F467282

General Info

Members Datasets Scaffolds Average Seq Length
593 419 473 169

Family's Representative Sequence

Representative Sequence 3300053177|Ga0500636_0002418|Ga0500636_0002418_3181_3801
Length 206
Sequence LPKRKTGTRFFAQCSGLIRSAALSATGIVACPKKVETMDVTALRALQAPLKDQYRETPDAAVITLKARGELDDQHIACKVETGRAIALAGLHPATGGSGAELCSGDMLLEALVACAGVTLKAVATALEIELKKGTVRAEGDLDFRGTLGVAKDAPVGFKAIRLSFDVETDAPQEKLDTLLKLTERYCVVFQTLNVKPQLSAELRQA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
7 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
8 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
9 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
10 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
11 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
12 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
13 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
14 2643221733 Bosea sp. Root381 Isolate Unclassified
15 2643221734 Bosea sp. Root670 Isolate Unclassified
16 2643221736 Bosea sp. Root483D1 Isolate Unclassified
17 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
18 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
19 2773857925 Microvirga vignae BR3299 Isolate Unclassified
20 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
21 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
22 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
23 2818991467 Bosea vestrisii 3192 Isolate Unclassified
24 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
25 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
26 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
27 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
28 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
29 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
30 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
31 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
32 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
33 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
34 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
35 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
36 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
37 2841760612 Bosea sp. Tri-49 Isolate Nodule
38 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
39 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
40 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
41 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
42 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
43 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
44 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
45 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
46 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
47 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
48 2844104063 Bosea sp. Tri-39 Isolate Nodule
49 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
50 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
51 2851182111 Bosea sp. Tri-44 Isolate Nodule
52 2851246043 Bosea sp. Tri-54 Isolate Nodule
53 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
54 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
55 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
56 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
57 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
58 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
59 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
60 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
61 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
62 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
63 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
64 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
65 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
66 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
67 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
68 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
69 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
70 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
71 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
72 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
73 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
74 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
75 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
76 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
77 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
78 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
79 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
80 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
81 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
82 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
83 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
84 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
85 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
86 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
87 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
88 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
89 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
90 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
91 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
92 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
93 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
94 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
95 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
96 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
97 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
98 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
99 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
100 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
101 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
102 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
103 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
104 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
105 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
106 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
107 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
108 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
109 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
110 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
111 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
112 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
113 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
114 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
115 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
116 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
117 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
118 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
119 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
120 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
121 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
122 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
123 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
124 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
125 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
126 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
127 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
128 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
129 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
130 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
131 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
132 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
133 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
134 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
135 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
136 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
137 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
138 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
139 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
140 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
141 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
142 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
143 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
144 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
145 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
146 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
147 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
148 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
149 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
150 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
151 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
152 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
153 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
154 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
155 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
156 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
157 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
158 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
159 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
160 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
161 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
162 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
163 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
164 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
165 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
166 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
167 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
168 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
169 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
170 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
171 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
172 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
173 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
174 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
175 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
176 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
177 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
178 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
179 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
180 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
181 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
182 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
183 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
184 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
185 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
186 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
187 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
188 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
189 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
190 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
191 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
192 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
194 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
195 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
196 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
197 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
198 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
199 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
200 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
201 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
203 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
205 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
207 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
209 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
210 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
246 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
247 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
248 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
252 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
253 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
254 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
255 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
256 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
257 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
258 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
259 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
262 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
263 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
264 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
265 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
266 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
267 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
273 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
274 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
277 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
278 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
279 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
280 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
281 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
282 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
283 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
289 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
290 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
291 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
292 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
293 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
294 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
295 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
296 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
297 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
300 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
301 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
302 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
307 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
308 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
309 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
313 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
314 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
315 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
316 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
317 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
318 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
319 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
323 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
324 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
330 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
331 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
332 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
333 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
334 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
335 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
336 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
337 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
338 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
339 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
340 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
341 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
342 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
343 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
344 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
345 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
346 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
347 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
348 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
349 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
350 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
351 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
352 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
362 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
365 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
366 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
367 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
368 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
369 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
370 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
371 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
372 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
373 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
374 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
375 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
376 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
377 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
378 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
379 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
380 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
381 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
382 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
383 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
384 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
385 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
386 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
387 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
388 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
389 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
390 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
391 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
392 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
393 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
394 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
395 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
396 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
397 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
398 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
399 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
400 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
401 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
402 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
403 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
404 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
405 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
406 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
407 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
408 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
409 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
410 641522639 Methylobacterium sp. 4-46 Isolate Nodule
411 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
412 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
413 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
414 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
415 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
416 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
417 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
418 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
419 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.43
Metatranscriptomes 0.34
Isolates 20.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.55
Nodule 15.01
Rhizoplane 7.93
Rhizosphere 45.36
Stem 0
Stem Tuber 0
Unclassified 13.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1021976 3300002987 Bacteria 1190
2 JGI25151J46595_10000021 3300003187 Bacteria 227826
3 JGI25153J46596_10000133 3300003215 Bacteria 79398
4 JGI25153J46596_10001375 3300003215 Bacteria 14553
5 JGI25153J46596_10015196 3300003215 Bacteria 3152
6 JGI25160J50197_1001189 3300003354 Bacteria 13266
7 Ga0055526_1001254 3300003771 Bacteria 18211
8 Ga0055526_1001771 3300003771 Bacteria 14997
9 Ga0055524_1000011 3300003775 Bacteria 261442
10 Ga0065165_1000150 3300005262 Bacteria 121992
11 Ga0065165_1053766 3300005262 Bacteria 1132
12 Ga0070658_10811070 3300005327 Bacteria 813
13 Ga0070670_100075398 3300005331 Bacteria 2898
14 Ga0068868_100003650 3300005338 Bacteria 10741
15 Ga0070660_100492174 3300005339 Bacteria 1020
16 Ga0070689_100000018 3300005340 Bacteria 153256
17 Ga0070668_100464360 3300005347 Bacteria 1091
18 Ga0070668_100516691 3300005347 Bacteria 1036
19 Ga0070675_100083801 3300005354 Bacteria 2662
20 Ga0070675_100128215 3300005354 Bacteria 2160
21 Ga0070675_100298987 3300005354 Bacteria 1418
22 Ga0070675_100299578 3300005354 Bacteria 1416
23 Ga0070671_100015653 3300005355 Bacteria 6129
24 Ga0070671_100141019 3300005355 Unclassified 2034
25 Ga0070673_100090930 3300005364 Bacteria 2494
26 Ga0070688_100122177 3300005365 Bacteria 1746
27 Ga0070659_100994064 3300005366 Bacteria 736
28 Ga0070709_10018422 3300005434 Bacteria 4021
29 Ga0070714_100017599 3300005435 Bacteria 5792
30 Ga0070713_100018232 3300005436 Bacteria 5333
31 Ga0070713_100251505 3300005436 Bacteria 1612
32 Ga0070710_10083796 3300005437 Unclassified 1867
33 Ga0070705_100417546 3300005440 Bacteria 998
34 Ga0070700_100812870 3300005441 Bacteria 754
35 Ga0070694_100728250 3300005444 Bacteria 808
36 Ga0070663_100096378 3300005455 Bacteria 2200
37 Ga0070663_100234570 3300005455 Bacteria 1446
38 Ga0070678_100745913 3300005456 Bacteria 885
39 Ga0070678_101010449 3300005456 Bacteria 765
40 Ga0068867_100044224 3300005459 Bacteria 3262
41 Ga0068867_101540674 3300005459 Bacteria 620
42 Ga0070685_10013703 3300005466 Bacteria 4283
43 Ga0070684_100273139 3300005535 Bacteria 1548
44 Ga0070684_100424240 3300005535 Bacteria 1228
45 Ga0070672_100216621 3300005543 Bacteria 1605
46 Ga0070672_100416870 3300005543 Bacteria 1153
47 Ga0070686_100030101 3300005544 Bacteria 3308
48 Ga0070696_100008909 3300005546 Bacteria 6717
49 Ga0070693_100624624 3300005547 Bacteria 781
50 Ga0070665_100027310 3300005548 Bacteria 5749
51 Ga0070704_100024848 3300005549 Bacteria 3936
52 Ga0068856_100227664 3300005614 Bacteria 1880
53 Ga0068856_100294832 3300005614 Unclassified 1639
54 Ga0070702_100141784 3300005615 Bacteria 1531
55 Ga0068852_100076609 3300005616 Bacteria 2953
56 Ga0068859_100362045 3300005617 Bacteria 1545
57 Ga0068864_101191853 3300005618 Bacteria 760
58 Ga0068866_10209299 3300005718 Bacteria 1170
59 Ga0068863_100407461 3300005841 Bacteria 1331
60 Ga0068863_101461066 3300005841 Bacteria 692
61 Ga0068858_101139955 3300005842 Bacteria 766
62 Ga0068860_100400687 3300005843 Bacteria 1357
63 Ga0068860_100926396 3300005843 Bacteria 888
64 Ga0068862_100004007 3300005844 Bacteria 12490
65 Ga0068862_100365703 3300005844 Bacteria 1341
66 Ga0081455_10043443 3300005937 Bacteria 3930
67 Ga0081455_10124402 3300005937 Bacteria 2026
68 Ga0081540_1081219 3300005983 Bacteria 1459
69 Ga0070717_10005153 3300006028 Bacteria 9528
70 Ga0075365_10017968 3300006038 Bacteria 4339
71 Ga0075365_10027319 3300006038 Bacteria 3630
72 Ga0075365_10164656 3300006038 Bacteria 1546
73 Ga0075365_10405718 3300006038 Bacteria 962
74 Ga0075365_11004602 3300006038 Bacteria 588
75 Ga0075368_10318850 3300006042 Bacteria 673
76 Ga0075364_10133114 3300006051 Bacteria 1669
77 Ga0075364_10490732 3300006051 Bacteria 840
78 Ga0070716_100121943 3300006173 Unclassified 1633
79 Ga0070716_100231711 3300006173 Bacteria 1247
80 Ga0075362_10257900 3300006177 Bacteria 858
81 Ga0075369_10061400 3300006186 Bacteria 1640
82 Ga0075369_10077135 3300006186 Bacteria 1474
83 Ga0075366_10054826 3300006195 Bacteria 2367
84 Ga0075366_10091254 3300006195 Bacteria 1825
85 Ga0097621_100085078 3300006237 Bacteria 2637
86 Ga0097621_100335347 3300006237 Bacteria 1342
87 Ga0075370_10052635 3300006353 Bacteria 2310
88 Ga0075370_10247437 3300006353 Bacteria 1056
89 Ga0068871_100021632 3300006358 Bacteria 4947
90 Ga0075434_100011878 3300006871 Bacteria 8233
91 Ga0075434_100339422 3300006871 Bacteria 1523
92 Ga0097620_100362038 3300006931 Bacteria 1545
93 Ga0099823_1013263 3300006944 Bacteria 8300
94 Ga0105240_10009401 3300009093 Bacteria 13842
95 Ga0105240_10076360 3300009093 Bacteria 4130
96 Ga0105240_10077368 3300009093 Bacteria 4098
97 Ga0105240_10430678 3300009093 Bacteria 1480
98 Ga0105240_10670205 3300009093 Bacteria 1135
99 Ga0105247_10160516 3300009101 Bacteria 1488
100 Ga0105247_10786876 3300009101 Bacteria 724
101 Ga0105241_10131101 3300009174 Bacteria 2030
102 Ga0105241_10187922 3300009174 Bacteria 1718
103 Ga0105248_10806788 3300009177 Bacteria 1059
104 Ga0105237_10133511 3300009545 Bacteria 2477
105 Ga0105249_10014538 3300009553 Bacteria 6958
106 Ga0105249_10914868 3300009553 Bacteria 944
107 Ga0105239_10079271 3300010375 Bacteria 3614
108 Ga0105239_10367297 3300010375 Bacteria 1626
109 Ga0157314_1014240 3300012500 Bacteria 738
110 Ga0171462_1015 3300013250 Bacteria 169578
111 Ga0157374_10203265 3300013296 Bacteria 1940
112 Ga0157374_10848455 3300013296 Bacteria 930
113 Ga0157378_10274569 3300013297 Bacteria 1622
114 Ga0163162_10927960 3300013306 Bacteria 982
115 Ga0157372_11862187 3300013307 Bacteria 692
116 Ga0157375_12225208 3300013308 Bacteria 653
117 Ga0163163_10004923 3300014325 Bacteria 11488
118 Ga0163163_10047869 3300014325 Bacteria 4203
119 Ga0163163_10308330 3300014325 Bacteria 1635
120 Ga0163163_10733616 3300014325 Bacteria 1051
121 Ga0157380_10019928 3300014326 Bacteria 5005
122 Ga0182008_10534830 3300014497 Bacteria 649
123 Ga0157379_10170305 3300014968 Bacteria 1966
124 Ga0157379_10252918 3300014968 Bacteria 1600
125 Ga0163161_10552857 3300017792 Bacteria 944
126 Ga0163161_11383257 3300017792 Bacteria 614
127 Ga0206354_10108602 3300020081 Bacteria 1158
128 Ga0206354_10359821 3300020081 Bacteria 631
129 Ga0214544_1000003 3300021320 Bacteria 643752
130 Ga0214542_1000003 3300021321 Bacteria 435700
131 Ga0214545_1000004 3300021324 Bacteria 453352
132 Ga0214543_1000007 3300021327 Bacteria 414744
133 Ga0213874_10002498 3300021377 Bacteria 3969
134 Ga0213876_10007769 3300021384 Bacteria 5821
135 Ga0213876_10009062 3300021384 Bacteria 5359
136 Ga0213876_10029125 3300021384 Bacteria 2911
137 Ga0213875_10021992 3300021388 Bacteria 3052
138 Ga0213875_10076933 3300021388 Bacteria 1557
139 Ga0213875_10377973 3300021388 Bacteria 674
140 Ga0209233_1021879 3300025261 Bacteria 1646
141 Ga0209673_1049107 3300025273 Bacteria 1130
142 Ga0209130_1000187 3300025284 Bacteria 87082
143 Ga0209675_1005741 3300025291 Bacteria 5121
144 Ga0209025_1000010 3300025294 Bacteria 986612
145 Ga0209025_1003913 3300025294 Bacteria 13420
146 Ga0209025_1062867 3300025294 Bacteria 1374
147 Ga0209025_1070283 3300025294 Bacteria 1247
148 Ga0209564_1000019 3300025295 Bacteria 573686
149 Ga0209564_1000369 3300025295 Bacteria 83878
150 Ga0209758_1000005 3300025297 Bacteria 1368918
151 Ga0209758_1002632 3300025297 Bacteria 17829
152 Ga0209758_1016086 3300025297 Bacteria 3822
153 Ga0209758_1039208 3300025297 Bacteria 1804
154 Ga0209758_1078121 3300025297 Bacteria 1012
155 Ga0209050_1019524 3300025298 Bacteria 2569
156 Ga0209050_1064198 3300025298 Bacteria 852
157 Ga0209256_1000317 3300025299 Bacteria 83179
158 Ga0209256_1050348 3300025299 Bacteria 1010
159 Ga0207426_1000201 3300025302 Bacteria 143975
160 Ga0207426_1011144 3300025302 Bacteria 3444
161 Ga0207426_1018295 3300025302 Bacteria 2472
162 Ga0209257_1000391 3300025304 Bacteria 87258
163 Ga0209257_1065298 3300025304 Bacteria 976
164 Ga0207692_10081313 3300025898 Unclassified 1733
165 Ga0207692_10628966 3300025898 Bacteria 692
166 Ga0207680_10198228 3300025903 Bacteria 1367
167 Ga0207699_10115358 3300025906 Unclassified 1728
168 Ga0207654_10044547 3300025911 Bacteria 2521
169 Ga0207695_10000065 3300025913 Bacteria 336949
170 Ga0207695_10055253 3300025913 Bacteria 4139
171 Ga0207695_10414864 3300025913 Bacteria 1231
172 Ga0207671_10017405 3300025914 Bacteria 5543
173 Ga0207662_10112981 3300025918 Bacteria 1695
174 Ga0207657_10185324 3300025919 Bacteria 1681
175 Ga0207652_10104076 3300025921 Bacteria 2510
176 Ga0207650_10095627 3300025925 Bacteria 2277
177 Ga0207650_10836010 3300025925 Bacteria 781
178 Ga0207659_10159977 3300025926 Bacteria 1767
179 Ga0207659_10263559 3300025926 Bacteria 1403
180 Ga0207700_10040741 3300025928 Bacteria 3392
181 Ga0207664_10028898 3300025929 Bacteria 4218
182 Ga0207644_10052406 3300025931 Bacteria 2932
183 Ga0207644_10538122 3300025931 Unclassified 966
184 Ga0207644_10656374 3300025931 Bacteria 873
185 Ga0207706_10237822 3300025933 Bacteria 1592
186 Ga0207670_10000001 3300025936 Bacteria 949312
187 Ga0207670_10026049 3300025936 Bacteria 3681
188 Ga0207665_10136391 3300025939 Unclassified 1746
189 Ga0207665_10405791 3300025939 Bacteria 1038
190 Ga0207691_10005607 3300025940 Bacteria 12133
191 Ga0207691_10129493 3300025940 Bacteria 2230
192 Ga0207679_11454512 3300025945 Bacteria 629
193 Ga0207667_10753042 3300025949 Bacteria 973
194 Ga0207651_10000751 3300025960 Bacteria 13926
195 Ga0207651_10121773 3300025960 Bacteria 1980
196 Ga0207651_10212262 3300025960 Bacteria 1559
197 Ga0207712_10007361 3300025961 Bacteria 6949
198 Ga0207712_11364006 3300025961 Bacteria 634
199 Ga0207668_10411807 3300025972 Bacteria 1145
200 Ga0207668_11362324 3300025972 Bacteria 639
201 Ga0207640_10813913 3300025981 Bacteria 810
202 Ga0207658_10039079 3300025986 Bacteria 3423
203 Ga0207677_10004986 3300026023 Bacteria 7167
204 Ga0207678_10744374 3300026067 Bacteria 864
205 Ga0207708_10244255 3300026075 Bacteria 1445
206 Ga0207708_10409273 3300026075 Bacteria 1123
207 Ga0207708_11100282 3300026075 Bacteria 693
208 Ga0207702_10250907 3300026078 Bacteria 1662
209 Ga0207702_10490535 3300026078 Bacteria 1197
210 Ga0207641_11541881 3300026088 Bacteria 666
211 Ga0207648_10031123 3300026089 Bacteria 4719
212 Ga0207648_10316570 3300026089 Bacteria 1402
213 Ga0207648_11460127 3300026089 Bacteria 643
214 Ga0207676_10167880 3300026095 Bacteria 1909
215 Ga0207683_10054965 3300026121 Bacteria 3491
216 Ga0207683_10246280 3300026121 Bacteria 1631
217 Ga0207698_10104979 3300026142 Bacteria 2353
218 Ga0209389_1010635 3300027296 Bacteria 8306
219 Ga0209489_112010 3300027361 Bacteria 8306
220 Ga0209700_110939 3300027363 Bacteria 8919
221 Ga0207428_10035875 3300027907 Bacteria 4050
222 Ga0268266_10006781 3300028379 Bacteria 10439
223 Ga0268265_11749033 3300028380 Bacteria 628
224 Ga0265318_10067478 3300028577 Bacteria 1328
225 Ga0307515_10178960 3300028794 Bacteria 2079
226 Ga0265320_10269587 3300031240 Bacteria 754
227 Ga0307513_10036871 3300031456 Bacteria 5447
228 Ga0307513_10129247 3300031456 Bacteria 2475
229 Ga0307408_100052585 3300031548 Bacteria 2938
230 Ga0307408_100225750 3300031548 Bacteria 1531
231 Ga0307508_10082799 3300031616 Bacteria 2791
232 Ga0307406_10141603 3300031901 Bacteria 1703
233 Ga0307406_10324944 3300031901 Bacteria 1192
234 Ga0307412_10212845 3300031911 Bacteria 1476
235 Ga0307409_101744072 3300031995 Bacteria 651
236 Ga0307416_100878294 3300032002 Bacteria 996
237 Ga0307416_102132942 3300032002 Bacteria 662
238 Ga0307415_100643481 3300032126 Bacteria 949
239 Ga0307415_101320184 3300032126 Bacteria 684
240 Ga0307510_10016772 3300033180 Bacteria 8640
241 Ga0307510_10070055 3300033180 Bacteria 3506
242 Ga0373957_0079320 3300035120 Bacteria 1294
243 Ga0373946_0030522 3300035171 Bacteria 2152
244 Ga0373955_0110620 3300035172 Bacteria 1588
245 Ga0373931_0472589 3300035691 Bacteria 805
246 Ga0373933_0120135 3300035724 Bacteria 1645
247 Ga0373933_0526077 3300035724 Bacteria 775
248 Ga0373937_0197415 3300036401 Bacteria 1891
249 Ga0373925_0268148 3300037068 Bacteria 1373
250 Ga0373925_0898809 3300037068 Bacteria 730
251 Ga0395898_1118688 3300037466 Bacteria 720
252 Ga0395905_0081569 3300037471 Bacteria 3031
253 Ga0436364_0197909 3300037853 Bacteria 872
254 Ga0436364_0497276 3300037853 Bacteria 1333
255 Ga0436364_0532601 3300037853 Bacteria 664
256 Ga0436364_1099918 3300037853 Bacteria 3218
257 Ga0237819_26476 3300038705 Bacteria 540
258 Ga0237816_00722 3300039145 Bacteria 2784
259 Ga0436365_0088001 3300039437 Bacteria 1551
260 Ga0436365_0277390 3300039437 Bacteria 3720
261 Ga0436365_0678611 3300039437 Bacteria 2527
262 Ga0436365_1886658 3300039437 Bacteria 26869
263 Ga0436360_0652803 3300039438 Bacteria 5557
264 Ga0436361_0425765 3300039447 Bacteria 1311
265 Ga0436361_0500698 3300039447 Bacteria 1074
266 Ga0436361_1079383 3300039447 Bacteria 2820
267 Ga0436363_0699892 3300039450 Bacteria 10776
268 Ga0436363_0700629 3300039450 Bacteria 1028
269 Ga0436363_1011916 3300039450 Bacteria 2000
270 Ga0451843_1323642 3300041509 Bacteria 1277
271 Ga0450900_028879 3300042136 Bacteria 800
272 Ga0466972_0072916 3300044658 Bacteria 1637
273 Ga0466968_0053024 3300044735 Bacteria 1736
274 Ga0466968_0066967 3300044735 Bacteria 1556
275 Ga0466960_0200173 3300044901 Bacteria 1091
276 Ga0466960_0391389 3300044901 Bacteria 799
277 Ga0466960_0465994 3300044901 Bacteria 736
278 Ga0466967_0282371 3300045976 Bacteria 1593
279 Ga0495592_0538314 3300046454 Bacteria 720
280 Ga0495603_0123288 3300046455 Bacteria 1510
281 Ga0495638_0001760 3300046460 Bacteria 18968
282 Ga0495638_0361783 3300046460 Bacteria 763
283 Ga0495651_0001917 3300046462 Bacteria 16106
284 Ga0495605_0148332 3300046474 Bacteria 1048
285 Ga0495639_0048418 3300046475 Bacteria 1927
286 Ga0495664_0011217 3300046477 Bacteria 5047
287 Ga0495594_0228874 3300046499 Bacteria 1060
288 Ga0495583_0230360 3300046506 Bacteria 747
289 Ga0495606_0375969 3300046507 Bacteria 746
290 Ga0495620_0138662 3300046515 Bacteria 952
291 Ga0495628_0103487 3300046516 Bacteria 2195
292 Ga0495643_0050420 3300046522 Bacteria 2242
293 Ga0495652_0025465 3300046529 Bacteria 5233
294 Ga0495652_0514286 3300046529 Bacteria 828
295 Ga0495640_0011710 3300046533 Bacteria 6735
296 Ga0495640_0376595 3300046533 Bacteria 874
297 Ga0495587_0009486 3300046536 Bacteria 6236
298 Ga0495598_0314227 3300046537 Bacteria 595
299 Ga0495609_0058978 3300046538 Bacteria 1697
300 Ga0495645_0037519 3300046543 Bacteria 3533
301 Ga0495622_0079208 3300046557 Bacteria 1512
302 Ga0495667_0009591 3300046559 Bacteria 6564
303 Ga0495634_0042998 3300046642 Bacteria 3063
304 Ga0495634_0065794 3300046642 Bacteria 2401
305 Ga0495625_0071460 3300046660 Bacteria 2435
306 Ga0495635_0001881 3300046663 Bacteria 14234
307 Ga0495635_0099874 3300046663 Bacteria 1983
308 Ga0495661_0168011 3300046665 Bacteria 1172
309 Ga0495661_0419745 3300046665 Bacteria 648
310 Ga0495588_0075640 3300046674 Bacteria 1754
311 Ga0495588_0082234 3300046674 Bacteria 1682
312 Ga0495657_0004727 3300046675 Bacteria 10849
313 Ga0495599_0011007 3300046678 Bacteria 5551
314 Ga0495623_0022868 3300046679 Bacteria 4036
315 Ga0495613_0027850 3300046689 Bacteria 4206
316 Ga0495624_0022395 3300046690 Bacteria 4176
317 Ga0495600_0004439 3300046809 Bacteria 8392
318 Ga0495600_0007347 3300046809 Bacteria 6734
319 Ga0495581_0063802 3300047315 Bacteria 2128
320 Ga0495581_0174984 3300047315 Bacteria 1255
321 Ga0495604_0002141 3300047317 Bacteria 15889
322 Ga0495604_0026793 3300047317 Bacteria 4587
323 Ga0495674_0018376 3300047319 Bacteria 6508
324 Ga0495676_0049909 3300047321 Bacteria 3360
325 Ga0495680_0019780 3300047322 Bacteria 5678
326 Ga0495683_0244379 3300047323 Bacteria 790
327 Ga0495675_0027393 3300047444 Bacteria 3630
328 Ga0495686_0020180 3300047472 Bacteria 4446
329 Ga0495686_0634721 3300047472 Bacteria 550
330 Ga0495602_0074836 3300048088 Bacteria 2876
331 Ga0496100_0134242 3300048903 Bacteria 1747
332 Ga0496100_0152731 3300048903 Bacteria 1649
333 Ga0496100_0494916 3300048903 Bacteria 941
334 Ga0496101_0131222 3300048904 Bacteria 1903
335 Ga0496101_0272801 3300048904 Bacteria 1321
336 Ga0496101_0428910 3300048904 Bacteria 1042
337 Ga0496101_0667172 3300048904 Bacteria 821
338 Ga0496102_0070802 3300048905 Bacteria 3202
339 Ga0496104_0006361 3300048907 Bacteria 10389
340 Ga0496104_0021759 3300048907 Bacteria 5889
341 Ga0496104_0022524 3300048907 Bacteria 5787
342 Ga0496104_0251380 3300048907 Bacteria 1680
343 Ga0496104_0361991 3300048907 Unclassified 1363
344 Ga0496104_0398200 3300048907 Bacteria 1289
345 Ga0496104_0632394 3300048907 Bacteria 979
346 Ga0496105_0005021 3300048908 Bacteria 10018
347 Ga0496105_0147028 3300048908 Bacteria 1938
348 Ga0496105_0191474 3300048908 Unclassified 1672
349 Ga0496106_0059587 3300048909 Bacteria 2892
350 Ga0496106_0230376 3300048909 Bacteria 1479
351 Ga0496106_0549762 3300048909 Bacteria 926
352 Ga0496107_0173502 3300048910 Bacteria 1600
353 Ga0496107_0354899 3300048910 Unclassified 1091
354 Ga0496108_0010916 3300048911 Bacteria 7375
355 Ga0496108_0071778 3300048911 Bacteria 2922
356 Ga0496108_0573538 3300048911 Bacteria 984
357 Ga0496108_0588931 3300048911 Bacteria 969
358 Ga0496108_0780298 3300048911 Bacteria 825
359 Ga0496109_0001443 3300048912 Bacteria 19754
360 Ga0496110_0024131 3300048913 Bacteria 5180
361 Ga0496110_0228404 3300048913 Bacteria 1692
362 Ga0496110_0419356 3300048913 Bacteria 1220
363 Ga0496110_1133173 3300048913 Bacteria 691
364 Ga0496111_0436011 3300048914 Bacteria 967
365 Ga0496112_0001558 3300048915 Bacteria 17713
366 Ga0496112_1010461 3300048915 Bacteria 751
367 Ga0496113_0001483 3300048916 Bacteria 13114
368 Ga0496113_0010571 3300048916 Bacteria 6107
369 Ga0496113_0280507 3300048916 Bacteria 1332
370 Ga0496114_0000290 3300048917 Bacteria 36753
371 Ga0496114_0440600 3300048917 Bacteria 1154
372 Ga0496114_0949437 3300048917 Bacteria 742
373 Ga0496114_1298827 3300048917 Bacteria 614
374 Ga0496115_0003155 3300048918 Bacteria 11852
375 Ga0496115_0019865 3300048918 Bacteria 5176
376 Ga0496115_0057623 3300048918 Bacteria 3125
377 Ga0496115_0639186 3300048918 Bacteria 842
378 Ga0496116_0273267 3300048919 Bacteria 824
379 Ga0496117_0235143 3300048920 Bacteria 1010
380 Ga0496118_0175217 3300048921 Bacteria 1304
381 Ga0496119_0022738 3300048922 Bacteria 4476
382 Ga0496120_0036896 3300048923 Bacteria 2904
383 Ga0496121_0051244 3300048924 Bacteria 3478
384 Ga0496122_0007615 3300048925 Bacteria 11968
385 Ga0496122_0100923 3300048925 Bacteria 1929
386 Ga0496122_0278299 3300048925 Bacteria 916
387 Ga0496123_0055689 3300048926 Bacteria 2591
388 Ga0496124_0082577 3300048927 Bacteria 2637
389 Ga0496124_0087867 3300048927 Bacteria 2542
390 Ga0496125_0082641 3300048928 Bacteria 2447
391 Ga0496125_0105615 3300048928 Bacteria 2058
392 Ga0496126_0031654 3300048929 Bacteria 4992
393 Ga0496126_0111250 3300048929 Bacteria 2385
394 Ga0496126_0302353 3300048929 Bacteria 1319
395 Ga0496126_0853138 3300048929 Bacteria 694
396 Ga0501031_0198575 3300049568 Bacteria 1309
397 Ga0501037_0022439 3300049573 Bacteria 4669
398 Ga0501038_0553451 3300049574 Bacteria 874
399 Ga0501039_0119308 3300049575 Bacteria 2066
400 Ga0501040_0140528 3300049576 Bacteria 1701
401 Ga0501042_0069013 3300049578 Bacteria 2528
402 Ga0501046_0024593 3300049580 Bacteria 4939
403 Ga0501048_0247788 3300049582 Bacteria 1264
404 Ga0501070_0803033 3300049586 Bacteria 739
405 Ga0501075_0226169 3300049591 Bacteria 1427
406 Ga0501076_0154250 3300049592 Bacteria 1869
407 Ga0501044_0642380 3300049823 Bacteria 951
408 Ga0501045_0040032 3300049824 Bacteria 3410
409 nmdc:mga03n38_249516_c1 3300050490 Bacteria 937
410 nmdc:mga00v17_27926_c1 3300050491 Bacteria 3299
411 nmdc:mga00v17_349596_c1 3300050491 Bacteria 961
412 nmdc:mga0yw44_147163_c1 3300050492 Bacteria 1534
413 nmdc:mga0yw44_26350_c1 3300050492 Bacteria 3320
414 nmdc:mga0yw44_44148_c1 3300050492 Bacteria 2665
415 nmdc:mga07m45_53861_c1 3300050496 Bacteria 2274
416 nmdc:mga07m45_78980_c1 3300050496 Bacteria 1878
417 nmdc:mga0qj67_1105113_c1 3300050509 Bacteria 619
418 nmdc:mga08y16_66783_c1 3300050511 Bacteria 3754
419 nmdc:mga0n895_18008_c1 3300050512 Bacteria 6528
420 nmdc:mga08x19_95333_c1 3300050514 Bacteria 1968
421 nmdc:mga0sz30_102683_c1 3300050516 Bacteria 1250
422 nmdc:mga0sz30_135110_c1 3300050516 Bacteria 1088
423 nmdc:mga0sz30_44043_c1 3300050516 Bacteria 1879
424 nmdc:mga0sz30_86805_c1 3300050516 Bacteria 1358
425 Ga0500610_0142079 3300053079 Bacteria 1211
426 Ga0500578_0087490 3300053086 Bacteria 1979
427 Ga0500643_000163 3300053087 Bacteria 66676
428 Ga0500644_0225983 3300053088 Bacteria 782
429 Ga0500646_0026278 3300053090 Bacteria 1577
430 Ga0500651_0413484 3300053093 Bacteria 756
431 Ga0500566_0000224 3300053094 Bacteria 30350
432 Ga0500566_0096883 3300053094 Bacteria 1623
433 Ga0500641_0002734 3300053096 Bacteria 6227
434 Ga0500641_0016388 3300053096 Bacteria 2760
435 Ga0500650_0045589 3300053098 Bacteria 2031
436 Ga0500650_0112302 3300053098 Bacteria 1272
437 Ga0500650_0118657 3300053098 Bacteria 1234
438 Ga0500554_053541 3300053102 Bacteria 1277
439 Ga0500555_001084 3300053103 Bacteria 9093
440 Ga0500556_0027049 3300053104 Bacteria 1911
441 Ga0500562_110308 3300053108 Bacteria 750
442 Ga0500569_164298 3300053109 Bacteria 752
443 Ga0500572_042735 3300053111 Bacteria 1322
444 Ga0500594_0036703 3300053118 Bacteria 1320
445 Ga0500595_005537 3300053119 Bacteria 5504
446 Ga0500595_040507 3300053119 Bacteria 1502
447 Ga0500608_046197 3300053122 Bacteria 2092
448 Ga0500642_0007538 3300053130 Bacteria 3665
449 Ga0500642_0008075 3300053130 Bacteria 3578
450 Ga0500559_0063420 3300053136 Bacteria 1651
451 Ga0500564_034892 3300053138 Bacteria 2322
452 Ga0500568_0053420 3300053139 Bacteria 1583
453 Ga0500577_0206153 3300053142 Bacteria 849
454 Ga0500588_0001796 3300053146 Bacteria 4178
455 Ga0500588_0008929 3300053146 Bacteria 2362
456 Ga0500588_0021991 3300053146 Bacteria 1730
457 Ga0500590_107781 3300053148 Bacteria 1327
458 Ga0500604_0003195 3300053151 Bacteria 4404
459 Ga0500604_0045994 3300053151 Bacteria 1333
460 Ga0500616_0000705 3300053153 Bacteria 38798
461 Ga0500616_0060070 3300053153 Bacteria 1972
462 Ga0500619_056515 3300053154 Bacteria 1282
463 Ga0500622_0022826 3300053156 Bacteria 3313
464 Ga0500624_074124 3300053157 Bacteria 670
465 Ga0500633_0062579 3300053160 Bacteria 1312
466 Ga0500636_0000330 3300053177 Bacteria 26259
467 Ga0500636_0002418 3300053177 Bacteria 10334
468 Ga0500609_000476 3300053731 Bacteria 5969
469 Ga0500609_001275 3300053731 Bacteria 3727
470 Ga0500609_011550 3300053731 Bacteria 1193
471 Ga0500599_012579 3300053736 Bacteria 1138
472 Ga0500601_001460 3300053737 Bacteria 2595
473 Ga0501084_0073475 3300054114 Bacteria 2864

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10405791 Ga0207665_104057912 151
2 iso_pu_bacteria 2507262055 2507504937 165
3 iso_pu_bacteria 2508501050 2508727602 165
4 iso_pu_bacteria 2508501114 2509077487 165
5 iso_pu_bacteria 2511231028 2511401386 165
6 iso_pu_bacteria 2513237092 2513623374 165
7 iso_pu_bacteria 2513237139 2513873818 165
8 iso_pu_bacteria 2513237161 2514015340 165
9 iso_pu_bacteria 2517093001 2517102292 165
10 iso_pu_bacteria 2528768022 2528851958 165
11 iso_pu_bacteria 2545555834 2545678069 165
12 iso_pu_bacteria 2595698237 2596373538 165
13 iso_pu_bacteria 2617270735 2617351799 165
14 iso_pu_bacteria 2617270741 2617374026 165
15 iso_pu_bacteria 2643221733 2644730869 165
16 iso_pu_bacteria 2643221734 2644736032 165
17 iso_pu_bacteria 2643221736 2644742586 165
18 iso_pu_bacteria 2738541281 2738745530 165
19 iso_pu_bacteria 2738543032 2739354760 165
20 iso_pu_bacteria 2773857925 2774868728 165
21 iso_pu_bacteria 2775506901 2776258335 165
22 iso_pu_bacteria 2791355196 2793063020 165
23 iso_pu_bacteria 2802429603 2805915901 165
24 iso_pu_bacteria 2818991467 2819722087 165
25 iso_pu_bacteria 2824661429 2824670084 165
26 iso_pu_bacteria 2824671348 2824679108 165
27 iso_pu_bacteria 2824687955 2824695718 165
28 iso_pu_bacteria 2824696289 2824701633 165
29 iso_pu_bacteria 2824704595 2824713651 165
30 iso_pu_bacteria 2824732956 2824739262 165
31 iso_pu_bacteria 2824746037 2824748925 165
32 iso_pu_bacteria 2824753945 2824760561 165
33 iso_pu_bacteria 2824763712 2824771025 165
34 iso_pu_bacteria 2824773399 2824774844 165
35 iso_pu_bacteria 2829745981 2829750703 165
36 iso_pu_bacteria 2835312727 2835318528 165
37 iso_pu_bacteria 2838122688 2838124215 165
38 iso_pu_bacteria 2841760612 2841763991 165
39 iso_pu_bacteria 2841911363 2841915525 165
40 iso_pu_bacteria 2841917233 2841920727 165
41 iso_pu_bacteria 2841941048 2841944561 165
42 iso_pu_bacteria 2841949485 2841951699 165
43 iso_pu_bacteria 2841957949 2841964840 165
44 iso_pu_bacteria 2841966195 2841969339 165
45 iso_pu_bacteria 2841974524 2841980264 165
46 iso_pu_bacteria 2841983080 2841985514 165
47 iso_pu_bacteria 2842038055 2842043786 165
48 iso_pu_bacteria 2842045827 2842052224 165
49 iso_pu_bacteria 2844104063 2844108554 165
50 iso_pu_bacteria 2844315083 2844321915 165
51 iso_pu_bacteria 2847939898 2847941852 165
52 iso_pu_bacteria 2851182111 2851185234 165
53 iso_pu_bacteria 2851246043 2851250426 165
54 iso_pu_bacteria 2861691609 2861695916 165
55 iso_pu_bacteria 2874612657 2874618479 165
56 iso_pu_bacteria 2874620515 2874624508 165
57 iso_pu_bacteria 2874628541 2874629128 165
58 iso_pu_bacteria 2879099564 2879107321 165
59 iso_pu_bacteria 2882456835 2882457563 165
60 iso_pu_bacteria 2884298095 2884301344 165
61 iso_pu_bacteria 2889306138 2889311485 165
62 iso_pu_bacteria 2894232714 2894235974 165
63 iso_pu_bacteria 2902405164 2902411663 165
64 iso_pu_bacteria 2903727486 2903727537 165
65 iso_pu_bacteria 2904666416 2904672153 165
66 iso_pu_bacteria 2904711408 2904718166 165
67 iso_pu_bacteria 2906602504 2906602973 165
68 iso_pu_bacteria 2908775508 2908776503 165
69 iso_pu_bacteria 2917699015 2917701902 165
70 iso_pu_bacteria 2928125067 2928128570 165
71 iso_pu_bacteria 2929615660 2929623800 165
72 iso_pu_bacteria 2929624759 2929629031 165
73 iso_pu_bacteria 2932784394 2932786443 165
74 iso_pu_bacteria 2932809354 2932812483 165
75 iso_pu_bacteria 2932818245 2932822845 165
76 iso_pu_bacteria 2932828146 2932829680 165
77 iso_pu_bacteria 2933577622 2933585679 165
78 iso_pu_bacteria 2935616580 2935618200 165
79 iso_pu_bacteria 2935638405 2935641404 165
80 iso_pu_bacteria 2935648319 2935652897 165
81 iso_pu_bacteria 2935656913 2935661480 165
82 iso_pu_bacteria 2935665750 2935669538 165
83 iso_pu_bacteria 2935675223 2935677864 165
84 iso_pu_bacteria 2935684952 2935689687 165
85 iso_pu_bacteria 2935694250 2935698225 165
86 iso_pu_bacteria 2935703347 2935707363 165
87 iso_pu_bacteria 2935713505 2935717207 165
88 iso_pu_bacteria 2935722832 2935724124 165
89 iso_pu_bacteria 2935732158 2935738622 165
90 iso_pu_bacteria 2935741537 2935749130 165
91 iso_pu_bacteria 2935750917 2935757041 165
92 iso_pu_bacteria 2935760218 2935764348 165
93 iso_pu_bacteria 2935801545 2935804258 165
94 iso_pu_bacteria 2935827899 2935831135 165
95 iso_pu_bacteria 2935837841 2935841744 165
96 iso_pu_bacteria 2935855204 2935856301 165
97 iso_pu_bacteria 2935864058 2935866367 165
98 iso_pu_bacteria 2935873716 2935874674 165
99 iso_pu_bacteria 2935959822 2935962368 165
100 iso_pu_bacteria 2935984226 2935984878 165
101 iso_pu_bacteria 2935992306 2935994132 165
102 iso_pu_bacteria 2936002035 2936004857 165
103 iso_pu_bacteria 2936011229 2936015791 165
104 iso_pu_bacteria 2936019824 2936024425 165
105 iso_pu_bacteria 2936028420 2936031688 165
106 iso_pu_bacteria 2936046547 2936051510 165
107 iso_pu_bacteria 2936055302 2936056049 165
108 iso_pu_bacteria 2940556831 2940562955 165
109 iso_pu_bacteria 2941538514 2941543817 165
110 iso_pu_bacteria 3005718088 3005725037 165
111 iso_pu_bacteria 641522639 641642416 165
112 iso_pu_bacteria 643348564 643598895 165
113 iso_pu_bacteria 8006926726 8006932777 165
114 iso_pu_bacteria 8016630954 8016635985 165
115 iso_pu_bacteria 8017057580 8017058142 165
116 iso_pu_bacteria 8019586578 8019595680 165
117 iso_pu_bacteria 8019608314 8019612450 165
118 iso_pu_bacteria 8019648815 8019652782 165
119 iso_pu_bacteria 8055742211 8055751101 165
120 iso_pu_bacteria 8057529695 8057534084 165
121 3300005331 Ga0070670_100075398 Ga0070670_1000753983 166
122 3300005354 Ga0070675_100128215 Ga0070675_1001282153 166
123 3300005543 Ga0070672_100216621 Ga0070672_1002166213 166
124 3300005618 Ga0068864_101191853 Ga0068864_1011918532 166
125 3300025925 Ga0207650_10095627 Ga0207650_100956273 166
126 3300025940 Ga0207691_10129493 Ga0207691_101294933 166
127 3300025960 Ga0207651_10212262 Ga0207651_102122623 166
128 3300032002 Ga0307416_102132942 Ga0307416_1021329421 167
129 3300037853 Ga0436364_0497276 Ga0436364_0497276_127_648 167
130 3300005366 Ga0070659_100994064 Ga0070659_1009940641 168
131 3300005440 Ga0070705_100417546 Ga0070705_1004175461 168
132 3300005444 Ga0070694_100728250 Ga0070694_1007282502 168
133 3300005546 Ga0070696_100008909 Ga0070696_1000089093 168
134 3300005549 Ga0070704_100024848 Ga0070704_1000248482 168
135 3300005617 Ga0068859_100362045 Ga0068859_1003620452 168
136 3300005842 Ga0068858_101139955 Ga0068858_1011399551 168
137 3300005843 Ga0068860_100400687 Ga0068860_1004006872 168
138 3300005843 Ga0068860_100926396 Ga0068860_1009263961 168
139 3300005844 Ga0068862_100365703 Ga0068862_1003657032 168
140 3300006038 Ga0075365_11004602 Ga0075365_110046021 168
141 3300006042 Ga0075368_10318850 Ga0075368_103188501 168
142 3300006177 Ga0075362_10257900 Ga0075362_102579001 168
143 3300006195 Ga0075366_10054826 Ga0075366_100548263 168
144 3300006353 Ga0075370_10052635 Ga0075370_100526351 168
145 3300006931 Ga0097620_100362038 Ga0097620_1003620382 168
146 3300009101 Ga0105247_10160516 Ga0105247_101605162 168
147 3300009177 Ga0105248_10806788 Ga0105248_108067881 168
148 3300009553 Ga0105249_10014538 Ga0105249_100145385 168
149 3300009553 Ga0105249_10914868 Ga0105249_109148682 168
150 3300013296 Ga0157374_10203265 Ga0157374_102032652 168
151 3300014325 Ga0163163_10047869 Ga0163163_100478693 168
152 3300014968 Ga0157379_10170305 Ga0157379_101703052 168
153 3300014968 Ga0157379_10252918 Ga0157379_102529182 168
154 3300021384 Ga0213876_10029125 Ga0213876_100291253 168
155 3300021388 Ga0213875_10076933 Ga0213875_100769332 168
156 3300025961 Ga0207712_10007361 Ga0207712_100073613 168
157 3300028380 Ga0268265_11749033 Ga0268265_117490331 168
158 3300037853 Ga0436364_0532601 Ga0436364_0532601_55_561 168
159 3300039437 Ga0436365_0277390 Ga0436365_0277390_3176_3691 168
160 3300048907 Ga0496104_0251380 Ga0496104_0251380_184_690 168
161 3300048917 Ga0496114_1298827 Ga0496114_1298827_80_586 168
162 3300049568 Ga0501031_0198575 Ga0501031_0198575_168_680 168
163 3300049574 Ga0501038_0553451 Ga0501038_0553451_30_542 168
164 3300049575 Ga0501039_0119308 Ga0501039_0119308_497_1009 168
165 3300049576 Ga0501040_0140528 Ga0501040_0140528_720_1232 168
166 3300049578 Ga0501042_0069013 Ga0501042_0069013_1466_1978 168
167 3300049580 Ga0501046_0024593 Ga0501046_0024593_2210_2722 168
168 3300049582 Ga0501048_0247788 Ga0501048_0247788_641_1153 168
169 3300049586 Ga0501070_0803033 Ga0501070_0803033_82_588 168
170 3300049591 Ga0501075_0226169 Ga0501075_0226169_873_1385 168
171 3300049824 Ga0501045_0040032 Ga0501045_0040032_836_1348 168
172 3300050509 nmdc:mga0qj67_1105113_c1 nmdc:mga0qj67_1105113_c1_26_532 168
173 3300054114 Ga0501084_0073475 Ga0501084_0073475_1839_2351 168
174 3300002987 JGI25159J45721_1021976 JGI25159J45721_10219762 169
175 3300003187 JGI25151J46595_10000021 JGI25151J46595_1000002122 169
176 3300003215 JGI25153J46596_10000133 JGI25153J46596_100001339 169
177 3300003215 JGI25153J46596_10001375 JGI25153J46596_1000137515 169
178 3300003215 JGI25153J46596_10015196 JGI25153J46596_100151962 169
179 3300003354 JGI25160J50197_1001189 JGI25160J50197_10011893 169
180 3300003771 Ga0055526_1001254 Ga0055526_100125411 169
181 3300003771 Ga0055526_1001771 Ga0055526_100177111 169
182 3300003775 Ga0055524_1000011 Ga0055524_1000011177 169
183 3300005262 Ga0065165_1000150 Ga0065165_100015036 169
184 3300005262 Ga0065165_1053766 Ga0065165_10537662 169
185 3300005327 Ga0070658_10811070 Ga0070658_108110701 169
186 3300005338 Ga0068868_100003650 Ga0068868_10000365011 169
187 3300005339 Ga0070660_100492174 Ga0070660_1004921742 169
188 3300005340 Ga0070689_100000018 Ga0070689_1000000189 169
189 3300005347 Ga0070668_100464360 Ga0070668_1004643602 169
190 3300005347 Ga0070668_100516691 Ga0070668_1005166912 169
191 3300005354 Ga0070675_100083801 Ga0070675_1000838014 169
192 3300005354 Ga0070675_100298987 Ga0070675_1002989872 169
193 3300005354 Ga0070675_100299578 Ga0070675_1002995781 169
194 3300005355 Ga0070671_100015653 Ga0070671_1000156532 169
195 3300005355 Ga0070671_100141019 Ga0070671_1001410191 169
196 3300005364 Ga0070673_100090930 Ga0070673_1000909301 169
197 3300005365 Ga0070688_100122177 Ga0070688_1001221772 169
198 3300005434 Ga0070709_10018422 Ga0070709_100184223 169
199 3300005435 Ga0070714_100017599 Ga0070714_1000175992 169
200 3300005436 Ga0070713_100018232 Ga0070713_1000182322 169
201 3300005436 Ga0070713_100251505 Ga0070713_1002515052 169
202 3300005437 Ga0070710_10083796 Ga0070710_100837962 169
203 3300005441 Ga0070700_100812870 Ga0070700_1008128701 169
204 3300005455 Ga0070663_100096378 Ga0070663_1000963783 169
205 3300005455 Ga0070663_100234570 Ga0070663_1002345702 169
206 3300005456 Ga0070678_100745913 Ga0070678_1007459132 169
207 3300005456 Ga0070678_101010449 Ga0070678_1010104492 169
208 3300005459 Ga0068867_100044224 Ga0068867_1000442243 169
209 3300005459 Ga0068867_101540674 Ga0068867_1015406741 169
210 3300005466 Ga0070685_10013703 Ga0070685_100137031 169
211 3300005535 Ga0070684_100273139 Ga0070684_1002731392 169
212 3300005535 Ga0070684_100424240 Ga0070684_1004242402 169
213 3300005543 Ga0070672_100416870 Ga0070672_1004168701 169
214 3300005544 Ga0070686_100030101 Ga0070686_1000301012 169
215 3300005547 Ga0070693_100624624 Ga0070693_1006246241 169
216 3300005548 Ga0070665_100027310 Ga0070665_1000273102 169
217 3300005614 Ga0068856_100227664 Ga0068856_1002276643 169
218 3300005614 Ga0068856_100294832 Ga0068856_1002948322 169
219 3300005615 Ga0070702_100141784 Ga0070702_1001417842 169
220 3300005616 Ga0068852_100076609 Ga0068852_1000766093 169
221 3300005718 Ga0068866_10209299 Ga0068866_102092992 169
222 3300005841 Ga0068863_100407461 Ga0068863_1004074612 169
223 3300005841 Ga0068863_101461066 Ga0068863_1014610661 169
224 3300005844 Ga0068862_100004007 Ga0068862_10000400713 169
225 3300005937 Ga0081455_10043443 Ga0081455_100434433 169
226 3300005937 Ga0081455_10124402 Ga0081455_101244022 169
227 3300005983 Ga0081540_1081219 Ga0081540_10812191 169
228 3300006028 Ga0070717_10005153 Ga0070717_100051534 169
229 3300006038 Ga0075365_10017968 Ga0075365_100179683 169
230 3300006038 Ga0075365_10027319 Ga0075365_100273192 169
231 3300006038 Ga0075365_10164656 Ga0075365_101646561 169
232 3300006038 Ga0075365_10405718 Ga0075365_104057182 169
233 3300006051 Ga0075364_10133114 Ga0075364_101331142 169
234 3300006051 Ga0075364_10490732 Ga0075364_104907321 169
235 3300006173 Ga0070716_100121943 Ga0070716_1001219433 169
236 3300006173 Ga0070716_100231711 Ga0070716_1002317112 169
237 3300006186 Ga0075369_10061400 Ga0075369_100614002 169
238 3300006186 Ga0075369_10077135 Ga0075369_100771352 169
239 3300006195 Ga0075366_10091254 Ga0075366_100912542 169
240 3300006237 Ga0097621_100085078 Ga0097621_1000850782 169
241 3300006237 Ga0097621_100335347 Ga0097621_1003353472 169
242 3300006353 Ga0075370_10247437 Ga0075370_102474372 169
243 3300006358 Ga0068871_100021632 Ga0068871_1000216321 169
244 3300006871 Ga0075434_100011878 Ga0075434_1000118785 169
245 3300006871 Ga0075434_100339422 Ga0075434_1003394222 169
246 3300006944 Ga0099823_1013263 Ga0099823_10132633 169
247 3300009093 Ga0105240_10009401 Ga0105240_100094014 169
248 3300009093 Ga0105240_10076360 Ga0105240_100763603 169
249 3300009093 Ga0105240_10077368 Ga0105240_100773684 169
250 3300009093 Ga0105240_10430678 Ga0105240_104306782 169
251 3300009093 Ga0105240_10670205 Ga0105240_106702052 169
252 3300009101 Ga0105247_10786876 Ga0105247_107868761 169
253 3300009174 Ga0105241_10131101 Ga0105241_101311011 169
254 3300009174 Ga0105241_10187922 Ga0105241_101879222 169
255 3300009545 Ga0105237_10133511 Ga0105237_101335113 169
256 3300010375 Ga0105239_10079271 Ga0105239_100792712 169
257 3300010375 Ga0105239_10367297 Ga0105239_103672972 169
258 3300012500 Ga0157314_1014240 Ga0157314_10142401 169
259 3300013250 Ga0171462_1015 Ga0171462_101568 169
260 3300013296 Ga0157374_10848455 Ga0157374_108484552 169
261 3300013297 Ga0157378_10274569 Ga0157378_102745692 169
262 3300013306 Ga0163162_10927960 Ga0163162_109279601 169
263 3300013307 Ga0157372_11862187 Ga0157372_118621871 169
264 3300013308 Ga0157375_12225208 Ga0157375_122252081 169
265 3300014325 Ga0163163_10004923 Ga0163163_100049237 169
266 3300014325 Ga0163163_10308330 Ga0163163_103083303 169
267 3300014325 Ga0163163_10733616 Ga0163163_107336162 169
268 3300014326 Ga0157380_10019928 Ga0157380_100199282 169
269 3300014497 Ga0182008_10534830 Ga0182008_105348301 169
270 3300017792 Ga0163161_10552857 Ga0163161_105528571 169
271 3300017792 Ga0163161_11383257 Ga0163161_113832571 169
272 3300020081 Ga0206354_10108602 Ga0206354_101086023 169
273 3300020081 Ga0206354_10359821 Ga0206354_103598211 169
274 3300021320 Ga0214544_1000003 Ga0214544_100000332 169
275 3300021321 Ga0214542_1000003 Ga0214542_100000322 169
276 3300021324 Ga0214545_1000004 Ga0214545_100000435 169
277 3300021327 Ga0214543_1000007 Ga0214543_1000007381 169
278 3300021377 Ga0213874_10002498 Ga0213874_100024982 169
279 3300021384 Ga0213876_10007769 Ga0213876_100077698 169
280 3300021384 Ga0213876_10009062 Ga0213876_100090623 169
281 3300021388 Ga0213875_10021992 Ga0213875_100219924 169
282 3300021388 Ga0213875_10377973 Ga0213875_103779731 169
283 3300025261 Ga0209233_1021879 Ga0209233_10218792 169
284 3300025273 Ga0209673_1049107 Ga0209673_10491072 169
285 3300025284 Ga0209130_1000187 Ga0209130_100018770 169
286 3300025291 Ga0209675_1005741 Ga0209675_10057412 169
287 3300025294 Ga0209025_1000010 Ga0209025_1000010476 169
288 3300025294 Ga0209025_1003913 Ga0209025_100391315 169
289 3300025294 Ga0209025_1062867 Ga0209025_10628672 169
290 3300025294 Ga0209025_1070283 Ga0209025_10702832 169
291 3300025295 Ga0209564_1000019 Ga0209564_1000019508 169
292 3300025295 Ga0209564_1000369 Ga0209564_100036968 169
293 3300025297 Ga0209758_1000005 Ga0209758_1000005810 169
294 3300025297 Ga0209758_1002632 Ga0209758_100263214 169
295 3300025297 Ga0209758_1016086 Ga0209758_10160862 169
296 3300025297 Ga0209758_1039208 Ga0209758_10392083 169
297 3300025297 Ga0209758_1078121 Ga0209758_10781212 169
298 3300025298 Ga0209050_1019524 Ga0209050_10195243 169
299 3300025298 Ga0209050_1064198 Ga0209050_10641982 169
300 3300025299 Ga0209256_1000317 Ga0209256_100031722 169
301 3300025299 Ga0209256_1050348 Ga0209256_10503482 169
302 3300025302 Ga0207426_1000201 Ga0207426_100020192 169
303 3300025302 Ga0207426_1011144 Ga0207426_10111442 169
304 3300025302 Ga0207426_1018295 Ga0207426_10182953 169
305 3300025304 Ga0209257_1000391 Ga0209257_100039174 169
306 3300025304 Ga0209257_1065298 Ga0209257_10652982 169
307 3300025898 Ga0207692_10081313 Ga0207692_100813132 169
308 3300025898 Ga0207692_10628966 Ga0207692_106289662 169
309 3300025903 Ga0207680_10198228 Ga0207680_101982282 169
310 3300025906 Ga0207699_10115358 Ga0207699_101153581 169
311 3300025911 Ga0207654_10044547 Ga0207654_100445473 169
312 3300025913 Ga0207695_10000065 Ga0207695_10000065263 169
313 3300025913 Ga0207695_10055253 Ga0207695_100552533 169
314 3300025913 Ga0207695_10414864 Ga0207695_104148642 169
315 3300025914 Ga0207671_10017405 Ga0207671_100174052 169
316 3300025918 Ga0207662_10112981 Ga0207662_101129813 169
317 3300025919 Ga0207657_10185324 Ga0207657_101853242 169
318 3300025921 Ga0207652_10104076 Ga0207652_101040762 169
319 3300025925 Ga0207650_10836010 Ga0207650_108360102 169
320 3300025926 Ga0207659_10159977 Ga0207659_101599772 169
321 3300025926 Ga0207659_10263559 Ga0207659_102635592 169
322 3300025928 Ga0207700_10040741 Ga0207700_100407411 169
323 3300025929 Ga0207664_10028898 Ga0207664_100288982 169
324 3300025931 Ga0207644_10052406 Ga0207644_100524064 169
325 3300025931 Ga0207644_10538122 Ga0207644_105381222 169
326 3300025931 Ga0207644_10656374 Ga0207644_106563742 169
327 3300025933 Ga0207706_10237822 Ga0207706_102378222 169
328 3300025936 Ga0207670_10000001 Ga0207670_100000019 169
329 3300025936 Ga0207670_10026049 Ga0207670_100260495 169
330 3300025939 Ga0207665_10136391 Ga0207665_101363911 169
331 3300025940 Ga0207691_10005607 Ga0207691_1000560712 169
332 3300025945 Ga0207679_11454512 Ga0207679_114545122 169
333 3300025949 Ga0207667_10753042 Ga0207667_107530422 169
334 3300025960 Ga0207651_10000751 Ga0207651_100007517 169
335 3300025960 Ga0207651_10121773 Ga0207651_101217732 169
336 3300025961 Ga0207712_11364006 Ga0207712_113640061 169
337 3300025972 Ga0207668_10411807 Ga0207668_104118071 169
338 3300025972 Ga0207668_11362324 Ga0207668_113623241 169
339 3300025981 Ga0207640_10813913 Ga0207640_108139131 169
340 3300025986 Ga0207658_10039079 Ga0207658_100390793 169
341 3300026023 Ga0207677_10004986 Ga0207677_100049865 169
342 3300026067 Ga0207678_10744374 Ga0207678_107443741 169
343 3300026075 Ga0207708_10244255 Ga0207708_102442552 169
344 3300026075 Ga0207708_10409273 Ga0207708_104092732 169
345 3300026075 Ga0207708_11100282 Ga0207708_111002821 169
346 3300026078 Ga0207702_10250907 Ga0207702_102509071 169
347 3300026078 Ga0207702_10490535 Ga0207702_104905352 169
348 3300026088 Ga0207641_11541881 Ga0207641_115418811 169
349 3300026089 Ga0207648_10031123 Ga0207648_100311233 169
350 3300026089 Ga0207648_10316570 Ga0207648_103165702 169
351 3300026089 Ga0207648_11460127 Ga0207648_114601271 169
352 3300026095 Ga0207676_10167880 Ga0207676_101678802 169
353 3300026121 Ga0207683_10054965 Ga0207683_100549652 169
354 3300026121 Ga0207683_10246280 Ga0207683_102462802 169
355 3300026142 Ga0207698_10104979 Ga0207698_101049794 169
356 3300027296 Ga0209389_1010635 Ga0209389_10106356 169
357 3300027361 Ga0209489_112010 Ga0209489_1120106 169
358 3300027363 Ga0209700_110939 Ga0209700_1109398 169
359 3300027907 Ga0207428_10035875 Ga0207428_100358752 169
360 3300028379 Ga0268266_10006781 Ga0268266_100067815 169
361 3300028577 Ga0265318_10067478 Ga0265318_100674782 169
362 3300028794 Ga0307515_10178960 Ga0307515_101789603 169
363 3300031240 Ga0265320_10269587 Ga0265320_102695871 169
364 3300031456 Ga0307513_10036871 Ga0307513_100368714 169
365 3300031456 Ga0307513_10129247 Ga0307513_101292472 169
366 3300031548 Ga0307408_100052585 Ga0307408_1000525852 169
367 3300031548 Ga0307408_100225750 Ga0307408_1002257502 169
368 3300031616 Ga0307508_10082799 Ga0307508_100827994 169
369 3300031901 Ga0307406_10141603 Ga0307406_101416032 169
370 3300031901 Ga0307406_10324944 Ga0307406_103249442 169
371 3300031911 Ga0307412_10212845 Ga0307412_102128452 169
372 3300031995 Ga0307409_101744072 Ga0307409_1017440721 169
373 3300032002 Ga0307416_100878294 Ga0307416_1008782942 169
374 3300032126 Ga0307415_100643481 Ga0307415_1006434812 169
375 3300032126 Ga0307415_101320184 Ga0307415_1013201842 169
376 3300033180 Ga0307510_10016772 Ga0307510_100167721 169
377 3300033180 Ga0307510_10070055 Ga0307510_100700552 169
378 3300035120 Ga0373957_0079320 Ga0373957_0079320_63_590 169
379 3300035171 Ga0373946_0030522 Ga0373946_0030522_1450_1962 169
380 3300035172 Ga0373955_0110620 Ga0373955_0110620_563_1078 169
381 3300035691 Ga0373931_0472589 Ga0373931_0472589_216_725 169
382 3300035724 Ga0373933_0120135 Ga0373933_0120135_449_964 169
383 3300035724 Ga0373933_0526077 Ga0373933_0526077_74_589 169
384 3300036401 Ga0373937_0197415 Ga0373937_0197415_1335_1850 169
385 3300037068 Ga0373925_0268148 Ga0373925_0268148_771_1283 169
386 3300037068 Ga0373925_0898809 Ga0373925_0898809_33_542 169
387 3300037466 Ga0395898_1118688 Ga0395898_1118688_165_674 169
388 3300037471 Ga0395905_0081569 Ga0395905_0081569_1671_2180 169
389 3300037853 Ga0436364_0197909 Ga0436364_0197909_194_724 169
390 3300037853 Ga0436364_1099918 Ga0436364_1099918_2189_2701 169
391 3300038705 Ga0237819_26476 Ga0237819_26476_15_524 169
392 3300039145 Ga0237816_00722 Ga0237816_00722_1224_1733 169
393 3300039437 Ga0436365_0088001 Ga0436365_0088001_618_1130 169
394 3300039437 Ga0436365_0678611 Ga0436365_0678611_1649_2158 169
395 3300039437 Ga0436365_1886658 Ga0436365_1886658_2058_2567 169
396 3300039438 Ga0436360_0652803 Ga0436360_0652803_89_598 169
397 3300039447 Ga0436361_0425765 Ga0436361_0425765_23_535 169
398 3300039447 Ga0436361_0500698 Ga0436361_0500698_36_548 169
399 3300039447 Ga0436361_1079383 Ga0436361_1079383_653_1183 169
400 3300039450 Ga0436363_0699892 Ga0436363_0699892_6689_7204 169
401 3300039450 Ga0436363_0700629 Ga0436363_0700629_487_996 169
402 3300039450 Ga0436363_1011916 Ga0436363_1011916_733_1263 169
403 3300041509 Ga0451843_1323642 Ga0451843_1323642_607_1116 169
404 3300042136 Ga0450900_028879 Ga0450900_028879_46_555 169
405 3300044658 Ga0466972_0072916 Ga0466972_0072916_625_1134 169
406 3300044735 Ga0466968_0053024 Ga0466968_0053024_663_1172 169
407 3300044735 Ga0466968_0066967 Ga0466968_0066967_587_1096 169
408 3300044901 Ga0466960_0200173 Ga0466960_0200173_195_704 169
409 3300044901 Ga0466960_0391389 Ga0466960_0391389_154_663 169
410 3300044901 Ga0466960_0465994 Ga0466960_0465994_144_653 169
411 3300045976 Ga0466967_0282371 Ga0466967_0282371_731_1246 169
412 3300046454 Ga0495592_0538314 Ga0495592_0538314_177_686 169
413 3300046455 Ga0495603_0123288 Ga0495603_0123288_895_1407 169
414 3300046460 Ga0495638_0001760 Ga0495638_0001760_216_725 169
415 3300046460 Ga0495638_0361783 Ga0495638_0361783_229_738 169
416 3300046462 Ga0495651_0001917 Ga0495651_0001917_4919_5428 169
417 3300046474 Ga0495605_0148332 Ga0495605_0148332_366_875 169
418 3300046475 Ga0495639_0048418 Ga0495639_0048418_828_1340 169
419 3300046477 Ga0495664_0011217 Ga0495664_0011217_2879_3388 169
420 3300046499 Ga0495594_0228874 Ga0495594_0228874_223_732 169
421 3300046506 Ga0495583_0230360 Ga0495583_0230360_16_525 169
422 3300046507 Ga0495606_0375969 Ga0495606_0375969_67_576 169
423 3300046515 Ga0495620_0138662 Ga0495620_0138662_38_568 169
424 3300046516 Ga0495628_0103487 Ga0495628_0103487_156_665 169
425 3300046522 Ga0495643_0050420 Ga0495643_0050420_855_1364 169
426 3300046529 Ga0495652_0025465 Ga0495652_0025465_3093_3602 169
427 3300046529 Ga0495652_0514286 Ga0495652_0514286_215_724 169
428 3300046533 Ga0495640_0011710 Ga0495640_0011710_4326_4835 169
429 3300046533 Ga0495640_0376595 Ga0495640_0376595_182_697 169
430 3300046536 Ga0495587_0009486 Ga0495587_0009486_2360_2869 169
431 3300046537 Ga0495598_0314227 Ga0495598_0314227_52_561 169
432 3300046538 Ga0495609_0058978 Ga0495609_0058978_947_1456 169
433 3300046543 Ga0495645_0037519 Ga0495645_0037519_999_1508 169
434 3300046557 Ga0495622_0079208 Ga0495622_0079208_303_812 169
435 3300046559 Ga0495667_0009591 Ga0495667_0009591_2967_3476 169
436 3300046642 Ga0495634_0042998 Ga0495634_0042998_2371_2880 169
437 3300046642 Ga0495634_0065794 Ga0495634_0065794_869_1378 169
438 3300046660 Ga0495625_0071460 Ga0495625_0071460_247_756 169
439 3300046663 Ga0495635_0001881 Ga0495635_0001881_9761_10270 169
440 3300046663 Ga0495635_0099874 Ga0495635_0099874_201_710 169
441 3300046665 Ga0495661_0168011 Ga0495661_0168011_653_1162 169
442 3300046665 Ga0495661_0419745 Ga0495661_0419745_88_597 169
443 3300046674 Ga0495588_0075640 Ga0495588_0075640_1173_1682 169
444 3300046674 Ga0495588_0082234 Ga0495588_0082234_1055_1567 169
445 3300046675 Ga0495657_0004727 Ga0495657_0004727_3126_3635 169
446 3300046678 Ga0495599_0011007 Ga0495599_0011007_2107_2616 169
447 3300046679 Ga0495623_0022868 Ga0495623_0022868_3238_3747 169
448 3300046689 Ga0495613_0027850 Ga0495613_0027850_3666_4175 169
449 3300046690 Ga0495624_0022395 Ga0495624_0022395_2866_3375 169
450 3300046809 Ga0495600_0004439 Ga0495600_0004439_5020_5529 169
451 3300046809 Ga0495600_0007347 Ga0495600_0007347_2623_3132 169
452 3300047315 Ga0495581_0063802 Ga0495581_0063802_385_897 169
453 3300047315 Ga0495581_0174984 Ga0495581_0174984_129_638 169
454 3300047317 Ga0495604_0002141 Ga0495604_0002141_1637_2146 169
455 3300047317 Ga0495604_0026793 Ga0495604_0026793_92_601 169
456 3300047319 Ga0495674_0018376 Ga0495674_0018376_2905_3414 169
457 3300047321 Ga0495676_0049909 Ga0495676_0049909_878_1390 169
458 3300047322 Ga0495680_0019780 Ga0495680_0019780_2196_2705 169
459 3300047323 Ga0495683_0244379 Ga0495683_0244379_206_715 169
460 3300047444 Ga0495675_0027393 Ga0495675_0027393_3109_3618 169
461 3300047472 Ga0495686_0020180 Ga0495686_0020180_252_761 169
462 3300047472 Ga0495686_0634721 Ga0495686_0634721_22_531 169
463 3300048088 Ga0495602_0074836 Ga0495602_0074836_2277_2786 169
464 3300048903 Ga0496100_0134242 Ga0496100_0134242_731_1243 169
465 3300048903 Ga0496100_0152731 Ga0496100_0152731_411_926 169
466 3300048903 Ga0496100_0494916 Ga0496100_0494916_320_829 169
467 3300048904 Ga0496101_0131222 Ga0496101_0131222_1243_1758 169
468 3300048904 Ga0496101_0272801 Ga0496101_0272801_669_1181 169
469 3300048904 Ga0496101_0428910 Ga0496101_0428910_313_822 169
470 3300048904 Ga0496101_0667172 Ga0496101_0667172_149_658 169
471 3300048905 Ga0496102_0070802 Ga0496102_0070802_1203_1715 169
472 3300048907 Ga0496104_0006361 Ga0496104_0006361_6528_7037 169
473 3300048907 Ga0496104_0021759 Ga0496104_0021759_5231_5743 169
474 3300048907 Ga0496104_0022524 Ga0496104_0022524_2999_3514 169
475 3300048907 Ga0496104_0361991 Ga0496104_0361991_593_1105 169
476 3300048907 Ga0496104_0398200 Ga0496104_0398200_141_653 169
477 3300048907 Ga0496104_0632394 Ga0496104_0632394_298_807 169
478 3300048908 Ga0496105_0005021 Ga0496105_0005021_4942_5451 169
479 3300048908 Ga0496105_0147028 Ga0496105_0147028_541_1140 169
480 3300048908 Ga0496105_0191474 Ga0496105_0191474_112_624 169
481 3300048909 Ga0496106_0059587 Ga0496106_0059587_1421_1930 169
482 3300048909 Ga0496106_0230376 Ga0496106_0230376_438_947 169
483 3300048909 Ga0496106_0549762 Ga0496106_0549762_118_630 169
484 3300048910 Ga0496107_0173502 Ga0496107_0173502_920_1435 169
485 3300048910 Ga0496107_0354899 Ga0496107_0354899_565_1077 169
486 3300048911 Ga0496108_0010916 Ga0496108_0010916_3314_3826 169
487 3300048911 Ga0496108_0071778 Ga0496108_0071778_1925_2434 169
488 3300048911 Ga0496108_0573538 Ga0496108_0573538_108_629 169
489 3300048911 Ga0496108_0588931 Ga0496108_0588931_74_583 169
490 3300048911 Ga0496108_0780298 Ga0496108_0780298_147_659 169
491 3300048912 Ga0496109_0001443 Ga0496109_0001443_2562_3074 169
492 3300048913 Ga0496110_0024131 Ga0496110_0024131_1217_1729 169
493 3300048913 Ga0496110_0228404 Ga0496110_0228404_1055_1567 169
494 3300048913 Ga0496110_0419356 Ga0496110_0419356_648_1163 169
495 3300048913 Ga0496110_1133173 Ga0496110_1133173_126_647 169
496 3300048914 Ga0496111_0436011 Ga0496111_0436011_143_655 169
497 3300048915 Ga0496112_0001558 Ga0496112_0001558_13013_13525 169
498 3300048915 Ga0496112_1010461 Ga0496112_1010461_107_619 169
499 3300048916 Ga0496113_0001483 Ga0496113_0001483_9222_9734 169
500 3300048916 Ga0496113_0010571 Ga0496113_0010571_2593_3102 169
501 3300048916 Ga0496113_0280507 Ga0496113_0280507_305_814 169
502 3300048917 Ga0496114_0000290 Ga0496114_0000290_11058_11567 169
503 3300048917 Ga0496114_0440600 Ga0496114_0440600_362_871 169
504 3300048917 Ga0496114_0949437 Ga0496114_0949437_145_654 169
505 3300048918 Ga0496115_0003155 Ga0496115_0003155_3039_3551 169
506 3300048918 Ga0496115_0019865 Ga0496115_0019865_1007_1516 169
507 3300048918 Ga0496115_0057623 Ga0496115_0057623_703_1218 169
508 3300048918 Ga0496115_0639186 Ga0496115_0639186_77_589 169
509 3300048919 Ga0496116_0273267 Ga0496116_0273267_151_666 169
510 3300048920 Ga0496117_0235143 Ga0496117_0235143_345_860 169
511 3300048921 Ga0496118_0175217 Ga0496118_0175217_484_999 169
512 3300048922 Ga0496119_0022738 Ga0496119_0022738_3329_3838 169
513 3300048923 Ga0496120_0036896 Ga0496120_0036896_1875_2384 169
514 3300048924 Ga0496121_0051244 Ga0496121_0051244_2337_2846 169
515 3300048925 Ga0496122_0007615 Ga0496122_0007615_6288_6803 169
516 3300048925 Ga0496122_0100923 Ga0496122_0100923_1059_1568 169
517 3300048925 Ga0496122_0278299 Ga0496122_0278299_84_593 169
518 3300048926 Ga0496123_0055689 Ga0496123_0055689_1572_2087 169
519 3300048927 Ga0496124_0082577 Ga0496124_0082577_2018_2533 169
520 3300048927 Ga0496124_0087867 Ga0496124_0087867_619_1128 169
521 3300048928 Ga0496125_0082641 Ga0496125_0082641_705_1214 169
522 3300048928 Ga0496125_0105615 Ga0496125_0105615_110_619 169
523 3300048929 Ga0496126_0031654 Ga0496126_0031654_3116_3625 169
524 3300048929 Ga0496126_0111250 Ga0496126_0111250_66_575 169
525 3300048929 Ga0496126_0302353 Ga0496126_0302353_672_1181 169
526 3300048929 Ga0496126_0853138 Ga0496126_0853138_61_570 169
527 3300049573 Ga0501037_0022439 Ga0501037_0022439_1670_2197 169
528 3300049592 Ga0501076_0154250 Ga0501076_0154250_289_798 169
529 3300049823 Ga0501044_0642380 Ga0501044_0642380_408_935 169
530 3300050490 nmdc:mga03n38_249516_c1 nmdc:mga03n38_249516_c1_380_895 169
531 3300050491 nmdc:mga00v17_27926_c1 nmdc:mga00v17_27926_c1_751_1260 169
532 3300050491 nmdc:mga00v17_349596_c1 nmdc:mga00v17_349596_c1_235_744 169
533 3300050492 nmdc:mga0yw44_147163_c1 nmdc:mga0yw44_147163_c1_790_1305 169
534 3300050492 nmdc:mga0yw44_26350_c1 nmdc:mga0yw44_26350_c1_2762_3271 169
535 3300050492 nmdc:mga0yw44_44148_c1 nmdc:mga0yw44_44148_c1_483_992 169
536 3300050496 nmdc:mga07m45_53861_c1 nmdc:mga07m45_53861_c1_1633_2142 169
537 3300050496 nmdc:mga07m45_78980_c1 nmdc:mga07m45_78980_c1_206_715 169
538 3300050511 nmdc:mga08y16_66783_c1 nmdc:mga08y16_66783_c1_1913_2422 169
539 3300050512 nmdc:mga0n895_18008_c1 nmdc:mga0n895_18008_c1_4142_4660 169
540 3300050514 nmdc:mga08x19_95333_c1 nmdc:mga08x19_95333_c1_224_742 169
541 3300050516 nmdc:mga0sz30_102683_c1 nmdc:mga0sz30_102683_c1_701_1210 169
542 3300050516 nmdc:mga0sz30_135110_c1 nmdc:mga0sz30_135110_c1_133_642 169
543 3300050516 nmdc:mga0sz30_44043_c1 nmdc:mga0sz30_44043_c1_637_1146 169
544 3300050516 nmdc:mga0sz30_86805_c1 nmdc:mga0sz30_86805_c1_417_929 169
545 3300053079 Ga0500610_0142079 Ga0500610_0142079_599_1108 169
546 3300053086 Ga0500578_0087490 Ga0500578_0087490_1277_1786 169
547 3300053087 Ga0500643_000163 Ga0500643_000163_33930_34439 169
548 3300053088 Ga0500644_0225983 Ga0500644_0225983_149_658 169
549 3300053090 Ga0500646_0026278 Ga0500646_0026278_405_914 169
550 3300053093 Ga0500651_0413484 Ga0500651_0413484_117_626 169
551 3300053094 Ga0500566_0000224 Ga0500566_0000224_158_667 169
552 3300053094 Ga0500566_0096883 Ga0500566_0096883_860_1369 169
553 3300053096 Ga0500641_0002734 Ga0500641_0002734_1829_2338 169
554 3300053096 Ga0500641_0016388 Ga0500641_0016388_122_631 169
555 3300053098 Ga0500650_0045589 Ga0500650_0045589_195_704 169
556 3300053098 Ga0500650_0112302 Ga0500650_0112302_373_882 169
557 3300053098 Ga0500650_0118657 Ga0500650_0118657_551_1060 169
558 3300053102 Ga0500554_053541 Ga0500554_053541_733_1242 169
559 3300053103 Ga0500555_001084 Ga0500555_001084_4589_5098 169
560 3300053104 Ga0500556_0027049 Ga0500556_0027049_814_1323 169
561 3300053108 Ga0500562_110308 Ga0500562_110308_42_596 169
562 3300053109 Ga0500569_164298 Ga0500569_164298_96_605 169
563 3300053111 Ga0500572_042735 Ga0500572_042735_80_589 169
564 3300053118 Ga0500594_0036703 Ga0500594_0036703_520_1029 169
565 3300053119 Ga0500595_005537 Ga0500595_005537_4054_4563 169
566 3300053119 Ga0500595_040507 Ga0500595_040507_446_955 169
567 3300053122 Ga0500608_046197 Ga0500608_046197_1288_1797 169
568 3300053130 Ga0500642_0007538 Ga0500642_0007538_2120_2629 169
569 3300053130 Ga0500642_0008075 Ga0500642_0008075_2315_2824 169
570 3300053136 Ga0500559_0063420 Ga0500559_0063420_924_1433 169
571 3300053138 Ga0500564_034892 Ga0500564_034892_25_534 169
572 3300053139 Ga0500568_0053420 Ga0500568_0053420_887_1396 169
573 3300053142 Ga0500577_0206153 Ga0500577_0206153_52_561 169
574 3300053146 Ga0500588_0001796 Ga0500588_0001796_177_686 169
575 3300053146 Ga0500588_0008929 Ga0500588_0008929_1253_1762 169
576 3300053146 Ga0500588_0021991 Ga0500588_0021991_761_1270 169
577 3300053148 Ga0500590_107781 Ga0500590_107781_440_949 169
578 3300053151 Ga0500604_0003195 Ga0500604_0003195_720_1229 169
579 3300053151 Ga0500604_0045994 Ga0500604_0045994_802_1311 169
580 3300053153 Ga0500616_0000705 Ga0500616_0000705_19537_20046 169
581 3300053153 Ga0500616_0060070 Ga0500616_0060070_1329_1838 169
582 3300053154 Ga0500619_056515 Ga0500619_056515_584_1093 169
583 3300053156 Ga0500622_0022826 Ga0500622_0022826_1797_2306 169
584 3300053157 Ga0500624_074124 Ga0500624_074124_142_651 169
585 3300053160 Ga0500633_0062579 Ga0500633_0062579_480_989 169
586 3300053177 Ga0500636_0000330 Ga0500636_0000330_24183_24692 169
587 3300053177 Ga0500636_0002418 Ga0500636_0002418_3181_3801 169
588 3300053731 Ga0500609_000476 Ga0500609_000476_1573_2082 169
589 3300053731 Ga0500609_001275 Ga0500609_001275_1612_2121 169
590 3300053731 Ga0500609_011550 Ga0500609_011550_280_789 169
591 3300053736 Ga0500599_012579 Ga0500599_012579_321_830 169
592 3300053737 Ga0500601_001460 Ga0500601_001460_167_676 169
593 iso_pu_bacteria 3003665799 3003666943 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

97

202

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ml8-assembly1.cif.gz_A-2 structural genomics 0.8668 62 157
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.8655 64 155
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.7887 63 161
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.7649 25 157
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.7593 61 160
ID Description Score Start End Superfamily
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9352 69 157 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8665 69 157 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8153 68 159 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8115 61 155 3.30.300.20
af_Q57993_77_188_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.797 45 155 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A2V6HIQ5-F1-model_v4 Peroxiredoxin 0.9926 1 169
AF-A0A4P5WPR6-F1-model_v4 Peroxiredoxin 0.9888 65 168
AF-A0A440JM30-F1-model_v4 deleted 0.9883 50 168
AF-A0A4Q0QJ12-F1-model_v4 OsmC family peroxiredoxin 0.9876 1 169
AF-A0A395KC67-F1-model_v4 deleted 0.987 1 168

Feature Viewer

pLDDT pTM Quality
94.03 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map