002989872 | 169 |
| 193 | 3300005354 | Ga0070675_100299578 | Ga0070675_1002995781 | 169 |
| 194 | 3300005355 | Ga0070671_100015653 | Ga0070671_1000156532 | 169 |
| 195 | 3300005355 | Ga0070671_100141019 | Ga0070671_1001410191 | 169 |
| 196 | 3300005364 | Ga0070673_100090930 | Ga0070673_1000909301 | 169 |
| 197 | 3300005365 | Ga0070688_100122177 | Ga0070688_1001221772 | 169 |
| 198 | 3300005434 | Ga0070709_10018422 | Ga0070709_100184223 | 169 |
| 199 | 3300005435 | Ga0070714_100017599 | Ga0070714_1000175992 | 169 |
| 200 | 3300005436 | Ga0070713_100018232 | Ga0070713_1000182322 | 169 |
| 201 | 3300005436 | Ga0070713_100251505 | Ga0070713_1002515052 | 169 |
| 202 | 3300005437 | Ga0070710_10083796 | Ga0070710_100837962 | 169 |
| 203 | 3300005441 | Ga0070700_100812870 | Ga0070700_1008128701 | 169 |
| 204 | 3300005455 | Ga0070663_100096378 | Ga0070663_1000963783 | 169 |
| 205 | 3300005455 | Ga0070663_100234570 | Ga0070663_1002345702 | 169 |
| 206 | 3300005456 | Ga0070678_100745913 | Ga0070678_1007459132 | 169 |
| 207 | 3300005456 | Ga0070678_101010449 | Ga0070678_1010104492 | 169 |
| 208 | 3300005459 | Ga0068867_100044224 | Ga0068867_1000442243 | 169 |
| 209 | 3300005459 | Ga0068867_101540674 | Ga0068867_1015406741 | 169 |
| 210 | 3300005466 | Ga0070685_10013703 | Ga0070685_100137031 | 169 |
| 211 | 3300005535 | Ga0070684_100273139 | Ga0070684_1002731392 | 169 |
| 212 | 3300005535 | Ga0070684_100424240 | Ga0070684_1004242402 | 169 |
| 213 | 3300005543 | Ga0070672_100416870 | Ga0070672_1004168701 | 169 |
| 214 | 3300005544 | Ga0070686_100030101 | Ga0070686_1000301012 | 169 |
| 215 | 3300005547 | Ga0070693_100624624 | Ga0070693_1006246241 | 169 |
| 216 | 3300005548 | Ga0070665_100027310 | Ga0070665_1000273102 | 169 |
| 217 | 3300005614 | Ga0068856_100227664 | Ga0068856_1002276643 | 169 |
| 218 | 3300005614 | Ga0068856_100294832 | Ga0068856_1002948322 | 169 |
| 219 | 3300005615 | Ga0070702_100141784 | Ga0070702_1001417842 | 169 |
| 220 | 3300005616 | Ga0068852_100076609 | Ga0068852_1000766093 | 169 |
| 221 | 3300005718 | Ga0068866_10209299 | Ga0068866_102092992 | 169 |
| 222 | 3300005841 | Ga0068863_100407461 | Ga0068863_1004074612 | 169 |
| 223 | 3300005841 | Ga0068863_101461066 | Ga0068863_1014610661 | 169 |
| 224 | 3300005844 | Ga0068862_100004007 | Ga0068862_10000400713 | 169 |
| 225 | 3300005937 | Ga0081455_10043443 | Ga0081455_100434433 | 169 |
| 226 | 3300005937 | Ga0081455_10124402 | Ga0081455_101244022 | 169 |
| 227 | 3300005983 | Ga0081540_1081219 | Ga0081540_10812191 | 169 |
| 228 | 3300006028 | Ga0070717_10005153 | Ga0070717_100051534 | 169 |
| 229 | 3300006038 | Ga0075365_10017968 | Ga0075365_100179683 | 169 |
| 230 | 3300006038 | Ga0075365_10027319 | Ga0075365_100273192 | 169 |
| 231 | 3300006038 | Ga0075365_10164656 | Ga0075365_101646561 | 169 |
| 232 | 3300006038 | Ga0075365_10405718 | Ga0075365_104057182 | 169 |
| 233 | 3300006051 | Ga0075364_10133114 | Ga0075364_101331142 | 169 |
| 234 | 3300006051 | Ga0075364_10490732 | Ga0075364_104907321 | 169 |
| 235 | 3300006173 | Ga0070716_100121943 | Ga0070716_1001219433 | 169 |
| 236 | 3300006173 | Ga0070716_100231711 | Ga0070716_1002317112 | 169 |
| 237 | 3300006186 | Ga0075369_10061400 | Ga0075369_100614002 | 169 |
| 238 | 3300006186 | Ga0075369_10077135 | Ga0075369_100771352 | 169 |
| 239 | 3300006195 | Ga0075366_10091254 | Ga0075366_100912542 | 169 |
| 240 | 3300006237 | Ga0097621_100085078 | Ga0097621_1000850782 | 169 |
| 241 | 3300006237 | Ga0097621_100335347 | Ga0097621_1003353472 | 169 |
| 242 | 3300006353 | Ga0075370_10247437 | Ga0075370_102474372 | 169 |
| 243 | 3300006358 | Ga0068871_100021632 | Ga0068871_1000216321 | 169 |
| 244 | 3300006871 | Ga0075434_100011878 | Ga0075434_1000118785 | 169 |
| 245 | 3300006871 | Ga0075434_100339422 | Ga0075434_1003394222 | 169 |
| 246 | 3300006944 | Ga0099823_1013263 | Ga0099823_10132633 | 169 |
| 247 | 3300009093 | Ga0105240_10009401 | Ga0105240_100094014 | 169 |
| 248 | 3300009093 | Ga0105240_10076360 | Ga0105240_100763603 | 169 |
| 249 | 3300009093 | Ga0105240_10077368 | Ga0105240_100773684 | 169 |
| 250 | 3300009093 | Ga0105240_10430678 | Ga0105240_104306782 | 169 |
| 251 | 3300009093 | Ga0105240_10670205 | Ga0105240_106702052 | 169 |
| 252 | 3300009101 | Ga0105247_10786876 | Ga0105247_107868761 | 169 |
| 253 | 3300009174 | Ga0105241_10131101 | Ga0105241_101311011 | 169 |
| 254 | 3300009174 | Ga0105241_10187922 | Ga0105241_101879222 | 169 |
| 255 | 3300009545 | Ga0105237_10133511 | Ga0105237_101335113 | 169 |
| 256 | 3300010375 | Ga0105239_10079271 | Ga0105239_100792712 | 169 |
| 257 | 3300010375 | Ga0105239_10367297 | Ga0105239_103672972 | 169 |
| 258 | 3300012500 | Ga0157314_1014240 | Ga0157314_10142401 | 169 |
| 259 | 3300013250 | Ga0171462_1015 | Ga0171462_101568 | 169 |
| 260 | 3300013296 | Ga0157374_10848455 | Ga0157374_108484552 | 169 |
| 261 | 3300013297 | Ga0157378_10274569 | Ga0157378_102745692 | 169 |
| 262 | 3300013306 | Ga0163162_10927960 | Ga0163162_109279601 | 169 |
| 263 | 3300013307 | Ga0157372_11862187 | Ga0157372_118621871 | 169 |
| 264 | 3300013308 | Ga0157375_12225208 | Ga0157375_122252081 | 169 |
| 265 | 3300014325 | Ga0163163_10004923 | Ga0163163_100049237 | 169 |
| 266 | 3300014325 | Ga0163163_10308330 | Ga0163163_103083303 | 169 |
| 267 | 3300014325 | Ga0163163_10733616 | Ga0163163_107336162 | 169 |
| 268 | 3300014326 | Ga0157380_10019928 | Ga0157380_100199282 | 169 |
| 269 | 3300014497 | Ga0182008_10534830 | Ga0182008_105348301 | 169 |
| 270 | 3300017792 | Ga0163161_10552857 | Ga0163161_105528571 | 169 |
| 271 | 3300017792 | Ga0163161_11383257 | Ga0163161_113832571 | 169 |
| 272 | 3300020081 | Ga0206354_10108602 | Ga0206354_101086023 | 169 |
| 273 | 3300020081 | Ga0206354_10359821 | Ga0206354_103598211 | 169 |
| 274 | 3300021320 | Ga0214544_1000003 | Ga0214544_100000332 | 169 |
| 275 | 3300021321 | Ga0214542_1000003 | Ga0214542_100000322 | 169 |
| 276 | 3300021324 | Ga0214545_1000004 | Ga0214545_100000435 | 169 |
| 277 | 3300021327 | Ga0214543_1000007 | Ga0214543_1000007381 | 169 |
| 278 | 3300021377 | Ga0213874_10002498 | Ga0213874_100024982 | 169 |
| 279 | 3300021384 | Ga0213876_10007769 | Ga0213876_100077698 | 169 |
| 280 | 3300021384 | Ga0213876_10009062 | Ga0213876_100090623 | 169 |
| 281 | 3300021388 | Ga0213875_10021992 | Ga0213875_100219924 | 169 |
| 282 | 3300021388 | Ga0213875_10377973 | Ga0213875_103779731 | 169 |
| 283 | 3300025261 | Ga0209233_1021879 | Ga0209233_10218792 | 169 |
| 284 | 3300025273 | Ga0209673_1049107 | Ga0209673_10491072 | 169 |
| 285 | 3300025284 | Ga0209130_1000187 | Ga0209130_100018770 | 169 |
| 286 | 3300025291 | Ga0209675_1005741 | Ga0209675_10057412 | 169 |
| 287 | 3300025294 | Ga0209025_1000010 | Ga0209025_1000010476 | 169 |
| 288 | 3300025294 | Ga0209025_1003913 | Ga0209025_100391315 | 169 |
| 289 | 3300025294 | Ga0209025_1062867 | Ga0209025_10628672 | 169 |
| 290 | 3300025294 | Ga0209025_1070283 | Ga0209025_10702832 | 169 |
| 291 | 3300025295 | Ga0209564_1000019 | Ga0209564_1000019508 | 169 |
| 292 | 3300025295 | Ga0209564_1000369 | Ga0209564_100036968 | 169 |
| 293 | 3300025297 | Ga0209758_1000005 | Ga0209758_1000005810 | 169 |
| 294 | 3300025297 | Ga0209758_1002632 | Ga0209758_100263214 | 169 |
| 295 | 3300025297 | Ga0209758_1016086 | Ga0209758_10160862 | 169 |
| 296 | 3300025297 | Ga0209758_1039208 | Ga0209758_10392083 | 169 |
| 297 | 3300025297 | Ga0209758_1078121 | Ga0209758_10781212 | 169 |
| 298 | 3300025298 | Ga0209050_1019524 | Ga0209050_10195243 | 169 |
| 299 | 3300025298 | Ga0209050_1064198 | Ga0209050_10641982 | 169 |
| 300 | 3300025299 | Ga0209256_1000317 | Ga0209256_100031722 | 169 |
| 301 | 3300025299 | Ga0209256_1050348 | Ga0209256_10503482 | 169 |
| 302 | 3300025302 | Ga0207426_1000201 | Ga0207426_100020192 | 169 |
| 303 | 3300025302 | Ga0207426_1011144 | Ga0207426_10111442 | 169 |
| 304 | 3300025302 | Ga0207426_1018295 | Ga0207426_10182953 | 169 |
| 305 | 3300025304 | Ga0209257_1000391 | Ga0209257_100039174 | 169 |
| 306 | 3300025304 | Ga0209257_1065298 | Ga0209257_10652982 | 169 |
| 307 | 3300025898 | Ga0207692_10081313 | Ga0207692_100813132 | 169 |
| 308 | 3300025898 | Ga0207692_10628966 | Ga0207692_106289662 | 169 |
| 309 | 3300025903 | Ga0207680_10198228 | Ga0207680_101982282 | 169 |
| 310 | 3300025906 | Ga0207699_10115358 | Ga0207699_101153581 | 169 |
| 311 | 3300025911 | Ga0207654_10044547 | Ga0207654_100445473 | 169 |
| 312 | 3300025913 | Ga0207695_10000065 | Ga0207695_10000065263 | 169 |
| 313 | 3300025913 | Ga0207695_10055253 | Ga0207695_100552533 | 169 |
| 314 | 3300025913 | Ga0207695_10414864 | Ga0207695_104148642 | 169 |
| 315 | 3300025914 | Ga0207671_10017405 | Ga0207671_100174052 | 169 |
| 316 | 3300025918 | Ga0207662_10112981 | Ga0207662_101129813 | 169 |
| 317 | 3300025919 | Ga0207657_10185324 | Ga0207657_101853242 | 169 |
| 318 | 3300025921 | Ga0207652_10104076 | Ga0207652_101040762 | 169 |
| 319 | 3300025925 | Ga0207650_10836010 | Ga0207650_108360102 | 169 |
| 320 | 3300025926 | Ga0207659_10159977 | Ga0207659_101599772 | 169 |
| 321 | 3300025926 | Ga0207659_10263559 | Ga0207659_102635592 | 169 |
| 322 | 3300025928 | Ga0207700_10040741 | Ga0207700_100407411 | 169 |
| 323 | 3300025929 | Ga0207664_10028898 | Ga0207664_100288982 | 169 |
| 324 | 3300025931 | Ga0207644_10052406 | Ga0207644_100524064 | 169 |
| 325 | 3300025931 | Ga0207644_10538122 | Ga0207644_105381222 | 169 |
| 326 | 3300025931 | Ga0207644_10656374 | Ga0207644_106563742 | 169 |
| 327 | 3300025933 | Ga0207706_10237822 | Ga0207706_102378222 | 169 |
| 328 | 3300025936 | Ga0207670_10000001 | Ga0207670_100000019 | 169 |
| 329 | 3300025936 | Ga0207670_10026049 | Ga0207670_100260495 | 169 |
| 330 | 3300025939 | Ga0207665_10136391 | Ga0207665_101363911 | 169 |
| 331 | 3300025940 | Ga0207691_10005607 | Ga0207691_1000560712 | 169 |
| 332 | 3300025945 | Ga0207679_11454512 | Ga0207679_114545122 | 169 |
| 333 | 3300025949 | Ga0207667_10753042 | Ga0207667_107530422 | 169 |
| 334 | 3300025960 | Ga0207651_10000751 | Ga0207651_100007517 | 169 |
| 335 | 3300025960 | Ga0207651_10121773 | Ga0207651_101217732 | 169 |
| 336 | 3300025961 | Ga0207712_11364006 | Ga0207712_113640061 | 169 |
| 337 | 3300025972 | Ga0207668_10411807 | Ga0207668_104118071 | 169 |
| 338 | 3300025972 | Ga0207668_11362324 | Ga0207668_113623241 | 169 |
| 339 | 3300025981 | Ga0207640_10813913 | Ga0207640_108139131 | 169 |
| 340 | 3300025986 | Ga0207658_10039079 | Ga0207658_100390793 | 169 |
| 341 | 3300026023 | Ga0207677_10004986 | Ga0207677_100049865 | 169 |
| 342 | 3300026067 | Ga0207678_10744374 | Ga0207678_107443741 | 169 |
| 343 | 3300026075 | Ga0207708_10244255 | Ga0207708_102442552 | 169 |
| 344 | 3300026075 | Ga0207708_10409273 | Ga0207708_104092732 | 169 |
| 345 | 3300026075 | Ga0207708_11100282 | Ga0207708_111002821 | 169 |
| 346 | 3300026078 | Ga0207702_10250907 | Ga0207702_102509071 | 169 |
| 347 | 3300026078 | Ga0207702_10490535 | Ga0207702_104905352 | 169 |
| 348 | 3300026088 | Ga0207641_11541881 | Ga0207641_115418811 | 169 |
| 349 | 3300026089 | Ga0207648_10031123 | Ga0207648_100311233 | 169 |
| 350 | 3300026089 | Ga0207648_10316570 | Ga0207648_103165702 | 169 |
| 351 | 3300026089 | Ga0207648_11460127 | Ga0207648_114601271 | 169 |
| 352 | 3300026095 | Ga0207676_10167880 | Ga0207676_101678802 | 169 |
| 353 | 3300026121 | Ga0207683_10054965 | Ga0207683_100549652 | 169 |
| 354 | 3300026121 | Ga0207683_10246280 | Ga0207683_102462802 | 169 |
| 355 | 3300026142 | Ga0207698_10104979 | Ga0207698_101049794 | 169 |
| 356 | 3300027296 | Ga0209389_1010635 | Ga0209389_10106356 | 169 |
| 357 | 3300027361 | Ga0209489_112010 | Ga0209489_1120106 | 169 |
| 358 | 3300027363 | Ga0209700_110939 | Ga0209700_1109398 | 169 |
| 359 | 3300027907 | Ga0207428_10035875 | Ga0207428_100358752 | 169 |
| 360 | 3300028379 | Ga0268266_10006781 | Ga0268266_100067815 | 169 |
| 361 | 3300028577 | Ga0265318_10067478 | Ga0265318_100674782 | 169 |
| 362 | 3300028794 | Ga0307515_10178960 | Ga0307515_101789603 | 169 |
| 363 | 3300031240 | Ga0265320_10269587 | Ga0265320_102695871 | 169 |
| 364 | 3300031456 | Ga0307513_10036871 | Ga0307513_100368714 | 169 |
| 365 | 3300031456 | Ga0307513_10129247 | Ga0307513_101292472 | 169 |
| 366 | 3300031548 | Ga0307408_100052585 | Ga0307408_1000525852 | 169 |
| 367 | 3300031548 | Ga0307408_100225750 | Ga0307408_1002257502 | 169 |
| 368 | 3300031616 | Ga0307508_10082799 | Ga0307508_100827994 | 169 |
| 369 | 3300031901 | Ga0307406_10141603 | Ga0307406_101416032 | 169 |
| 370 | 3300031901 | Ga0307406_10324944 | Ga0307406_103249442 | 169 |
| 371 | 3300031911 | Ga0307412_10212845 | Ga0307412_102128452 | 169 |
| 372 | 3300031995 | Ga0307409_101744072 | Ga0307409_1017440721 | 169 |
| 373 | 3300032002 | Ga0307416_100878294 | Ga0307416_1008782942 | 169 |
| 374 | 3300032126 | Ga0307415_100643481 | Ga0307415_1006434812 | 169 |
| 375 | 3300032126 | Ga0307415_101320184 | Ga0307415_1013201842 | 169 |
| 376 | 3300033180 | Ga0307510_10016772 | Ga0307510_100167721 | 169 |
| 377 | 3300033180 | Ga0307510_10070055 | Ga0307510_100700552 | 169 |
| 378 | 3300035120 | Ga0373957_0079320 | Ga0373957_0079320_63_590 | 169 |
| 379 | 3300035171 | Ga0373946_0030522 | Ga0373946_0030522_1450_1962 | 169 |
| 380 | 3300035172 | Ga0373955_0110620 | Ga0373955_0110620_563_1078 | 169 |
| 381 | 3300035691 | Ga0373931_0472589 | Ga0373931_0472589_216_725 | 169 |
| 382 | 3300035724 | Ga0373933_0120135 | Ga0373933_0120135_449_964 | 169 |
| 383 | 3300035724 | Ga0373933_0526077 | Ga0373933_0526077_74_589 | 169 |
| 384 | 3300036401 | Ga0373937_0197415 | Ga0373937_0197415_1335_1850 | 169 |
| 385 | 3300037068 | Ga0373925_0268148 | Ga0373925_0268148_771_1283 | 169 |
| 386 | 3300037068 | Ga0373925_0898809 | Ga0373925_0898809_33_542 | 169 |
| 387 | 3300037466 | Ga0395898_1118688 | Ga0395898_1118688_165_674 | 169 |
| 388 | 3300037471 | Ga0395905_0081569 | Ga0395905_0081569_1671_2180 | 169 |
| 389 | 3300037853 | Ga0436364_0197909 | Ga0436364_0197909_194_724 | 169 |
| 390 | 3300037853 | Ga0436364_1099918 | Ga0436364_1099918_2189_2701 | 169 |
| 391 | 3300038705 | Ga0237819_26476 | Ga0237819_26476_15_524 | 169 |
| 392 | 3300039145 | Ga0237816_00722 | Ga0237816_00722_1224_1733 | 169 |
| 393 | 3300039437 | Ga0436365_0088001 | Ga0436365_0088001_618_1130 | 169 |
| 394 | 3300039437 | Ga0436365_0678611 | Ga0436365_0678611_1649_2158 | 169 |
| 395 | 3300039437 | Ga0436365_1886658 | Ga0436365_1886658_2058_2567 | 169 |
| 396 | 3300039438 | Ga0436360_0652803 | Ga0436360_0652803_89_598 | 169 |
| 397 | 3300039447 | Ga0436361_0425765 | Ga0436361_0425765_23_535 | 169 |
| 398 | 3300039447 | Ga0436361_0500698 | Ga0436361_0500698_36_548 | 169 |
| 399 | 3300039447 | Ga0436361_1079383 | Ga0436361_1079383_653_1183 | 169 |
| 400 | 3300039450 | Ga0436363_0699892 | Ga0436363_0699892_6689_7204 | 169 |
| 401 | 3300039450 | Ga0436363_0700629 | Ga0436363_0700629_487_996 | 169 |
| 402 | 3300039450 | Ga0436363_1011916 | Ga0436363_1011916_733_1263 | 169 |
| 403 | 3300041509 | Ga0451843_1323642 | Ga0451843_1323642_607_1116 | 169 |
| 404 | 3300042136 | Ga0450900_028879 | Ga0450900_028879_46_555 | 169 |
| 405 | 3300044658 | Ga0466972_0072916 | Ga0466972_0072916_625_1134 | 169 |
| 406 | 3300044735 | Ga0466968_0053024 | Ga0466968_0053024_663_1172 | 169 |
| 407 | 3300044735 | Ga0466968_0066967 | Ga0466968_0066967_587_1096 | 169 |
| 408 | 3300044901 | Ga0466960_0200173 | Ga0466960_0200173_195_704 | 169 |
| 409 | 3300044901 | Ga0466960_0391389 | Ga0466960_0391389_154_663 | 169 |
| 410 | 3300044901 | Ga0466960_0465994 | Ga0466960_0465994_144_653 | 169 |
| 411 | 3300045976 | Ga0466967_0282371 | Ga0466967_0282371_731_1246 | 169 |
| 412 | 3300046454 | Ga0495592_0538314 | Ga0495592_0538314_177_686 | 169 |
| 413 | 3300046455 | Ga0495603_0123288 | Ga0495603_0123288_895_1407 | 169 |
| 414 | 3300046460 | Ga0495638_0001760 | Ga0495638_0001760_216_725 | 169 |
| 415 | 3300046460 | Ga0495638_0361783 | Ga0495638_0361783_229_738 | 169 |
| 416 | 3300046462 | Ga0495651_0001917 | Ga0495651_0001917_4919_5428 | 169 |
| 417 | 3300046474 | Ga0495605_0148332 | Ga0495605_0148332_366_875 | 169 |
| 418 | 3300046475 | Ga0495639_0048418 | Ga0495639_0048418_828_1340 | 169 |
| 419 | 3300046477 | Ga0495664_0011217 | Ga0495664_0011217_2879_3388 | 169 |
| 420 | 3300046499 | Ga0495594_0228874 | Ga0495594_0228874_223_732 | 169 |
| 421 | 3300046506 | Ga0495583_0230360 | Ga0495583_0230360_16_525 | 169 |
| 422 | 3300046507 | Ga0495606_0375969 | Ga0495606_0375969_67_576 | 169 |
| 423 | 3300046515 | Ga0495620_0138662 | Ga0495620_0138662_38_568 | 169 |
| 424 | 3300046516 | Ga0495628_0103487 | Ga0495628_0103487_156_665 | 169 |
| 425 | 3300046522 | Ga0495643_0050420 | Ga0495643_0050420_855_1364 | 169 |
| 426 | 3300046529 | Ga0495652_0025465 | Ga0495652_0025465_3093_3602 | 169 |
| 427 | 3300046529 | Ga0495652_0514286 | Ga0495652_0514286_215_724 | 169 |
| 428 | 3300046533 | Ga0495640_0011710 | Ga0495640_0011710_4326_4835 | 169 |
| 429 | 3300046533 | Ga0495640_0376595 | Ga0495640_0376595_182_697 | 169 |
| 430 | 3300046536 | Ga0495587_0009486 | Ga0495587_0009486_2360_2869 | 169 |
| 431 | 3300046537 | Ga0495598_0314227 | Ga0495598_0314227_52_561 | 169 |
| 432 | 3300046538 | Ga0495609_0058978 | Ga0495609_0058978_947_1456 | 169 |
| 433 | 3300046543 | Ga0495645_0037519 | Ga0495645_0037519_999_1508 | 169 |
| 434 | 3300046557 | Ga0495622_0079208 | Ga0495622_0079208_303_812 | 169 |
| 435 | 3300046559 | Ga0495667_0009591 | Ga0495667_0009591_2967_3476 | 169 |
| 436 | 3300046642 | Ga0495634_0042998 | Ga0495634_0042998_2371_2880 | 169 |
| 437 | 3300046642 | Ga0495634_0065794 | Ga0495634_0065794_869_1378 | 169 |
| 438 | 3300046660 | Ga0495625_0071460 | Ga0495625_0071460_247_756 | 169 |
| 439 | 3300046663 | Ga0495635_0001881 | Ga0495635_0001881_9761_10270 | 169 |
| 440 | 3300046663 | Ga0495635_0099874 | Ga0495635_0099874_201_710 | 169 |
| 441 | 3300046665 | Ga0495661_0168011 | Ga0495661_0168011_653_1162 | 169 |
| 442 | 3300046665 | Ga0495661_0419745 | Ga0495661_0419745_88_597 | 169 |
| 443 | 3300046674 | Ga0495588_0075640 | Ga0495588_0075640_1173_1682 | 169 |
| 444 | 3300046674 | Ga0495588_0082234 | Ga0495588_0082234_1055_1567 | 169 |
| 445 | 3300046675 | Ga0495657_0004727 | Ga0495657_0004727_3126_3635 | 169 |
| 446 | 3300046678 | Ga0495599_0011007 | Ga0495599_0011007_2107_2616 | 169 |
| 447 | 3300046679 | Ga0495623_0022868 | Ga0495623_0022868_3238_3747 | 169 |
| 448 | 3300046689 | Ga0495613_0027850 | Ga0495613_0027850_3666_4175 | 169 |
| 449 | 3300046690 | Ga0495624_0022395 | Ga0495624_0022395_2866_3375 | 169 |
| 450 | 3300046809 | Ga0495600_0004439 | Ga0495600_0004439_5020_5529 | 169 |
| 451 | 3300046809 | Ga0495600_0007347 | Ga0495600_0007347_2623_3132 | 169 |
| 452 | 3300047315 | Ga0495581_0063802 | Ga0495581_0063802_385_897 | 169 |
| 453 | 3300047315 | Ga0495581_0174984 | Ga0495581_0174984_129_638 | 169 |
| 454 | 3300047317 | Ga0495604_0002141 | Ga0495604_0002141_1637_2146 | 169 |
| 455 | 3300047317 | Ga0495604_0026793 | Ga0495604_0026793_92_601 | 169 |
| 456 | 3300047319 | Ga0495674_0018376 | Ga0495674_0018376_2905_3414 | 169 |
| 457 | 3300047321 | Ga0495676_0049909 | Ga0495676_0049909_878_1390 | 169 |
| 458 | 3300047322 | Ga0495680_0019780 | Ga0495680_0019780_2196_2705 | 169 |
| 459 | 3300047323 | Ga0495683_0244379 | Ga0495683_0244379_206_715 | 169 |
| 460 | 3300047444 | Ga0495675_0027393 | Ga0495675_0027393_3109_3618 | 169 |
| 461 | 3300047472 | Ga0495686_0020180 | Ga0495686_0020180_252_761 | 169 |
| 462 | 3300047472 | Ga0495686_0634721 | Ga0495686_0634721_22_531 | 169 |
| 463 | 3300048088 | Ga0495602_0074836 | Ga0495602_0074836_2277_2786 | 169 |
| 464 | 3300048903 | Ga0496100_0134242 | Ga0496100_0134242_731_1243 | 169 |
| 465 | 3300048903 | Ga0496100_0152731 | Ga0496100_0152731_411_926 | 169 |
| 466 | 3300048903 | Ga0496100_0494916 | Ga0496100_0494916_320_829 | 169 |
| 467 | 3300048904 | Ga0496101_0131222 | Ga0496101_0131222_1243_1758 | 169 |
| 468 | 3300048904 | Ga0496101_0272801 | Ga0496101_0272801_669_1181 | 169 |
| 469 | 3300048904 | Ga0496101_0428910 | Ga0496101_0428910_313_822 | 169 |
| 470 | 3300048904 | Ga0496101_0667172 | Ga0496101_0667172_149_658 | 169 |
| 471 | 3300048905 | Ga0496102_0070802 | Ga0496102_0070802_1203_1715 | 169 |
| 472 | 3300048907 | Ga0496104_0006361 | Ga0496104_0006361_6528_7037 | 169 |
| 473 | 3300048907 | Ga0496104_0021759 | Ga0496104_0021759_5231_5743 | 169 |
| 474 | 3300048907 | Ga0496104_0022524 | Ga0496104_0022524_2999_3514 | 169 |
| 475 | 3300048907 | Ga0496104_0361991 | Ga0496104_0361991_593_1105 | 169 |
| 476 | 3300048907 | Ga0496104_0398200 | Ga0496104_0398200_141_653 | 169 |
| 477 | 3300048907 | Ga0496104_0632394 | Ga0496104_0632394_298_807 | 169 |
| 478 | 3300048908 | Ga0496105_0005021 | Ga0496105_0005021_4942_5451 | 169 |
| 479 | 3300048908 | Ga0496105_0147028 | Ga0496105_0147028_541_1140 | 169 |
| 480 | 3300048908 | Ga0496105_0191474 | Ga0496105_0191474_112_624 | 169 |
| 481 | 3300048909 | Ga0496106_0059587 | Ga0496106_0059587_1421_1930 | 169 |
| 482 | 3300048909 | Ga0496106_0230376 | Ga0496106_0230376_438_947 | 169 |
| 483 | 3300048909 | Ga0496106_0549762 | Ga0496106_0549762_118_630 | 169 |
| 484 | 3300048910 | Ga0496107_0173502 | Ga0496107_0173502_920_1435 | 169 |
| 485 | 3300048910 | Ga0496107_0354899 | Ga0496107_0354899_565_1077 | 169 |
| 486 | 3300048911 | Ga0496108_0010916 | Ga0496108_0010916_3314_3826 | 169 |
| 487 | 3300048911 | Ga0496108_0071778 | Ga0496108_0071778_1925_2434 | 169 |
| 488 | 3300048911 | Ga0496108_0573538 | Ga0496108_0573538_108_629 | 169 |
| 489 | 3300048911 | Ga0496108_0588931 | Ga0496108_0588931_74_583 | 169 |
| 490 | 3300048911 | Ga0496108_0780298 | Ga0496108_0780298_147_659 | 169 |
| 491 | 3300048912 | Ga0496109_0001443 | Ga0496109_0001443_2562_3074 | 169 |
| 492 | 3300048913 | Ga0496110_0024131 | Ga0496110_0024131_1217_1729 | 169 |
| 493 | 3300048913 | Ga0496110_0228404 | Ga0496110_0228404_1055_1567 | 169 |
| 494 | 3300048913 | Ga0496110_0419356 | Ga0496110_0419356_648_1163 | 169 |
| 495 | 3300048913 | Ga0496110_1133173 | Ga0496110_1133173_126_647 | 169 |
| 496 | 3300048914 | Ga0496111_0436011 | Ga0496111_0436011_143_655 | 169 |
| 497 | 3300048915 | Ga0496112_0001558 | Ga0496112_0001558_13013_13525 | 169 |
| 498 | 3300048915 | Ga0496112_1010461 | Ga0496112_1010461_107_619 | 169 |
| 499 | 3300048916 | Ga0496113_0001483 | Ga0496113_0001483_9222_9734 | 169 |
| 500 | 3300048916 | Ga0496113_0010571 | Ga0496113_0010571_2593_3102 | 169 |
| 501 | 3300048916 | Ga0496113_0280507 | Ga0496113_0280507_305_814 | 169 |
| 502 | 3300048917 | Ga0496114_0000290 | Ga0496114_0000290_11058_11567 | 169 |
| 503 | 3300048917 | Ga0496114_0440600 | Ga0496114_0440600_362_871 | 169 |
| 504 | 3300048917 | Ga0496114_0949437 | Ga0496114_0949437_145_654 | 169 |
| 505 | 3300048918 | Ga0496115_0003155 | Ga0496115_0003155_3039_3551 | 169 |
| 506 | 3300048918 | Ga0496115_0019865 | Ga0496115_0019865_1007_1516 | 169 |
| 507 | 3300048918 | Ga0496115_0057623 | Ga0496115_0057623_703_1218 | 169 |
| 508 | 3300048918 | Ga0496115_0639186 | Ga0496115_0639186_77_589 | 169 |
| 509 | 3300048919 | Ga0496116_0273267 | Ga0496116_0273267_151_666 | 169 |
| 510 | 3300048920 | Ga0496117_0235143 | Ga0496117_0235143_345_860 | 169 |
| 511 | 3300048921 | Ga0496118_0175217 | Ga0496118_0175217_484_999 | 169 |
| 512 | 3300048922 | Ga0496119_0022738 | Ga0496119_0022738_3329_3838 | 169 |
| 513 | 3300048923 | Ga0496120_0036896 | Ga0496120_0036896_1875_2384 | 169 |
| 514 | 3300048924 | Ga0496121_0051244 | Ga0496121_0051244_2337_2846 | 169 |
| 515 | 3300048925 | Ga0496122_0007615 | Ga0496122_0007615_6288_6803 | 169 |
| 516 | 3300048925 | Ga0496122_0100923 | Ga0496122_0100923_1059_1568 | 169 |
| 517 | 3300048925 | Ga0496122_0278299 | Ga0496122_0278299_84_593 | 169 |
| 518 | 3300048926 | Ga0496123_0055689 | Ga0496123_0055689_1572_2087 | 169 |
| 519 | 3300048927 | Ga0496124_0082577 | Ga0496124_0082577_2018_2533 | 169 |
| 520 | 3300048927 | Ga0496124_0087867 | Ga0496124_0087867_619_1128 | 169 |
| 521 | 3300048928 | Ga0496125_0082641 | Ga0496125_0082641_705_1214 | 169 |
| 522 | 3300048928 | Ga0496125_0105615 | Ga0496125_0105615_110_619 | 169 |
| 523 | 3300048929 | Ga0496126_0031654 | Ga0496126_0031654_3116_3625 | 169 |
| 524 | 3300048929 | Ga0496126_0111250 | Ga0496126_0111250_66_575 | 169 |
| 525 | 3300048929 | Ga0496126_0302353 | Ga0496126_0302353_672_1181 | 169 |
| 526 | 3300048929 | Ga0496126_0853138 | Ga0496126_0853138_61_570 | 169 |
| 527 | 3300049573 | Ga0501037_0022439 | Ga0501037_0022439_1670_2197 | 169 |
| 528 | 3300049592 | Ga0501076_0154250 | Ga0501076_0154250_289_798 | 169 |
| 529 | 3300049823 | Ga0501044_0642380 | Ga0501044_0642380_408_935 | 169 |
| 530 | 3300050490 | nmdc:mga03n38_249516_c1 | nmdc:mga03n38_249516_c1_380_895 | 169 |
| 531 | 3300050491 | nmdc:mga00v17_27926_c1 | nmdc:mga00v17_27926_c1_751_1260 | 169 |
| 532 | 3300050491 | nmdc:mga00v17_349596_c1 | nmdc:mga00v17_349596_c1_235_744 | 169 |
| 533 | 3300050492 | nmdc:mga0yw44_147163_c1 | nmdc:mga0yw44_147163_c1_790_1305 | 169 |
| 534 | 3300050492 | nmdc:mga0yw44_26350_c1 | nmdc:mga0yw44_26350_c1_2762_3271 | 169 |
| 535 | 3300050492 | nmdc:mga0yw44_44148_c1 | nmdc:mga0yw44_44148_c1_483_992 | 169 |
| 536 | 3300050496 | nmdc:mga07m45_53861_c1 | nmdc:mga07m45_53861_c1_1633_2142 | 169 |
| 537 | 3300050496 | nmdc:mga07m45_78980_c1 | nmdc:mga07m45_78980_c1_206_715 | 169 |
| 538 | 3300050511 | nmdc:mga08y16_66783_c1 | nmdc:mga08y16_66783_c1_1913_2422 | 169 |
| 539 | 3300050512 | nmdc:mga0n895_18008_c1 | nmdc:mga0n895_18008_c1_4142_4660 | 169 |
| 540 | 3300050514 | nmdc:mga08x19_95333_c1 | nmdc:mga08x19_95333_c1_224_742 | 169 |
| 541 | 3300050516 | nmdc:mga0sz30_102683_c1 | nmdc:mga0sz30_102683_c1_701_1210 | 169 |
| 542 | 3300050516 | nmdc:mga0sz30_135110_c1 | nmdc:mga0sz30_135110_c1_133_642 | 169 |
| 543 | 3300050516 | nmdc:mga0sz30_44043_c1 | nmdc:mga0sz30_44043_c1_637_1146 | 169 |
| 544 | 3300050516 | nmdc:mga0sz30_86805_c1 | nmdc:mga0sz30_86805_c1_417_929 | 169 |
| 545 | 3300053079 | Ga0500610_0142079 | Ga0500610_0142079_599_1108 | 169 |
| 546 | 3300053086 | Ga0500578_0087490 | Ga0500578_0087490_1277_1786 | 169 |
| 547 | 3300053087 | Ga0500643_000163 | Ga0500643_000163_33930_34439 | 169 |
| 548 | 3300053088 | Ga0500644_0225983 | Ga0500644_0225983_149_658 | 169 |
| 549 | 3300053090 | Ga0500646_0026278 | Ga0500646_0026278_405_914 | 169 |
| 550 | 3300053093 | Ga0500651_0413484 | Ga0500651_0413484_117_626 | 169 |
| 551 | 3300053094 | Ga0500566_0000224 | Ga0500566_0000224_158_667 | 169 |
| 552 | 3300053094 | Ga0500566_0096883 | Ga0500566_0096883_860_1369 | 169 |
| 553 | 3300053096 | Ga0500641_0002734 | Ga0500641_0002734_1829_2338 | 169 |
| 554 | 3300053096 | Ga0500641_0016388 | Ga0500641_0016388_122_631 | 169 |
| 555 | 3300053098 | Ga0500650_0045589 | Ga0500650_0045589_195_704 | 169 |
| 556 | 3300053098 | Ga0500650_0112302 | Ga0500650_0112302_373_882 | 169 |
| 557 | 3300053098 | Ga0500650_0118657 | Ga0500650_0118657_551_1060 | 169 |
| 558 | 3300053102 | Ga0500554_053541 | Ga0500554_053541_733_1242 | 169 |
| 559 | 3300053103 | Ga0500555_001084 | Ga0500555_001084_4589_5098 | 169 |
| 560 | 3300053104 | Ga0500556_0027049 | Ga0500556_0027049_814_1323 | 169 |
| 561 | 3300053108 | Ga0500562_110308 | Ga0500562_110308_42_596 | 169 |
| 562 | 3300053109 | Ga0500569_164298 | Ga0500569_164298_96_605 | 169 |
| 563 | 3300053111 | Ga0500572_042735 | Ga0500572_042735_80_589 | 169 |
| 564 | 3300053118 | Ga0500594_0036703 | Ga0500594_0036703_520_1029 | 169 |
| 565 | 3300053119 | Ga0500595_005537 | Ga0500595_005537_4054_4563 | 169 |
| 566 | 3300053119 | Ga0500595_040507 | Ga0500595_040507_446_955 | 169 |
| 567 | 3300053122 | Ga0500608_046197 | Ga0500608_046197_1288_1797 | 169 |
| 568 | 3300053130 | Ga0500642_0007538 | Ga0500642_0007538_2120_2629 | 169 |
| 569 | 3300053130 | Ga0500642_0008075 | Ga0500642_0008075_2315_2824 | 169 |
| 570 | 3300053136 | Ga0500559_0063420 | Ga0500559_0063420_924_1433 | 169 |
| 571 | 3300053138 | Ga0500564_034892 | Ga0500564_034892_25_534 | 169 |
| 572 | 3300053139 | Ga0500568_0053420 | Ga0500568_0053420_887_1396 | 169 |
| 573 | 3300053142 | Ga0500577_0206153 | Ga0500577_0206153_52_561 | 169 |
| 574 | 3300053146 | Ga0500588_0001796 | Ga0500588_0001796_177_686 | 169 |
| 575 | 3300053146 | Ga0500588_0008929 | Ga0500588_0008929_1253_1762 | 169 |
| 576 | 3300053146 | Ga0500588_0021991 | Ga0500588_0021991_761_1270 | 169 |
| 577 | 3300053148 | Ga0500590_107781 | Ga0500590_107781_440_949 | 169 |
| 578 | 3300053151 | Ga0500604_0003195 | Ga0500604_0003195_720_1229 | 169 |
| 579 | 3300053151 | Ga0500604_0045994 | Ga0500604_0045994_802_1311 | 169 |
| 580 | 3300053153 | Ga0500616_0000705 | Ga0500616_0000705_19537_20046 | 169 |
| 581 | 3300053153 | Ga0500616_0060070 | Ga0500616_0060070_1329_1838 | 169 |
| 582 | 3300053154 | Ga0500619_056515 | Ga0500619_056515_584_1093 | 169 |
| 583 | 3300053156 | Ga0500622_0022826 | Ga0500622_0022826_1797_2306 | 169 |
| 584 | 3300053157 | Ga0500624_074124 | Ga0500624_074124_142_651 | 169 |
| 585 | 3300053160 | Ga0500633_0062579 | Ga0500633_0062579_480_989 | 169 |
| 586 | 3300053177 | Ga0500636_0000330 | Ga0500636_0000330_24183_24692 | 169 |
| 587 | 3300053177 | Ga0500636_0002418 | Ga0500636_0002418_3181_3801 | 169 |
| 588 | 3300053731 | Ga0500609_000476 | Ga0500609_000476_1573_2082 | 169 |
| 589 | 3300053731 | Ga0500609_001275 | Ga0500609_001275_1612_2121 | 169 |
| 590 | 3300053731 | Ga0500609_011550 | Ga0500609_011550_280_789 | 169 |
| 591 | 3300053736 | Ga0500599_012579 | Ga0500599_012579_321_830 | 169 |
| 592 | 3300053737 | Ga0500601_001460 | Ga0500601_001460_167_676 | 169 |
| 593 | iso_pu_bacteria | 3003665799 | 3003666943 | 169 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ml8-assembly1.cif.gz_A-2 | structural genomics | 0.8668 | 62 | 157 |
| 1nye-assembly2.cif.gz_D | crystal structure of osmc from e. coli | 0.8655 | 64 | 155 |
| 1nye-assembly2.cif.gz_C | crystal structure of osmc from e. coli | 0.7887 | 63 | 161 |
| 1lql-assembly4.cif.gz_G | crystal structure of osmc like protein from mycoplasma pneumoniae | 0.7649 | 25 | 157 |
| 1ukk-assembly1.cif.gz_B | structure of osmotically inducible protein c from thermus thermophilus | 0.7593 | 61 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1lqlE02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9352 | 69 | 157 | 3.30.300.20 |
| 1ml8A02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8665 | 69 | 157 | 3.30.300.20 |
| 6mjnB02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8153 | 68 | 159 | 3.30.300.20 |
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8115 | 61 | 155 | 3.30.300.20 |
| af_Q57993_77_188_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.797 | 45 | 155 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6HIQ5-F1-model_v4 | Peroxiredoxin | 0.9926 | 1 | 169 |
|
| AF-A0A4P5WPR6-F1-model_v4 | Peroxiredoxin | 0.9888 | 65 | 168 |
|
| AF-A0A440JM30-F1-model_v4 | deleted | 0.9883 | 50 | 168 |
|
| AF-A0A4Q0QJ12-F1-model_v4 | OsmC family peroxiredoxin | 0.9876 | 1 | 169 |
|
| AF-A0A395KC67-F1-model_v4 | deleted | 0.987 | 1 | 168 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar