F467301

General Info

Members Datasets Scaffolds Average Seq Length
594 331 531 249

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100435569|Ga0070675_1004355691
Length 292
Sequence MQISICLFLQLPYFCPNSLYVSLVITTKDLIKSYRSRTVVDHVSIEVKQGEIVGLLGPNGAGKTTTFYMVVGLIKPDVGEVFLNEEEITKLPMYKRAQMGIGYLPQEASVFRKLSVEDNIMAVLEMTRLSKHQRKDKLESLIEEFNLHHVRKNNGDSLSGGERRRTEIARALAVDPKFILLDEPFAGVDPIAVEDIQSVVAKMKYKNIGILITDHNVNETLSICDRAYLLIDGKIFKHGTAEQLAEDEQVRRLYLGTNFELKRKDWIIDMARKGREGVTSTDIIEGLPGESK

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
3 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
4 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
5 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
6 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
7 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
8 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
9 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
10 2738541284 Pedobacter sp. YR016 Isolate Unclassified
11 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
12 2738541302 Pedobacter sp. CF074 Isolate Unclassified
13 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
14 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
15 2738543023 Pedobacter sp. OK628 Isolate Unclassified
16 2739367651 Pedobacter sp. OK291 Isolate Unclassified
17 2739367656 Pedobacter sp. CF523 Isolate Unclassified
18 2739367663 Pedobacter sp. YR510 Isolate Unclassified
19 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
20 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
21 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
22 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
23 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
24 2818991437 Pedobacter terrae 518 Isolate Unclassified
25 2818991444 Filimonas endophytica 3197 Isolate Unclassified
26 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
27 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
28 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
29 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
30 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
31 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
32 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
33 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
34 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
35 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
36 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
37 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
38 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
39 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
40 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
41 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
42 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
43 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
44 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
45 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
46 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
47 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
48 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
49 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
50 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
51 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
52 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
53 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
54 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
55 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
56 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
57 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
58 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
59 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
60 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
61 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
62 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
63 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
64 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
65 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
66 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
67 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
68 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
69 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
70 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
71 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
72 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
73 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
74 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
75 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
76 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
77 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
78 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
79 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
80 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
81 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
82 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
83 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
84 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
85 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
86 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
87 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
88 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
89 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
90 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
91 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
92 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
93 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
94 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
95 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
96 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
97 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
104 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
116 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
117 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
118 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
121 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
140 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
141 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
144 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
145 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
146 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
147 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
148 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
149 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
152 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
153 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
154 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
159 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
192 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
193 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
195 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
199 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
200 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
204 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
205 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
206 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
207 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
208 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
209 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
213 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
214 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
220 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
221 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
222 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
223 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
226 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
227 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
228 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
229 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
230 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
231 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
232 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
233 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
234 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
235 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
238 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
248 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
249 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
250 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
251 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
252 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
253 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
254 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
255 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
256 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
257 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
258 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
259 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
260 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
261 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
262 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
263 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
264 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
267 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
268 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
269 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
270 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
273 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
274 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
278 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
279 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
284 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
300 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
303 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
304 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
305 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
306 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
314 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
315 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
316 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
317 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
318 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
319 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
320 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
321 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
322 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
323 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
324 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
327 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
328 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
329 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
330 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
331 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.06
Metatranscriptomes 0.34
Isolates 10.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.26
Nodule 1.01
Rhizoplane 0.51
Rhizosphere 72.9
Stem 0
Stem Tuber 0
Unclassified 16.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10034722 3300001990 Bacteria 1563
2 JGI24735J21928_10010319 3300002067 Bacteria 2982
3 JGI24744J21845_10005688 3300002077 Bacteria 2582
4 JGI25162J39368_1001967 3300002737 Bacteria 9225
5 JGI25157J39369_1004597 3300002741 Bacteria 2456
6 JGI25152J39213_1000651 3300002773 Bacteria 18375
7 JGI25150J39212_1000005 3300002774 Bacteria 311800
8 JGI25150J39212_1002167 3300002774 Bacteria 5046
9 JGI25159J45721_1001172 3300002987 Bacteria 11186
10 JGI25159J45721_1003490 3300002987 Bacteria 5541
11 JGI25151J46595_10000004 3300003187 Bacteria 494006
12 JGI25151J46595_10013013 3300003187 Bacteria 3760
13 JGI25153J46596_10000004 3300003215 Bacteria 494006
14 rootH2_10205138 3300003320 Bacteria 3905
15 rootL2_10118505 3300003322 Bacteria 3258
16 Ga0006562J51391_1013169 3300003578 Bacteria 3230
17 Ga0055526_1007459 3300003771 Bacteria 5677
18 Ga0055536_1000526 3300003781 Bacteria 26477
19 Ga0055530_10001521 3300003791 Bacteria 16748
20 Ga0055540_1000176 3300003792 Bacteria 63046
21 Ga0055531_10001384 3300003794 Bacteria 17989
22 Ga0065714_10026342 3300005288 Bacteria 1679
23 Ga0065714_10064495 3300005288 Bacteria 48472
24 Ga0065714_10077582 3300005288 Bacteria 2676
25 Ga0065714_10096384 3300005288 Bacteria 1761
26 Ga0065714_10103932 3300005288 Bacteria 1583
27 Ga0065714_10221631 3300005288 Bacteria 839
28 Ga0065704_10077626 3300005289 Bacteria 4678
29 Ga0065715_10009462 3300005293 Bacteria 3323
30 Ga0070683_100361313 3300005329 Bacteria 1383
31 Ga0070682_100263410 3300005337 Bacteria 1248
32 Ga0070691_10005399 3300005341 Bacteria 5813
33 Ga0070675_100435569 3300005354 Bacteria 1174
34 Ga0070659_100043582 3300005366 Bacteria 3509
35 Ga0070709_10110332 3300005434 Bacteria 1848
36 Ga0070714_100004235 3300005435 Bacteria 10803
37 Ga0070714_100073926 3300005435 Bacteria 2954
38 Ga0070714_100231287 3300005435 Bacteria 1703
39 Ga0070714_100235558 3300005435 Bacteria 1688
40 Ga0070713_100100970 3300005436 Bacteria 2499
41 Ga0070708_100027258 3300005445 Bacteria 4901
42 Ga0070663_100101854 3300005455 Bacteria 2144
43 Ga0070678_100325966 3300005456 Bacteria 1313
44 Ga0070685_10201792 3300005466 Bacteria 1293
45 Ga0070707_100000171 3300005468 Bacteria 63131
46 Ga0070707_100025093 3300005468 Bacteria 5654
47 Ga0070707_100063972 3300005468 Bacteria 3531
48 Ga0070707_100067337 3300005468 Bacteria 3444
49 Ga0070707_100075812 3300005468 Bacteria 3244
50 Ga0070707_100104997 3300005468 Bacteria 2739
51 Ga0070707_100147600 3300005468 Bacteria 2289
52 Ga0070707_100154969 3300005468 Bacteria 2232
53 Ga0070707_100473858 3300005468 Bacteria 1213
54 Ga0070698_100000694 3300005471 Bacteria 35925
55 Ga0070698_100006669 3300005471 Bacteria 12519
56 Ga0070698_100071666 3300005471 Bacteria 3474
57 Ga0070698_100082122 3300005471 Bacteria 3215
58 Ga0070699_100032332 3300005518 Bacteria 4517
59 Ga0070699_100036559 3300005518 Bacteria 4248
60 Ga0070699_100198973 3300005518 Bacteria 1781
61 Ga0070684_100075075 3300005535 Bacteria 2981
62 Ga0070684_100359873 3300005535 Bacteria 1339
63 Ga0070697_100002369 3300005536 Bacteria 14497
64 Ga0070697_100013199 3300005536 Bacteria 6477
65 Ga0070697_100056988 3300005536 Bacteria 3179
66 Ga0070697_100104863 3300005536 Bacteria 2351
67 Ga0070697_100340843 3300005536 Unclassified 1293
68 Ga0070697_100613729 3300005536 Bacteria 956
69 Ga0068853_100132454 3300005539 Bacteria 2233
70 Ga0068853_100158246 3300005539 Bacteria 2042
71 Ga0068853_100561153 3300005539 Bacteria 1082
72 Ga0070665_100002492 3300005548 Bacteria 20261
73 Ga0068855_100000639 3300005563 Bacteria 42865
74 Ga0068855_100067372 3300005563 Bacteria 4171
75 Ga0068855_100180597 3300005563 Bacteria 2386
76 Ga0068857_100014021 3300005577 Bacteria 6975
77 Ga0068857_100633690 3300005577 Bacteria 1012
78 Ga0068854_100000002 3300005578 Bacteria 362695
79 Ga0068856_100001301 3300005614 Bacteria 26256
80 Ga0068856_100749380 3300005614 Bacteria 997
81 Ga0068852_100008184 3300005616 Bacteria 7683
82 Ga0068852_100343923 3300005616 Bacteria 1455
83 Ga0068852_100534312 3300005616 Bacteria 1171
84 Ga0068852_100821987 3300005616 Bacteria 944
85 Ga0068864_100106595 3300005618 Bacteria 2492
86 Ga0068851_10222343 3300005834 Bacteria 1061
87 Ga0068860_100133092 3300005843 Bacteria 2387
88 Ga0070717_10000082 3300006028 Bacteria 77627
89 Ga0070717_10014212 3300006028 Bacteria 6121
90 Ga0070717_10079087 3300006028 Bacteria 2756
91 Ga0075368_10007692 3300006042 Bacteria 3810
92 Ga0075363_100012832 3300006048 Bacteria 4045
93 Ga0070716_100017787 3300006173 Bacteria 3692
94 Ga0070716_100042882 3300006173 Bacteria 2527
95 Ga0070712_100085950 3300006175 Bacteria 2291
96 Ga0075362_10000562 3300006177 Bacteria 10810
97 Ga0075370_10120516 3300006353 Bacteria 1527
98 Ga0068871_100112458 3300006358 Bacteria 2292
99 Ga0068865_100641986 3300006881 Bacteria 901
100 Ga0099824_1000610 3300006942 Bacteria 43941
101 Ga0079104_1000091 3300006946 Bacteria 132682
102 Ga0099826_10000144 3300006948 Bacteria 30370
103 Ga0099795_10016509 3300007788 Bacteria 2336
104 Ga0105251_10147232 3300009011 Bacteria 1064
105 Ga0105244_10000027 3300009036 Bacteria 207569
106 Ga0105244_10147995 3300009036 Bacteria 1126
107 Ga0105250_10008636 3300009092 Bacteria 4317
108 Ga0105240_10042259 3300009093 Bacteria 5810
109 Ga0105240_10076482 3300009093 Bacteria 4126
110 Ga0105240_10389763 3300009093 Bacteria 1571
111 Ga0105240_10412701 3300009093 Bacteria 1518
112 Ga0105242_10004808 3300009176 Bacteria 10451
113 Ga0105237_10000650 3300009545 Bacteria 48489
114 Ga0105237_10303400 3300009545 Bacteria 1600
115 Ga0105237_10406082 3300009545 Bacteria 1367
116 Ga0105238_10386360 3300009551 Bacteria 1392
117 Ga0105239_10000014 3300010375 Bacteria 325391
118 Ga0105239_10002611 3300010375 Bacteria 22800
119 Ga0105239_10007091 3300010375 Bacteria 12902
120 Ga0105239_10036516 3300010375 Bacteria 5396
121 Ga0105239_10495112 3300010375 Bacteria 1389
122 Ga0157326_1000493 3300012513 Bacteria 4716
123 Ga0157373_10000047 3300013100 Bacteria 110376
124 Ga0157373_10006233 3300013100 Bacteria 8913
125 Ga0157373_10013646 3300013100 Bacteria 5957
126 Ga0157371_10000503 3300013102 Bacteria 47159
127 Ga0157371_10000571 3300013102 Bacteria 43698
128 Ga0157371_10012108 3300013102 Bacteria 6609
129 Ga0157371_10017902 3300013102 Bacteria 5253
130 Ga0157371_10192241 3300013102 Bacteria 1461
131 Ga0157370_10000154 3300013104 Bacteria 84734
132 Ga0157370_10001307 3300013104 Bacteria 31059
133 Ga0157370_10006256 3300013104 Bacteria 13182
134 Ga0157370_10011974 3300013104 Bacteria 9042
135 Ga0157370_10012517 3300013104 Bacteria 8795
136 Ga0157370_10023757 3300013104 Bacteria 6083
137 Ga0157370_10082592 3300013104 Bacteria 3022
138 Ga0157370_10101321 3300013104 Bacteria 2697
139 Ga0157370_10124962 3300013104 Bacteria 2402
140 Ga0157370_10225340 3300013104 Bacteria 1735
141 Ga0157370_10278608 3300013104 Bacteria 1545
142 Ga0157369_10000450 3300013105 Bacteria 54555
143 Ga0157369_10003997 3300013105 Bacteria 17494
144 Ga0157369_10161361 3300013105 Bacteria 2366
145 Ga0157369_10241062 3300013105 Bacteria 1889
146 Ga0157374_10033566 3300013296 Bacteria 4683
147 Ga0157378_10005510 3300013297 Bacteria 11093
148 Ga0157378_10206086 3300013297 Bacteria 1862
149 Ga0163162_10000073 3300013306 Bacteria 91871
150 Ga0163162_10312599 3300013306 Bacteria 1704
151 Ga0157372_10000432 3300013307 Bacteria 46220
152 Ga0157372_10023674 3300013307 Bacteria 6662
153 Ga0157372_10188198 3300013307 Bacteria 2390
154 Ga0157372_10222502 3300013307 Bacteria 2188
155 Ga0157372_10378366 3300013307 Bacteria 1650
156 Ga0157372_10468880 3300013307 Bacteria 1468
157 Ga0157372_10480258 3300013307 Bacteria 1449
158 Ga0157375_10015107 3300013308 Bacteria 6907
159 Ga0157375_10080026 3300013308 Bacteria 3304
160 Ga0182008_10000165 3300014497 Bacteria 51552
161 Ga0182008_10126868 3300014497 Bacteria 1271
162 Ga0157377_10249877 3300014745 Bacteria 1149
163 Ga0182006_1000064 3300015261 Bacteria 153418
164 Ga0182006_1000328 3300015261 Bacteria 41149
165 Ga0182006_1002390 3300015261 Bacteria 10288
166 Ga0182006_1009485 3300015261 Bacteria 4360
167 Ga0182006_1047352 3300015261 Bacteria 1667
168 Ga0182006_1065925 3300015261 Bacteria 1354
169 Ga0182007_10000016 3300015262 Bacteria 202375
170 Ga0183373_1011 3300015682 Bacteria 138873
171 Ga0163161_10000824 3300017792 Bacteria 24264
172 Ga0163161_10001346 3300017792 Bacteria 18290
173 Ga0163161_10080277 3300017792 Bacteria 2400
174 Ga0163161_10083929 3300017792 Bacteria 2349
175 Ga0163161_10591745 3300017792 Bacteria 914
176 Ga0213873_10000002 3300021358 Bacteria 1164195
177 Ga0213873_10000170 3300021358 Bacteria 12085
178 Ga0213873_10025349 3300021358 Bacteria 1430
179 Ga0213872_10002803 3300021361 Bacteria 9972
180 Ga0213872_10007483 3300021361 Bacteria 5370
181 Ga0213872_10048247 3300021361 Bacteria 1935
182 Ga0213872_10055775 3300021361 Bacteria 1790
183 Ga0213874_10002442 3300021377 Bacteria 4005
184 Ga0213874_10017729 3300021377 Bacteria 1914
185 Ga0213874_10042283 3300021377 Bacteria 1368
186 Ga0213876_10000001 3300021384 Bacteria 1186326
187 Ga0213876_10000080 3300021384 Bacteria 109125
188 Ga0213876_10000841 3300021384 Bacteria 20644
189 Ga0213876_10006318 3300021384 Unclassified 6455
190 Ga0213876_10156225 3300021384 Bacteria 1213
191 Ga0213875_10000001 3300021388 Bacteria 2793540
192 Ga0213875_10002299 3300021388 Bacteria 11574
193 Ga0213875_10018000 3300021388 Bacteria 3409
194 Ga0213875_10090630 3300021388 Bacteria 1426
195 Ga0213875_10137974 3300021388 Bacteria 1141
196 Ga0213875_10203767 3300021388 Bacteria 931
197 Ga0213871_10005781 3300021441 Bacteria 2579
198 Ga0213871_10048655 3300021441 Bacteria 1156
199 Ga0207427_107675 3300025231 Bacteria 1248
200 Ga0209437_100030 3300025233 Bacteria 532466
201 Ga0207425_1000008 3300025245 Bacteria 618024
202 Ga0207425_1003290 3300025245 Bacteria 5246
203 Ga0209026_1000310 3300025250 Bacteria 52783
204 Ga0209026_1005785 3300025250 Bacteria 3215
205 Ga0209129_1000040 3300025258 Bacteria 313043
206 Ga0209130_1001571 3300025284 Bacteria 14386
207 Ga0209676_1000013 3300025292 Bacteria 816080
208 Ga0209025_1000020 3300025294 Bacteria 618024
209 Ga0209025_1006033 3300025294 Bacteria 9587
210 Ga0209025_1021244 3300025294 Bacteria 3506
211 Ga0209564_1000579 3300025295 Bacteria 58010
212 Ga0209758_1000022 3300025297 Bacteria 618024
213 Ga0209758_1024796 3300025297 Bacteria 2658
214 Ga0209050_1000008 3300025298 Bacteria 1144179
215 Ga0207426_1000023 3300025302 Bacteria 545465
216 Ga0207426_1001868 3300025302 Bacteria 15446
217 Ga0209051_1000005 3300025303 Bacteria 1142353
218 Ga0209257_1000048 3300025304 Bacteria 455536
219 Ga0207655_1000038 3300025728 Bacteria 348340
220 Ga0207688_10032026 3300025901 Bacteria 2905
221 Ga0207647_10000080 3300025904 Bacteria 71854
222 Ga0207647_10053269 3300025904 Bacteria 2494
223 Ga0207684_10265479 3300025910 Bacteria 1481
224 Ga0207695_10013789 3300025913 Bacteria 9617
225 Ga0207695_10071813 3300025913 Bacteria 3534
226 Ga0207695_10494796 3300025913 Bacteria 1105
227 Ga0207671_10000340 3300025914 Bacteria 68615
228 Ga0207671_10049544 3300025914 Bacteria 3110
229 Ga0207671_10049578 3300025914 Bacteria 3109
230 Ga0207671_10180102 3300025914 Bacteria 1644
231 Ga0207693_10119116 3300025915 Bacteria 2073
232 Ga0207693_10194798 3300025915 Bacteria 1594
233 Ga0207646_10007675 3300025922 Bacteria 10922
234 Ga0207646_10008541 3300025922 Bacteria 10249
235 Ga0207646_10031393 3300025922 Bacteria 4809
236 Ga0207646_10058785 3300025922 Bacteria 3434
237 Ga0207646_10076305 3300025922 Bacteria 2994
238 Ga0207646_10107793 3300025922 Bacteria 2499
239 Ga0207646_10137419 3300025922 Bacteria 2201
240 Ga0207646_10238284 3300025922 Bacteria 1644
241 Ga0207646_10370394 3300025922 Bacteria 1294
242 Ga0207694_10195285 3300025924 Bacteria 1645
243 Ga0207659_10390854 3300025926 Bacteria 1162
244 Ga0207700_10037530 3300025928 Bacteria 3510
245 Ga0207664_10008638 3300025929 Bacteria 7120
246 Ga0207664_10138397 3300025929 Bacteria 2056
247 Ga0207664_10189209 3300025929 Bacteria 1771
248 Ga0207664_10204459 3300025929 Bacteria 1706
249 Ga0207690_10035752 3300025932 Bacteria 3211
250 Ga0207686_10003661 3300025934 Bacteria 8235
251 Ga0207686_10238563 3300025934 Bacteria 1322
252 Ga0207704_10468218 3300025938 Bacteria 1009
253 Ga0207665_10025657 3300025939 Bacteria 3889
254 Ga0207689_10227660 3300025942 Bacteria 1541
255 Ga0207661_10069997 3300025944 Bacteria 2863
256 Ga0207667_10000723 3300025949 Bacteria 42879
257 Ga0207667_10003736 3300025949 Bacteria 18780
258 Ga0207667_10249668 3300025949 Bacteria 1815
259 Ga0207640_10000006 3300025981 Bacteria 313289
260 Ga0207640_10195526 3300025981 Bacteria 1528
261 Ga0207640_10252911 3300025981 Bacteria 1369
262 Ga0207658_10249707 3300025986 Bacteria 1507
263 Ga0207703_10121162 3300026035 Bacteria 2246
264 Ga0207639_10125408 3300026041 Bacteria 2117
265 Ga0207639_10241821 3300026041 Bacteria 1570
266 Ga0207639_10457680 3300026041 Bacteria 1159
267 Ga0207678_10089312 3300026067 Bacteria 2634
268 Ga0207678_10102312 3300026067 Bacteria 2446
269 Ga0207702_10007208 3300026078 Bacteria 9515
270 Ga0207674_10059234 3300026116 Bacteria 3876
271 Ga0207683_10425986 3300026121 Bacteria 1222
272 Ga0207698_10005520 3300026142 Bacteria 7823
273 Ga0207698_10431654 3300026142 Bacteria 1267
274 Ga0207698_10522215 3300026142 Bacteria 1159
275 Ga0209281_1000671 3300027111 Bacteria 35798
276 Ga0209489_123305 3300027361 Bacteria 1188
277 Ga0209968_1002194 3300027526 Bacteria 2959
278 Ga0209282_1036863 3300027666 Bacteria 2944
279 Ga0265356_1000238 3300028017 Bacteria 10389
280 Ga0268266_10009751 3300028379 Bacteria 8447
281 Ga0268264_10394845 3300028381 Bacteria 1328
282 Ga0265319_1073845 3300028563 Bacteria 1090
283 Ga0265323_10082684 3300028653 Bacteria 1083
284 Ga0265322_10000582 3300028654 Bacteria 13833
285 Ga0307515_10034167 3300028794 Bacteria 8340
286 Ga0265338_10001615 3300028800 Bacteria 36054
287 Ga0265338_10034412 3300028800 Bacteria 4897
288 Ga0265338_10065254 3300028800 Bacteria 3160
289 Ga0265324_10000031 3300029957 Bacteria 126276
290 Ga0307511_10009303 3300030521 Bacteria 9790
291 Ga0316177_1026597 3300030731 Bacteria 10252
292 Ga0316176_1022262 3300030732 Bacteria 8520
293 Ga0316183_1044693 3300030742 Bacteria 20720
294 Ga0316181_1045180 3300030744 Bacteria 10796
295 Ga0316181_1109542 3300030744 Bacteria 2756
296 Ga0265765_1012766 3300030879 Bacteria 956
297 Ga0265330_10098079 3300031235 Bacteria 1255
298 Ga0265332_10027772 3300031238 Bacteria 2478
299 Ga0265325_10001483 3300031241 Bacteria 16540
300 Ga0265325_10006199 3300031241 Bacteria 7291
301 Ga0265325_10007334 3300031241 Bacteria 6609
302 Ga0265340_10018041 3300031247 Bacteria 3646
303 Ga0265339_10010373 3300031249 Bacteria 5791
304 Ga0265339_10231219 3300031249 Bacteria 901
305 Ga0265327_10050909 3300031251 Bacteria 2165
306 Ga0265316_10005344 3300031344 Bacteria 12515
307 Ga0265316_10037451 3300031344 Bacteria 3914
308 Ga0265316_10227224 3300031344 Bacteria 1375
309 Ga0307513_10000246 3300031456 Bacteria 78455
310 Ga0307513_10000256 3300031456 Bacteria 76296
311 Ga0307513_10226456 3300031456 Bacteria 1686
312 Ga0307408_100003034 3300031548 Bacteria 11594
313 Ga0307408_100003807 3300031548 Bacteria 10274
314 Ga0265313_10000215 3300031595 Bacteria 62030
315 Ga0265342_10008594 3300031712 Bacteria 7301
316 Ga0265342_10044888 3300031712 Bacteria 2662
317 Ga0316576_10038545 3300031727 Bacteria 3427
318 Ga0316578_10002633 3300031728 Bacteria 7959
319 Ga0307516_10004189 3300031730 Bacteria 17964
320 Ga0307516_10041065 3300031730 Bacteria 4601
321 Ga0307405_10000005 3300031731 Bacteria 376536
322 Ga0307405_10000023 3300031731 Bacteria 141450
323 Ga0307405_10030224 3300031731 Bacteria 3174
324 Ga0307405_10124618 3300031731 Bacteria 1769
325 Ga0307413_10000021 3300031824 Bacteria 41741
326 Ga0307410_10000151 3300031852 Bacteria 24899
327 Ga0307406_10000020 3300031901 Bacteria 98526
328 Ga0307406_10008580 3300031901 Bacteria 5706
329 Ga0307406_10022434 3300031901 Bacteria 3745
330 Ga0307407_10000059 3300031903 Bacteria 48015
331 Ga0307407_10009185 3300031903 Bacteria 4589
332 Ga0307412_10177668 3300031911 Bacteria 1598
333 Ga0307412_10420073 3300031911 Bacteria 1094
334 Ga0307412_10522990 3300031911 Bacteria 991
335 Ga0307409_100053757 3300031995 Bacteria 3097
336 Ga0307416_100000116 3300032002 Bacteria 47978
337 Ga0307416_100000211 3300032002 Bacteria 30454
338 Ga0307414_10000011 3300032004 Bacteria 338253
339 Ga0307414_10017360 3300032004 Bacteria 4400
340 Ga0307414_10029412 3300032004 Bacteria 3576
341 Ga0307414_10038450 3300032004 Bacteria 3214
342 Ga0307414_10163004 3300032004 Bacteria 1773
343 Ga0307411_10000004 3300032005 Bacteria 460327
344 Ga0307411_10164141 3300032005 Bacteria 1668
345 Ga0307411_10263184 3300032005 Bacteria 1363
346 Ga0316583_10078890 3300032133 Bacteria 1151
347 Ga0373944_0144927 3300035089 Bacteria 833
348 Ga0373947_0100628 3300035725 Bacteria 1816
349 Ga0316582_0292573 3300036647 Bacteria 1118
350 Ga0316584_0003038 3300036712 Bacteria 10807
351 Ga0316584_0031708 3300036712 Bacteria 3908
352 Ga0316584_0485748 3300036712 Bacteria 869
353 Ga0395899_0100177 3300037312 Bacteria 2092
354 Ga0395900_0052865 3300037418 Bacteria 4181
355 Ga0395900_0082370 3300037418 Bacteria 3306
356 Ga0395900_0524529 3300037418 Bacteria 1132
357 Ga0395898_0015142 3300037466 Bacteria 7916
358 Ga0395905_0000560 3300037471 Bacteria 50568
359 Ga0395905_0017789 3300037471 Bacteria 6751
360 Ga0395905_0101719 3300037471 Bacteria 2697
361 Ga0395905_0446751 3300037471 Bacteria 1191
362 Ga0436364_0178373 3300037853 Bacteria 15951
363 Ga0436364_0273345 3300037853 Bacteria 2794207
364 Ga0436364_0319955 3300037853 Bacteria 7180
365 Ga0436364_0385224 3300037853 Bacteria 1366
366 Ga0436364_0439424 3300037853 Bacteria 1045
367 Ga0436364_0575171 3300037853 Bacteria 2317
368 Ga0436364_0706226 3300037853 Bacteria 3404
369 Ga0436364_0732288 3300037853 Bacteria 3242
370 Ga0436364_0735947 3300037853 Bacteria 1134
371 Ga0436364_1300301 3300037853 Bacteria 1006
372 Ga0395901_0304577 3300038443 Bacteria 1651
373 Ga0395901_0858757 3300038443 Bacteria 892
374 Ga0400483_241986 3300039062 Unclassified 1335
375 Ga0436365_0404702 3300039437 Bacteria 45539
376 Ga0436365_0404975 3300039437 Bacteria 180420
377 Ga0436365_0719979 3300039437 Bacteria 52027
378 Ga0436365_1021547 3300039437 Bacteria 1074
379 Ga0436365_1049048 3300039437 Bacteria 1211
380 Ga0436365_1243729 3300039437 Bacteria 4131
381 Ga0436365_1635381 3300039437 Bacteria 3380
382 Ga0436365_1645708 3300039437 Bacteria 58473
383 Ga0436365_1758405 3300039437 Bacteria 1738
384 Ga0436360_0223866 3300039438 Bacteria 2637
385 Ga0436360_0395711 3300039438 Bacteria 3206
386 Ga0436360_0407461 3300039438 Bacteria 39705
387 Ga0436360_0700572 3300039438 Bacteria 1515
388 Ga0436360_0780262 3300039438 Bacteria 2462
389 Ga0436360_0882874 3300039438 Bacteria 1508
390 Ga0436360_0891128 3300039438 Bacteria 2625
391 Ga0436360_1007296 3300039438 Bacteria 8091
392 Ga0436360_1030917 3300039438 Bacteria 1951
393 Ga0436360_1061027 3300039438 Bacteria 1134
394 Ga0436360_1377273 3300039438 Bacteria 957
395 Ga0436361_0093534 3300039447 Bacteria 5371
396 Ga0436361_0221038 3300039447 Bacteria 5932
397 Ga0436361_0239735 3300039447 Bacteria 25433
398 Ga0436361_0313628 3300039447 Bacteria 35231
399 Ga0436361_0490065 3300039447 Bacteria 2548
400 Ga0436361_0818479 3300039447 Bacteria 29287
401 Ga0436361_1103455 3300039447 Bacteria 8641
402 Ga0436363_0461872 3300039450 Bacteria 118070
403 Ga0436363_0491107 3300039450 Bacteria 10896
404 Ga0436363_1208129 3300039450 Bacteria 2730
405 Ga0436363_1331416 3300039450 Bacteria 2770
406 Ga0436362_0302895 3300039453 Bacteria 2245
407 Ga0436362_0480821 3300039453 Bacteria 1177
408 Ga0436362_0604099 3300039453 Bacteria 1885
409 Ga0436362_0630989 3300039453 Bacteria 942
410 Ga0436362_0660519 3300039453 Bacteria 832172
411 Ga0436362_0840322 3300039453 Bacteria 7493
412 Ga0436362_0899075 3300039453 Bacteria 1021
413 Ga0436362_0940693 3300039453 Bacteria 930
414 Ga0436362_1241977 3300039453 Bacteria 25609
415 Ga0436362_1267084 3300039453 Bacteria 1781
416 Ga0439447_000444 3300041407 Bacteria 15417
417 Ga0439466_0002166 3300041411 Bacteria 7693
418 Ga0451791_0926619 3300041451 Bacteria 1080
419 Ga0451837_1370744 3300041494 Bacteria 891
420 Ga0451855_0117389 3300041511 Bacteria 1756
421 Ga0451855_2000359 3300041511 Bacteria 5484
422 Ga0451577_0000027 3300042876 Bacteria 397014
423 Ga0451577_0066422 3300042876 Bacteria 3217
424 Ga0451577_0103608 3300042876 Bacteria 2543
425 Ga0451577_0128398 3300042876 Bacteria 2273
426 Ga0451577_0161810 3300042876 Bacteria 2016
427 Ga0451577_0241842 3300042876 Bacteria 1633
428 Ga0453683_0000022 3300044673 Bacteria 269593
429 Ga0453683_0001094 3300044673 Bacteria 24893
430 Ga0453683_0019270 3300044673 Bacteria 4371
431 Ga0453683_0077863 3300044673 Bacteria 2076
432 Ga0466965_0248373 3300044683 Bacteria 954
433 Ga0466966_0017148 3300044684 Bacteria 4791
434 Ga0466963_0028886 3300044694 Bacteria 3565
435 Ga0466963_0065865 3300044694 Bacteria 2429
436 Ga0453684_0000154 3300044712 Bacteria 305062
437 Ga0453684_0000213 3300044712 Bacteria 253663
438 Ga0453684_0000967 3300044712 Bacteria 94647
439 Ga0453684_0005830 3300044712 Bacteria 23963
440 Ga0453684_0011432 3300044712 Bacteria 14891
441 Ga0453684_0033045 3300044712 Bacteria 7221
442 Ga0453684_0035249 3300044712 Bacteria 6921
443 Ga0453684_0040554 3300044712 Bacteria 6319
444 Ga0453684_0055350 3300044712 Bacteria 5159
445 Ga0453684_0132074 3300044712 Bacteria 2995
446 Ga0453684_0212921 3300044712 Bacteria 2245
447 Ga0453684_0257191 3300044712 Bacteria 2002
448 Ga0453684_0266886 3300044712 Bacteria 1958
449 Ga0453684_0277778 3300044712 Bacteria 1911
450 Ga0453684_0970984 3300044712 Bacteria 905
451 Ga0453684_1225636 3300044712 Unclassified 786
452 Ga0466957_0010485 3300044842 Bacteria 5326
453 Ga0451576_0000032 3300045051 Bacteria 397014
454 Ga0451576_0006696 3300045051 Bacteria 14051
455 Ga0451576_0018236 3300045051 Bacteria 7697
456 Ga0451576_0045233 3300045051 Bacteria 4637
457 Ga0451576_0222972 3300045051 Bacteria 1969
458 Ga0451576_0818997 3300045051 Bacteria 977
459 Ga0466958_0006203 3300045836 Bacteria 6490
460 Ga0466958_0047145 3300045836 Bacteria 2602
461 Ga0466967_0545388 3300045976 Bacteria 1141
462 Ga0495650_0098217 3300046471 Bacteria 1103
463 Ga0495606_0038039 3300046507 Bacteria 3259
464 Ga0495606_0087994 3300046507 Bacteria 1916
465 Ga0495610_0000098 3300046512 Bacteria 101620
466 Ga0495610_0002031 3300046512 Bacteria 17308
467 Ga0495616_0004654 3300046513 Bacteria 8612
468 Ga0495643_0000554 3300046522 Bacteria 46264
469 Ga0495644_0019474 3300046523 Bacteria 2591
470 Ga0495663_0014273 3300046525 Bacteria 2226
471 Ga0495654_0124579 3300046530 Bacteria 1162
472 Ga0495633_0028540 3300046558 Bacteria 2719
473 Ga0495625_0027261 3300046660 Bacteria 4304
474 Ga0495661_0041182 3300046665 Bacteria 2860
475 Ga0495677_0047580 3300047445 Bacteria 1575
476 Ga0495686_0003596 3300047472 Bacteria 13303
477 Ga0495615_0011642 3300048090 Bacteria 1795
478 Ga0496115_0020081 3300048918 Bacteria 5148
479 Ga0496115_0222062 3300048918 Bacteria 1559
480 Ga0496116_0000024 3300048919 Bacteria 471420
481 Ga0496117_0112964 3300048920 Bacteria 1688
482 Ga0496121_0042859 3300048924 Bacteria 3929
483 Ga0496123_0073904 3300048926 Bacteria 2113
484 Ga0496124_0021869 3300048927 Bacteria 5884
485 Ga0496125_0000031 3300048928 Bacteria 365156
486 Ga0496126_0011956 3300048929 Bacteria 8921
487 Ga0496126_0058034 3300048929 Bacteria 3490
488 Ga0501031_0010536 3300049568 Bacteria 6018
489 Ga0501032_0004537 3300049569 Bacteria 10446
490 Ga0501033_0000027 3300049570 Bacteria 166571
491 Ga0501034_0001590 3300049571 Bacteria 29553
492 Ga0501034_0576178 3300049571 Bacteria 1033
493 Ga0501036_0075317 3300049572 Bacteria 2854
494 Ga0501037_0005602 3300049573 Bacteria 9153
495 Ga0501038_0004024 3300049574 Bacteria 13664
496 Ga0501039_0004123 3300049575 Bacteria 10927
497 Ga0501043_0002197 3300049579 Bacteria 16637
498 Ga0501046_0000012 3300049580 Bacteria 314417
499 Ga0501048_0086237 3300049582 Bacteria 2215
500 Ga0501223_002272 3300049663 Bacteria 4297
501 Ga0501249_000029 3300049679 Bacteria 86766
502 Ga0501249_012179 3300049679 Bacteria 1814
503 Ga0501080_0207215 3300049742 Bacteria 1798
504 Ga0501241_001759 3300049758 Bacteria 4302
505 Ga0501266_000002 3300049763 Bacteria 459947
506 Ga0501267_011193 3300049764 Bacteria 912
507 Ga0501269_002275 3300049766 Bacteria 2384
508 Ga0501280_000161 3300049776 Bacteria 17488
509 Ga0501035_0032376 3300049822 Bacteria 4757
510 Ga0501044_0050301 3300049823 Bacteria 4301
511 Ga0501045_0000829 3300049824 Bacteria 20003
512 nmdc:mga03683_347_c1 3300050489 Bacteria 13548
513 nmdc:mga0k408_1563_c1 3300050493 Unclassified 12367
514 nmdc:mga0k408_2281_c1 3300050493 Bacteria 10241
515 nmdc:mga07m45_12103_c1 3300050496 Bacteria 1539
516 Ga0500644_0009448 3300053088 Bacteria 2608
517 Ga0500651_0000004 3300053093 Bacteria 389879
518 Ga0500641_0000028 3300053096 Bacteria 105996
519 Ga0500641_0000201 3300053096 Bacteria 22448
520 Ga0500641_0000602 3300053096 Bacteria 12962
521 Ga0500555_000713 3300053103 Bacteria 12553
522 Ga0500556_0000132 3300053104 Bacteria 63554
523 Ga0500593_006131 3300053117 Bacteria 4795
524 Ga0500593_074246 3300053117 Bacteria 1471
525 Ga0500642_0006878 3300053130 Unclassified 3783
526 Ga0500655_020772 3300053133 Bacteria 1228
527 Ga0500658_0000002 3300053134 Bacteria 548440
528 Ga0500559_0119394 3300053136 Bacteria 1225
529 Ga0500584_004413 3300053726 Bacteria 5765
530 Ga0500645_082292 3300053730 Bacteria 918
531 Ga0501082_0052420 3300060353 Bacteria 3517

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0491107 Ga0436363_0491107_2425_3093 213
2 3300013307 Ga0157372_10023674 Ga0157372_100236747 219
3 3300035089 Ga0373944_0144927 Ga0373944_0144927_19_765 219
4 3300035725 Ga0373947_0100628 Ga0373947_0100628_1016_1798 219
5 3300053117 Ga0500593_074246 Ga0500593_074246_420_1097 219
6 3300049742 Ga0501080_0207215 Ga0501080_0207215_1062_1778 222
7 3300021361 Ga0213872_10007483 Ga0213872_100074832 223
8 3300039447 Ga0436361_1103455 Ga0436361_1103455_1799_2581 223
9 3300039453 Ga0436362_0899075 Ga0436362_0899075_49_831 223
10 3300046471 Ga0495650_0098217 Ga0495650_0098217_63_857 223
11 3300021361 Ga0213872_10002803 Ga0213872_100028038 224
12 3300039438 Ga0436360_0891128 Ga0436360_0891128_1344_2126 224
13 3300039453 Ga0436362_0604099 Ga0436362_0604099_832_1614 224
14 3300005329 Ga0070683_100361313 Ga0070683_1003613131 226
15 3300005535 Ga0070684_100075075 Ga0070684_1000750752 226
16 3300005539 Ga0068853_100561153 Ga0068853_1005611531 226
17 3300005577 Ga0068857_100633690 Ga0068857_1006336901 226
18 3300031727 Ga0316576_10038545 Ga0316576_100385453 227
19 3300031728 Ga0316578_10002633 Ga0316578_100026334 227
20 3300036647 Ga0316582_0292573 Ga0316582_0292573_72_797 227
21 3300036712 Ga0316584_0031708 Ga0316584_0031708_960_1685 227
22 3300005468 Ga0070707_100154969 Ga0070707_1001549692 228
23 3300005616 Ga0068852_100821987 Ga0068852_1008219871 228
24 3300025922 Ga0207646_10137419 Ga0207646_101374192 228
25 3300005341 Ga0070691_10005399 Ga0070691_100053994 230
26 3300005445 Ga0070708_100027258 Ga0070708_1000272585 230
27 3300005468 Ga0070707_100104997 Ga0070707_1001049974 230
28 3300005471 Ga0070698_100000694 Ga0070698_10000069419 230
29 3300005518 Ga0070699_100198973 Ga0070699_1001989732 230
30 3300005536 Ga0070697_100013199 Ga0070697_1000131996 230
31 3300005536 Ga0070697_100340843 Ga0070697_1003408432 230
32 3300005616 Ga0068852_100008184 Ga0068852_1000081841 230
33 3300006028 Ga0070717_10014212 Ga0070717_100142122 230
34 3300006173 Ga0070716_100042882 Ga0070716_1000428823 230
35 3300007788 Ga0099795_10016509 Ga0099795_100165092 230
36 3300009093 Ga0105240_10076482 Ga0105240_100764822 230
37 3300009551 Ga0105238_10386360 Ga0105238_103863602 230
38 3300013102 Ga0157371_10192241 Ga0157371_101922412 230
39 3300013105 Ga0157369_10241062 Ga0157369_102410622 230
40 3300013296 Ga0157374_10033566 Ga0157374_100335665 230
41 3300021361 Ga0213872_10048247 Ga0213872_100482473 230
42 3300021377 Ga0213874_10017729 Ga0213874_100177292 230
43 3300021384 Ga0213876_10000841 Ga0213876_1000084114 230
44 3300021441 Ga0213871_10005781 Ga0213871_100057813 230
45 3300025913 Ga0207695_10494796 Ga0207695_104947962 230
46 3300025922 Ga0207646_10058785 Ga0207646_100587854 230
47 3300025924 Ga0207694_10195285 Ga0207694_101952852 230
48 3300025929 Ga0207664_10189209 Ga0207664_101892093 230
49 3300025939 Ga0207665_10025657 Ga0207665_100256575 230
50 3300026067 Ga0207678_10102312 Ga0207678_101023123 230
51 3300026142 Ga0207698_10005520 Ga0207698_100055201 230
52 3300031241 Ga0265325_10006199 Ga0265325_100061993 230
53 3300031241 Ga0265325_10007334 Ga0265325_100073346 230
54 3300031247 Ga0265340_10018041 Ga0265340_100180413 230
55 3300031249 Ga0265339_10231219 Ga0265339_102312192 230
56 3300031344 Ga0265316_10227224 Ga0265316_102272242 230
57 3300031712 Ga0265342_10044888 Ga0265342_100448882 230
58 3300031730 Ga0307516_10041065 Ga0307516_100410654 230
59 3300037853 Ga0436364_0575171 Ga0436364_0575171_948_1694 230
60 3300039437 Ga0436365_0719979 Ga0436365_0719979_36801_37583 230
61 3300039437 Ga0436365_1243729 Ga0436365_1243729_3019_3801 230
62 3300039438 Ga0436360_0223866 Ga0436360_0223866_1126_1914 230
63 3300039438 Ga0436360_1007296 Ga0436360_1007296_5795_6583 230
64 3300039447 Ga0436361_0093534 Ga0436361_0093534_2337_3125 230
65 3300039453 Ga0436362_0630989 Ga0436362_0630989_94_840 230
66 3300005468 Ga0070707_100147600 Ga0070707_1001476003 231
67 3300005536 Ga0070697_100613729 Ga0070697_1006137291 231
68 3300005563 Ga0068855_100067372 Ga0068855_1000673722 231
69 3300025922 Ga0207646_10238284 Ga0207646_102382843 231
70 3300025949 Ga0207667_10003736 Ga0207667_1000373611 231
71 3300037853 Ga0436364_0439424 Ga0436364_0439424_206_982 231
72 3300028800 Ga0265338_10001615 Ga0265338_1000161510 232
73 3300028800 Ga0265338_10065254 Ga0265338_100652542 232
74 3300030879 Ga0265765_1012766 Ga0265765_10127661 232
75 3300031238 Ga0265332_10027772 Ga0265332_100277722 232
76 3300031241 Ga0265325_10001483 Ga0265325_100014839 232
77 3300031249 Ga0265339_10010373 Ga0265339_100103736 232
78 3300031344 Ga0265316_10005344 Ga0265316_1000534411 232
79 3300031595 Ga0265313_10000215 Ga0265313_1000021537 232
80 3300031712 Ga0265342_10008594 Ga0265342_100085942 232
81 3300005563 Ga0068855_100000639 Ga0068855_10000063936 233
82 3300021441 Ga0213871_10048655 Ga0213871_100486552 233
83 3300025915 Ga0207693_10119116 Ga0207693_101191163 233
84 3300025949 Ga0207667_10000723 Ga0207667_1000072311 233
85 3300026041 Ga0207639_10241821 Ga0207639_102418212 233
86 3300039438 Ga0436360_0395711 Ga0436360_0395711_2421_3167 233
87 3300039437 Ga0436365_1049048 Ga0436365_1049048_280_1062 234
88 3300044684 Ga0466966_0017148 Ga0466966_0017148_3413_4135 235
89 3300044694 Ga0466963_0028886 Ga0466963_0028886_2752_3471 235
90 3300017792 Ga0163161_10001346 Ga0163161_100013469 236
91 3300005455 Ga0070663_100101854 Ga0070663_1001018542 237
92 3300005539 Ga0068853_100158246 Ga0068853_1001582462 237
93 3300005616 Ga0068852_100534312 Ga0068852_1005343122 237
94 3300021358 Ga0213873_10025349 Ga0213873_100253492 237
95 3300026041 Ga0207639_10457680 Ga0207639_104576802 237
96 3300026067 Ga0207678_10089312 Ga0207678_100893122 237
97 3300026142 Ga0207698_10522215 Ga0207698_105222152 237
98 iso_pu_bacteria 2738541273 2738701295 237
99 iso_pu_bacteria 2738543014 2739255593 237
100 3300021388 Ga0213875_10018000 Ga0213875_100180003 238
101 3300036712 Ga0316584_0485748 Ga0316584_0485748_79_801 238
102 3300037853 Ga0436364_0319955 Ga0436364_0319955_5071_5823 238
103 3300037853 Ga0436364_0706226 Ga0436364_0706226_1682_2434 238
104 3300039447 Ga0436361_0221038 Ga0436361_0221038_598_1326 238
105 3300002774 JGI25150J39212_1002167 JGI25150J39212_10021673 239
106 3300002987 JGI25159J45721_1001172 JGI25159J45721_10011725 239
107 3300002987 JGI25159J45721_1003490 JGI25159J45721_10034903 239
108 3300003187 JGI25151J46595_10013013 JGI25151J46595_100130133 239
109 3300003771 Ga0055526_1007459 Ga0055526_10074593 239
110 3300003781 Ga0055536_1000526 Ga0055536_10005262 239
111 3300003791 Ga0055530_10001521 Ga0055530_100015218 239
112 3300003792 Ga0055540_1000176 Ga0055540_100017629 239
113 3300003794 Ga0055531_10001384 Ga0055531_100013848 239
114 3300005434 Ga0070709_10110332 Ga0070709_101103323 239
115 3300005435 Ga0070714_100004235 Ga0070714_1000042353 239
116 3300005435 Ga0070714_100073926 Ga0070714_1000739264 239
117 3300005435 Ga0070714_100231287 Ga0070714_1002312872 239
118 3300005435 Ga0070714_100235558 Ga0070714_1002355582 239
119 3300005468 Ga0070707_100000171 Ga0070707_10000017117 239
120 3300005468 Ga0070707_100025093 Ga0070707_1000250933 239
121 3300005468 Ga0070707_100063972 Ga0070707_1000639723 239
122 3300005468 Ga0070707_100067337 Ga0070707_1000673374 239
123 3300005468 Ga0070707_100473858 Ga0070707_1004738582 239
124 3300005471 Ga0070698_100006669 Ga0070698_1000066699 239
125 3300005471 Ga0070698_100071666 Ga0070698_1000716664 239
126 3300005518 Ga0070699_100036559 Ga0070699_1000365592 239
127 3300005536 Ga0070697_100002369 Ga0070697_10000236915 239
128 3300005536 Ga0070697_100056988 Ga0070697_1000569884 239
129 3300005539 Ga0068853_100132454 Ga0068853_1001324543 239
130 3300005578 Ga0068854_100000002 Ga0068854_100000002157 239
131 3300005614 Ga0068856_100001301 Ga0068856_10000130118 239
132 3300006028 Ga0070717_10079087 Ga0070717_100790872 239
133 3300006042 Ga0075368_10007692 Ga0075368_100076922 239
134 3300006048 Ga0075363_100012832 Ga0075363_1000128322 239
135 3300006173 Ga0070716_100017787 Ga0070716_1000177872 239
136 3300006177 Ga0075362_10000562 Ga0075362_100005626 239
137 3300006353 Ga0075370_10120516 Ga0075370_101205161 239
138 3300010375 Ga0105239_10495112 Ga0105239_104951122 239
139 3300012513 Ga0157326_1000493 Ga0157326_10004933 239
140 3300013102 Ga0157371_10012108 Ga0157371_100121086 239
141 3300013297 Ga0157378_10206086 Ga0157378_102060863 239
142 3300013307 Ga0157372_10222502 Ga0157372_102225022 239
143 3300021358 Ga0213873_10000170 Ga0213873_1000017012 239
144 3300021361 Ga0213872_10055775 Ga0213872_100557752 239
145 3300021377 Ga0213874_10002442 Ga0213874_100024421 239
146 3300021377 Ga0213874_10042283 Ga0213874_100422832 239
147 3300021384 Ga0213876_10006318 Ga0213876_100063185 239
148 3300021384 Ga0213876_10156225 Ga0213876_101562252 239
149 3300021388 Ga0213875_10000001 Ga0213875_100000011413 239
150 3300021388 Ga0213875_10002299 Ga0213875_100022993 239
151 3300021388 Ga0213875_10090630 Ga0213875_100906302 239
152 3300021388 Ga0213875_10137974 Ga0213875_101379742 239
153 3300021388 Ga0213875_10203767 Ga0213875_102037671 239
154 3300025245 Ga0207425_1003290 Ga0207425_10032904 239
155 3300025284 Ga0209130_1001571 Ga0209130_10015718 239
156 3300025292 Ga0209676_1000013 Ga0209676_1000013228 239
157 3300025294 Ga0209025_1006033 Ga0209025_10060338 239
158 3300025294 Ga0209025_1021244 Ga0209025_10212443 239
159 3300025295 Ga0209564_1000579 Ga0209564_100057910 239
160 3300025297 Ga0209758_1024796 Ga0209758_10247962 239
161 3300025298 Ga0209050_1000008 Ga0209050_1000008228 239
162 3300025302 Ga0207426_1001868 Ga0207426_10018682 239
163 3300025303 Ga0209051_1000005 Ga0209051_1000005228 239
164 3300025304 Ga0209257_1000048 Ga0209257_1000048228 239
165 3300025910 Ga0207684_10265479 Ga0207684_102654792 239
166 3300025922 Ga0207646_10007675 Ga0207646_100076755 239
167 3300025922 Ga0207646_10008541 Ga0207646_100085415 239
168 3300025922 Ga0207646_10031393 Ga0207646_100313935 239
169 3300025922 Ga0207646_10076305 Ga0207646_100763054 239
170 3300025922 Ga0207646_10370394 Ga0207646_103703942 239
171 3300025929 Ga0207664_10008638 Ga0207664_100086383 239
172 3300025929 Ga0207664_10138397 Ga0207664_101383973 239
173 3300025929 Ga0207664_10204459 Ga0207664_102044592 239
174 3300025981 Ga0207640_10000006 Ga0207640_10000006155 239
175 3300026041 Ga0207639_10125408 Ga0207639_101254081 239
176 3300026078 Ga0207702_10007208 Ga0207702_1000720810 239
177 3300028017 Ga0265356_1000238 Ga0265356_10002388 239
178 3300028800 Ga0265338_10034412 Ga0265338_100344122 239
179 3300031456 Ga0307513_10000246 Ga0307513_1000024627 239
180 3300031456 Ga0307513_10000256 Ga0307513_1000025632 239
181 3300031456 Ga0307513_10226456 Ga0307513_102264562 239
182 3300031730 Ga0307516_10004189 Ga0307516_1000418912 239
183 3300031901 Ga0307406_10022434 Ga0307406_100224343 239
184 3300037312 Ga0395899_0100177 Ga0395899_0100177_85_873 239
185 3300037418 Ga0395900_0052865 Ga0395900_0052865_2155_2943 239
186 3300037418 Ga0395900_0082370 Ga0395900_0082370_242_1030 239
187 3300037466 Ga0395898_0015142 Ga0395898_0015142_4965_5753 239
188 3300037471 Ga0395905_0000560 Ga0395905_0000560_21061_21849 239
189 3300037471 Ga0395905_0017789 Ga0395905_0017789_5256_6044 239
190 3300037471 Ga0395905_0101719 Ga0395905_0101719_1359_2147 239
191 3300037471 Ga0395905_0446751 Ga0395905_0446751_358_1077 239
192 3300037853 Ga0436364_0178373 Ga0436364_0178373_1783_2547 239
193 3300037853 Ga0436364_0273345 Ga0436364_0273345_1471673_1472416 239
194 3300037853 Ga0436364_0385224 Ga0436364_0385224_149_895 239
195 3300037853 Ga0436364_0732288 Ga0436364_0732288_683_1426 239
196 3300037853 Ga0436364_0735947 Ga0436364_0735947_92_811 239
197 3300037853 Ga0436364_1300301 Ga0436364_1300301_228_983 239
198 3300038443 Ga0395901_0304577 Ga0395901_0304577_318_1106 239
199 3300038443 Ga0395901_0858757 Ga0395901_0858757_27_815 239
200 3300039062 Ga0400483_241986 Ga0400483_241986_62_790 239
201 3300039437 Ga0436365_0404702 Ga0436365_0404702_27768_28514 239
202 3300039437 Ga0436365_1021547 Ga0436365_1021547_183_935 239
203 3300039437 Ga0436365_1635381 Ga0436365_1635381_2455_3201 239
204 3300039437 Ga0436365_1758405 Ga0436365_1758405_541_1317 239
205 3300039438 Ga0436360_0407461 Ga0436360_0407461_23241_24008 239
206 3300039438 Ga0436360_0700572 Ga0436360_0700572_546_1301 239
207 3300039438 Ga0436360_0780262 Ga0436360_0780262_549_1304 239
208 3300039438 Ga0436360_0882874 Ga0436360_0882874_756_1496 239
209 3300039438 Ga0436360_1030917 Ga0436360_1030917_807_1589 239
210 3300039438 Ga0436360_1061027 Ga0436360_1061027_271_1026 239
211 3300039438 Ga0436360_1377273 Ga0436360_1377273_48_791 239
212 3300039447 Ga0436361_0239735 Ga0436361_0239735_6312_7058 239
213 3300039447 Ga0436361_0313628 Ga0436361_0313628_176_922 239
214 3300039447 Ga0436361_0490065 Ga0436361_0490065_1461_2207 239
215 3300039447 Ga0436361_0818479 Ga0436361_0818479_8534_9301 239
216 3300039450 Ga0436363_0461872 Ga0436363_0461872_64776_65522 239
217 3300039450 Ga0436363_1208129 Ga0436363_1208129_242_991 239
218 3300039450 Ga0436363_1331416 Ga0436363_1331416_562_1311 239
219 3300039453 Ga0436362_0302895 Ga0436362_0302895_244_990 239
220 3300039453 Ga0436362_0480821 Ga0436362_0480821_121_867 239
221 3300039453 Ga0436362_0840322 Ga0436362_0840322_809_1564 239
222 3300039453 Ga0436362_0940693 Ga0436362_0940693_75_821 239
223 3300039453 Ga0436362_1241977 Ga0436362_1241977_10679_11425 239
224 3300039453 Ga0436362_1267084 Ga0436362_1267084_116_892 239
225 3300044694 Ga0466963_0065865 Ga0466963_0065865_1228_1995 239
226 3300044712 Ga0453684_0257191 Ga0453684_0257191_12_734 239
227 3300044712 Ga0453684_0277778 Ga0453684_0277778_468_1208 239
228 3300044712 Ga0453684_1225636 Ga0453684_1225636_46_768 239
229 3300044842 Ga0466957_0010485 Ga0466957_0010485_3080_3847 239
230 3300045836 Ga0466958_0006203 Ga0466958_0006203_1959_2726 239
231 3300045836 Ga0466958_0047145 Ga0466958_0047145_1295_2035 239
232 3300045976 Ga0466967_0545388 Ga0466967_0545388_73_813 239
233 3300046525 Ga0495663_0014273 Ga0495663_0014273_446_1240 239
234 3300047472 Ga0495686_0003596 Ga0495686_0003596_5235_5960 239
235 3300050489 nmdc:mga03683_347_c1 nmdc:mga03683_347_c1_5728_6510 239
236 3300050493 nmdc:mga0k408_1563_c1 nmdc:mga0k408_1563_c1_10152_10892 239
237 3300050493 nmdc:mga0k408_2281_c1 nmdc:mga0k408_2281_c1_1244_2026 239
238 3300050496 nmdc:mga07m45_12103_c1 nmdc:mga07m45_12103_c1_39_821 239
239 3300053088 Ga0500644_0009448 Ga0500644_0009448_1543_2325 239
240 3300053103 Ga0500555_000713 Ga0500555_000713_8032_8814 239
241 3300053104 Ga0500556_0000132 Ga0500556_0000132_38514_39296 239
242 3300053117 Ga0500593_006131 Ga0500593_006131_2735_3517 239
243 3300053130 Ga0500642_0006878 Ga0500642_0006878_1464_2246 239
244 3300053133 Ga0500655_020772 Ga0500655_020772_263_1045 239
245 3300053730 Ga0500645_082292 Ga0500645_082292_51_833 239
246 3300005436 Ga0070713_100100970 Ga0070713_1001009702 240
247 3300005468 Ga0070707_100075812 Ga0070707_1000758122 240
248 3300005471 Ga0070698_100082122 Ga0070698_1000821222 240
249 3300005518 Ga0070699_100032332 Ga0070699_1000323323 240
250 3300005536 Ga0070697_100104863 Ga0070697_1001048632 240
251 3300006028 Ga0070717_10000082 Ga0070717_1000008273 240
252 3300006175 Ga0070712_100085950 Ga0070712_1000859502 240
253 3300009176 Ga0105242_10004808 Ga0105242_1000480811 240
254 3300021358 Ga0213873_10000002 Ga0213873_10000002896 240
255 3300021384 Ga0213876_10000001 Ga0213876_10000001979 240
256 3300021384 Ga0213876_10000080 Ga0213876_1000008045 240
257 3300025915 Ga0207693_10194798 Ga0207693_101947982 240
258 3300025922 Ga0207646_10107793 Ga0207646_101077932 240
259 3300025928 Ga0207700_10037530 Ga0207700_100375302 240
260 3300025934 Ga0207686_10003661 Ga0207686_100036619 240
261 3300029957 Ga0265324_10000031 Ga0265324_1000003142 240
262 3300030521 Ga0307511_10009303 Ga0307511_100093033 240
263 3300039437 Ga0436365_0404975 Ga0436365_0404975_116956_117714 240
264 3300039437 Ga0436365_1645708 Ga0436365_1645708_39919_40707 240
265 3300039453 Ga0436362_0660519 Ga0436362_0660519_30293_31051 240
266 3300042876 Ga0451577_0066422 Ga0451577_0066422_2156_2878 240
267 3300042876 Ga0451577_0128398 Ga0451577_0128398_1333_2121 240
268 3300042876 Ga0451577_0161810 Ga0451577_0161810_826_1548 240
269 3300042876 Ga0451577_0241842 Ga0451577_0241842_318_1040 240
270 3300044673 Ga0453683_0000022 Ga0453683_0000022_14701_15423 240
271 3300044673 Ga0453683_0077863 Ga0453683_0077863_1039_1761 240
272 3300044712 Ga0453684_0000213 Ga0453684_0000213_16032_16754 240
273 3300044712 Ga0453684_0000967 Ga0453684_0000967_75890_76612 240
274 3300044712 Ga0453684_0035249 Ga0453684_0035249_4647_5369 240
275 3300044712 Ga0453684_0055350 Ga0453684_0055350_2536_3258 240
276 3300044712 Ga0453684_0970984 Ga0453684_0970984_151_873 240
277 3300045051 Ga0451576_0018236 Ga0451576_0018236_6001_6723 240
278 3300046665 Ga0495661_0041182 Ga0495661_0041182_38_766 240
279 3300049580 Ga0501046_0000012 Ga0501046_0000012_290503_291225 240
280 3300053093 Ga0500651_0000004 Ga0500651_0000004_387560_388288 240
281 3300060353 Ga0501082_0052420 Ga0501082_0052420_218_940 240
282 iso_pu_bacteria 2738541284 2738764065 240
283 iso_pu_bacteria 2738543023 2739302832 240
284 iso_pu_bacteria 2775506987 2776616450 240
285 iso_pu_bacteria 2852627209 2852629547 240
286 iso_pu_bacteria 2896317667 2896321124 240
287 iso_pu_bacteria 2902048731 2902050903 240
288 iso_pu_bacteria 2919186247 2919191203 240
289 iso_pu_bacteria 2939664404 2939669482 240
290 iso_pu_bacteria 3003233435 3003235601 240
291 iso_pu_bacteria 8055588893 8055590839 240
292 3300003322 rootL2_10118505 rootL2_101185054 241
293 3300005843 Ga0068860_100133092 Ga0068860_1001330924 241
294 3300013307 Ga0157372_10188198 Ga0157372_101881982 241
295 3300028381 Ga0268264_10394845 Ga0268264_103948452 241
296 3300028563 Ga0265319_1073845 Ga0265319_10738452 241
297 3300042876 Ga0451577_0000027 Ga0451577_0000027_194643_195368 241
298 3300042876 Ga0451577_0103608 Ga0451577_0103608_762_1487 241
299 3300044673 Ga0453683_0001094 Ga0453683_0001094_2018_2743 241
300 3300044712 Ga0453684_0000154 Ga0453684_0000154_102691_103416 241
301 3300044712 Ga0453684_0005830 Ga0453684_0005830_6582_7307 241
302 3300044712 Ga0453684_0033045 Ga0453684_0033045_2494_3222 241
303 3300044712 Ga0453684_0266886 Ga0453684_0266886_284_1009 241
304 3300045051 Ga0451576_0000032 Ga0451576_0000032_201647_202372 241
305 3300045051 Ga0451576_0045233 Ga0451576_0045233_3565_4290 241
306 3300045051 Ga0451576_0222972 Ga0451576_0222972_749_1474 241
307 3300013307 Ga0157372_10480258 Ga0157372_104802582 242
308 3300032133 Ga0316583_10078890 Ga0316583_100788902 242
309 3300044712 Ga0453684_0040554 Ga0453684_0040554_4083_4844 242
310 3300045051 Ga0451576_0818997 Ga0451576_0818997_97_858 242
311 iso_pu_bacteria 2513020052 2513232459 242
312 iso_pu_bacteria 2519899754 2520879632 242
313 iso_pu_bacteria 2585427687 2586207906 242
314 iso_pu_bacteria 2643221600 2644009296 242
315 iso_pu_bacteria 2643221667 2644374036 242
316 iso_pu_bacteria 2643221716 2644643841 242
317 iso_pu_bacteria 2643221725 2644681738 242
318 iso_pu_bacteria 2738541279 2738732969 242
319 iso_pu_bacteria 2738541285 2738765507 242
320 iso_pu_bacteria 2738541302 2738856550 242
321 iso_pu_bacteria 2738543007 2739214550 242
322 iso_pu_bacteria 2739367651 2739587442 242
323 iso_pu_bacteria 2739367656 2739617443 242
324 iso_pu_bacteria 2739367663 2739647874 242
325 iso_pu_bacteria 2739367857 2740002945 242
326 iso_pu_bacteria 2739367858 2740007762 242
327 iso_pu_bacteria 2802428842 2802654636 242
328 iso_pu_bacteria 2816332280 2817413443 242
329 iso_pu_bacteria 2818991437 2819550281 242
330 iso_pu_bacteria 2842722452 2842726888 242
331 iso_pu_bacteria 2842903701 2842907324 242
332 iso_pu_bacteria 2842909656 2842911733 242
333 iso_pu_bacteria 2849281842 2849285010 242
334 iso_pu_bacteria 2852623160 2852625433 242
335 iso_pu_bacteria 2857613821 2857617145 242
336 iso_pu_bacteria 2857618242 2857619823 242
337 iso_pu_bacteria 2857627736 2857630380 242
338 iso_pu_bacteria 2881359912 2881364195 242
339 iso_pu_bacteria 2884933994 2884934439 242
340 iso_pu_bacteria 2903895155 2903898745 242
341 iso_pu_bacteria 2904419702 2904422302 242
342 iso_pu_bacteria 2904445276 2904448826 242
343 iso_pu_bacteria 2904555929 2904558596 242
344 iso_pu_bacteria 2919191525 2919194323 242
345 iso_pu_bacteria 2919509842 2919510901 242
346 iso_pu_bacteria 2919683626 2919684505 242
347 iso_pu_bacteria 2929150217 2929150515 242
348 iso_pu_bacteria 2945997725 2946002788 242
349 iso_pu_bacteria 2954016120 2954019656 242
350 iso_pu_bacteria 2958458903 2958461909 242
351 iso_pu_bacteria 2965320100 2965322027 242
352 iso_pu_bacteria 2977268062 2977271985 242
353 iso_pu_bacteria 8036736890 8036738691 242
354 iso_pu_bacteria 8054307821 8054311526 242
355 iso_pu_bacteria 8055419101 8055423475 242
356 iso_pu_bacteria 8055592153 8055595165 242
357 iso_pu_bacteria 8056440228 8056443429 242
358 3300028653 Ga0265323_10082684 Ga0265323_100826842 243
359 3300028654 Ga0265322_10000582 Ga0265322_1000058211 243
360 3300031235 Ga0265330_10098079 Ga0265330_100980792 243
361 3300031344 Ga0265316_10037451 Ga0265316_100374515 243
362 3300031548 Ga0307408_100003034 Ga0307408_10000303410 243
363 3300044673 Ga0453683_0019270 Ga0453683_0019270_2428_3189 243
364 3300044712 Ga0453684_0011432 Ga0453684_0011432_1531_2292 243
365 3300044712 Ga0453684_0212921 Ga0453684_0212921_487_1242 243
366 3300045051 Ga0451576_0006696 Ga0451576_0006696_9450_10205 243
367 3300002773 JGI25152J39213_1000651 JGI25152J39213_10006517 244
368 3300002774 JGI25150J39212_1000005 JGI25150J39212_1000005238 244
369 3300003187 JGI25151J46595_10000004 JGI25151J46595_10000004406 244
370 3300003215 JGI25153J46596_10000004 JGI25153J46596_10000004406 244
371 3300013104 Ga0157370_10124962 Ga0157370_101249622 244
372 3300014497 Ga0182008_10126868 Ga0182008_101268682 244
373 3300015261 Ga0182006_1002390 Ga0182006_10023905 244
374 3300025245 Ga0207425_1000008 Ga0207425_100000834 244
375 3300025258 Ga0209129_1000040 Ga0209129_1000040232 244
376 3300025294 Ga0209025_1000020 Ga0209025_100002034 244
377 3300025297 Ga0209758_1000022 Ga0209758_100002234 244
378 3300028794 Ga0307515_10034167 Ga0307515_100341676 244
379 3300030744 Ga0316181_1109542 Ga0316181_11095422 244
380 3300031911 Ga0307412_10177668 Ga0307412_101776682 244
381 3300031911 Ga0307412_10420073 Ga0307412_104200732 244
382 3300032004 Ga0307414_10029412 Ga0307414_100294122 244
383 3300032005 Ga0307411_10164141 Ga0307411_101641412 244
384 3300041511 Ga0451855_0117389 Ga0451855_0117389_714_1451 244
385 3300041511 Ga0451855_2000359 Ga0451855_2000359_2290_3027 244
386 3300049758 Ga0501241_001759 Ga0501241_001759_16_750 244
387 iso_pu_bacteria 2818991444 2819585963 244
388 iso_pu_bacteria 2840677318 2840678929 244
389 iso_pu_bacteria 2883068021 2883070400 244
390 iso_pu_bacteria 2896085136 2896086743 244
391 3300002741 JGI25157J39369_1004597 JGI25157J39369_10045972 245
392 3300005535 Ga0070684_100359873 Ga0070684_1003598732 245
393 3300025250 Ga0209026_1000310 Ga0209026_100031031 245
394 3300025944 Ga0207661_10069997 Ga0207661_100699972 245
395 3300036712 Ga0316584_0003038 Ga0316584_0003038_4826_5674 245
396 3300046523 Ga0495644_0019474 Ga0495644_0019474_763_1500 245
397 3300047445 Ga0495677_0047580 Ga0495677_0047580_37_774 245
398 3300048918 Ga0496115_0222062 Ga0496115_0222062_496_1233 245
399 3300049568 Ga0501031_0010536 Ga0501031_0010536_1190_1933 245
400 3300049569 Ga0501032_0004537 Ga0501032_0004537_7513_8256 245
401 3300049570 Ga0501033_0000027 Ga0501033_0000027_82154_82897 245
402 3300049571 Ga0501034_0001590 Ga0501034_0001590_6016_6759 245
403 3300049572 Ga0501036_0075317 Ga0501036_0075317_1496_2239 245
404 3300049573 Ga0501037_0005602 Ga0501037_0005602_5222_5965 245
405 3300049574 Ga0501038_0004024 Ga0501038_0004024_7641_8384 245
406 3300049575 Ga0501039_0004123 Ga0501039_0004123_6996_7739 245
407 3300049579 Ga0501043_0002197 Ga0501043_0002197_9942_10685 245
408 3300049582 Ga0501048_0086237 Ga0501048_0086237_693_1436 245
409 3300049822 Ga0501035_0032376 Ga0501035_0032376_3842_4585 245
410 3300049823 Ga0501044_0050301 Ga0501044_0050301_2191_2934 245
411 3300049824 Ga0501045_0000829 Ga0501045_0000829_7120_7863 245
412 3300001990 JGI24737J22298_10034722 JGI24737J22298_100347222 246
413 3300002067 JGI24735J21928_10010319 JGI24735J21928_100103192 246
414 3300002077 JGI24744J21845_10005688 JGI24744J21845_100056883 246
415 3300002737 JGI25162J39368_1001967 JGI25162J39368_10019672 246
416 3300003320 rootH2_10205138 rootH2_102051382 246
417 3300003578 Ga0006562J51391_1013169 Ga0006562J51391_10131694 246
418 3300005288 Ga0065714_10026342 Ga0065714_100263422 246
419 3300005288 Ga0065714_10064495 Ga0065714_1006449542 246
420 3300005288 Ga0065714_10077582 Ga0065714_100775823 246
421 3300005288 Ga0065714_10096384 Ga0065714_100963843 246
422 3300005288 Ga0065714_10103932 Ga0065714_101039322 246
423 3300005288 Ga0065714_10221631 Ga0065714_102216311 246
424 3300005289 Ga0065704_10077626 Ga0065704_100776261 246
425 3300005293 Ga0065715_10009462 Ga0065715_100094624 246
426 3300005337 Ga0070682_100263410 Ga0070682_1002634102 246
427 3300005354 Ga0070675_100435569 Ga0070675_1004355691 246
428 3300005366 Ga0070659_100043582 Ga0070659_1000435822 246
429 3300005456 Ga0070678_100325966 Ga0070678_1003259661 246
430 3300005466 Ga0070685_10201792 Ga0070685_102017921 246
431 3300005548 Ga0070665_100002492 Ga0070665_10000249217 246
432 3300005563 Ga0068855_100180597 Ga0068855_1001805972 246
433 3300005577 Ga0068857_100014021 Ga0068857_1000140213 246
434 3300005614 Ga0068856_100749380 Ga0068856_1007493802 246
435 3300005616 Ga0068852_100343923 Ga0068852_1003439233 246
436 3300005618 Ga0068864_100106595 Ga0068864_1001065953 246
437 3300005834 Ga0068851_10222343 Ga0068851_102223431 246
438 3300006358 Ga0068871_100112458 Ga0068871_1001124582 246
439 3300006881 Ga0068865_100641986 Ga0068865_1006419861 246
440 3300006942 Ga0099824_1000610 Ga0099824_10006102 246
441 3300006946 Ga0079104_1000091 Ga0079104_100009194 246
442 3300006948 Ga0099826_10000144 Ga0099826_1000014411 246
443 3300009011 Ga0105251_10147232 Ga0105251_101472322 246
444 3300009036 Ga0105244_10000027 Ga0105244_1000002799 246
445 3300009036 Ga0105244_10147995 Ga0105244_101479952 246
446 3300009092 Ga0105250_10008636 Ga0105250_100086363 246
447 3300009093 Ga0105240_10042259 Ga0105240_100422592 246
448 3300009093 Ga0105240_10389763 Ga0105240_103897632 246
449 3300009093 Ga0105240_10412701 Ga0105240_104127012 246
450 3300009545 Ga0105237_10000650 Ga0105237_1000065027 246
451 3300009545 Ga0105237_10303400 Ga0105237_103034002 246
452 3300009545 Ga0105237_10406082 Ga0105237_104060822 246
453 3300010375 Ga0105239_10000014 Ga0105239_1000001443 246
454 3300010375 Ga0105239_10002611 Ga0105239_1000261119 246
455 3300010375 Ga0105239_10007091 Ga0105239_100070916 246
456 3300010375 Ga0105239_10036516 Ga0105239_100365164 246
457 3300013100 Ga0157373_10000047 Ga0157373_1000004735 246
458 3300013100 Ga0157373_10006233 Ga0157373_100062339 246
459 3300013100 Ga0157373_10013646 Ga0157373_100136463 246
460 3300013102 Ga0157371_10000503 Ga0157371_1000050315 246
461 3300013102 Ga0157371_10000571 Ga0157371_1000057125 246
462 3300013102 Ga0157371_10017902 Ga0157371_100179025 246
463 3300013104 Ga0157370_10000154 Ga0157370_1000015464 246
464 3300013104 Ga0157370_10001307 Ga0157370_1000130717 246
465 3300013104 Ga0157370_10006256 Ga0157370_1000625613 246
466 3300013104 Ga0157370_10011974 Ga0157370_100119748 246
467 3300013104 Ga0157370_10012517 Ga0157370_100125177 246
468 3300013104 Ga0157370_10023757 Ga0157370_100237574 246
469 3300013104 Ga0157370_10082592 Ga0157370_100825922 246
470 3300013104 Ga0157370_10101321 Ga0157370_101013212 246
471 3300013104 Ga0157370_10225340 Ga0157370_102253402 246
472 3300013104 Ga0157370_10278608 Ga0157370_102786082 246
473 3300013105 Ga0157369_10000450 Ga0157369_1000045028 246
474 3300013105 Ga0157369_10003997 Ga0157369_1000399712 246
475 3300013105 Ga0157369_10161361 Ga0157369_101613612 246
476 3300013297 Ga0157378_10005510 Ga0157378_100055106 246
477 3300013306 Ga0163162_10000073 Ga0163162_1000007372 246
478 3300013306 Ga0163162_10312599 Ga0163162_103125992 246
479 3300013307 Ga0157372_10000432 Ga0157372_1000043217 246
480 3300013307 Ga0157372_10378366 Ga0157372_103783662 246
481 3300013307 Ga0157372_10468880 Ga0157372_104688803 246
482 3300013308 Ga0157375_10015107 Ga0157375_100151073 246
483 3300013308 Ga0157375_10080026 Ga0157375_100800261 246
484 3300014497 Ga0182008_10000165 Ga0182008_1000016558 246
485 3300014745 Ga0157377_10249877 Ga0157377_102498771 246
486 3300015261 Ga0182006_1000064 Ga0182006_100006443 246
487 3300015261 Ga0182006_1000328 Ga0182006_10003287 246
488 3300015261 Ga0182006_1009485 Ga0182006_10094853 246
489 3300015261 Ga0182006_1047352 Ga0182006_10473521 246
490 3300015261 Ga0182006_1065925 Ga0182006_10659252 246
491 3300015262 Ga0182007_10000016 Ga0182007_10000016130 246
492 3300015682 Ga0183373_1011 Ga0183373_101192 246
493 3300017792 Ga0163161_10000824 Ga0163161_1000082424 246
494 3300017792 Ga0163161_10080277 Ga0163161_100802772 246
495 3300017792 Ga0163161_10083929 Ga0163161_100839292 246
496 3300017792 Ga0163161_10591745 Ga0163161_105917451 246
497 3300025231 Ga0207427_107675 Ga0207427_1076752 246
498 3300025233 Ga0209437_100030 Ga0209437_100030412 246
499 3300025250 Ga0209026_1005785 Ga0209026_10057852 246
500 3300025302 Ga0207426_1000023 Ga0207426_1000023168 246
501 3300025728 Ga0207655_1000038 Ga0207655_1000038100 246
502 3300025901 Ga0207688_10032026 Ga0207688_100320262 246
503 3300025904 Ga0207647_10000080 Ga0207647_1000008024 246
504 3300025904 Ga0207647_10053269 Ga0207647_100532692 246
505 3300025913 Ga0207695_10013789 Ga0207695_100137892 246
506 3300025913 Ga0207695_10071813 Ga0207695_100718132 246
507 3300025914 Ga0207671_10000340 Ga0207671_1000034022 246
508 3300025914 Ga0207671_10049544 Ga0207671_100495442 246
509 3300025914 Ga0207671_10049578 Ga0207671_100495783 246
510 3300025914 Ga0207671_10180102 Ga0207671_101801022 246
511 3300025926 Ga0207659_10390854 Ga0207659_103908541 246
512 3300025932 Ga0207690_10035752 Ga0207690_100357522 246
513 3300025934 Ga0207686_10238563 Ga0207686_102385631 246
514 3300025938 Ga0207704_10468218 Ga0207704_104682181 246
515 3300025942 Ga0207689_10227660 Ga0207689_102276602 246
516 3300025949 Ga0207667_10249668 Ga0207667_102496682 246
517 3300025981 Ga0207640_10195526 Ga0207640_101955262 246
518 3300025981 Ga0207640_10252911 Ga0207640_102529112 246
519 3300025986 Ga0207658_10249707 Ga0207658_102497071 246
520 3300026035 Ga0207703_10121162 Ga0207703_101211623 246
521 3300026116 Ga0207674_10059234 Ga0207674_100592342 246
522 3300026121 Ga0207683_10425986 Ga0207683_104259861 246
523 3300026142 Ga0207698_10431654 Ga0207698_104316541 246
524 3300027111 Ga0209281_1000671 Ga0209281_10006715 246
525 3300027361 Ga0209489_123305 Ga0209489_1233052 246
526 3300027526 Ga0209968_1002194 Ga0209968_10021943 246
527 3300027666 Ga0209282_1036863 Ga0209282_10368632 246
528 3300028379 Ga0268266_10009751 Ga0268266_100097513 246
529 3300030731 Ga0316177_1026597 Ga0316177_10265975 246
530 3300030732 Ga0316176_1022262 Ga0316176_10222625 246
531 3300030742 Ga0316183_1044693 Ga0316183_10446937 246
532 3300030744 Ga0316181_1045180 Ga0316181_10451808 246
533 3300031251 Ga0265327_10050909 Ga0265327_100509092 246
534 3300031548 Ga0307408_100003807 Ga0307408_1000038076 246
535 3300031731 Ga0307405_10000005 Ga0307405_10000005108 246
536 3300031731 Ga0307405_10000023 Ga0307405_1000002359 246
537 3300031731 Ga0307405_10030224 Ga0307405_100302242 246
538 3300031731 Ga0307405_10124618 Ga0307405_101246183 246
539 3300031824 Ga0307413_10000021 Ga0307413_1000002121 246
540 3300031852 Ga0307410_10000151 Ga0307410_1000015115 246
541 3300031901 Ga0307406_10000020 Ga0307406_1000002075 246
542 3300031901 Ga0307406_10008580 Ga0307406_100085802 246
543 3300031903 Ga0307407_10000059 Ga0307407_100000599 246
544 3300031903 Ga0307407_10009185 Ga0307407_100091854 246
545 3300031911 Ga0307412_10522990 Ga0307412_105229901 246
546 3300031995 Ga0307409_100053757 Ga0307409_1000537573 246
547 3300032002 Ga0307416_100000116 Ga0307416_1000001169 246
548 3300032002 Ga0307416_100000211 Ga0307416_1000002118 246
549 3300032004 Ga0307414_10000011 Ga0307414_10000011245 246
550 3300032004 Ga0307414_10017360 Ga0307414_100173604 246
551 3300032004 Ga0307414_10038450 Ga0307414_100384502 246
552 3300032004 Ga0307414_10163004 Ga0307414_101630042 246
553 3300032005 Ga0307411_10000004 Ga0307411_10000004102 246
554 3300032005 Ga0307411_10263184 Ga0307411_102631842 246
555 3300037418 Ga0395900_0524529 Ga0395900_0524529_120_860 246
556 3300041407 Ga0439447_000444 Ga0439447_000444_13981_14721 246
557 3300041411 Ga0439466_0002166 Ga0439466_0002166_1386_2126 246
558 3300041451 Ga0451791_0926619 Ga0451791_0926619_36_776 246
559 3300041494 Ga0451837_1370744 Ga0451837_1370744_84_824 246
560 3300044683 Ga0466965_0248373 Ga0466965_0248373_78_938 246
561 3300044712 Ga0453684_0132074 Ga0453684_0132074_1760_2524 246
562 3300046507 Ga0495606_0038039 Ga0495606_0038039_767_1507 246
563 3300046507 Ga0495606_0087994 Ga0495606_0087994_936_1676 246
564 3300046512 Ga0495610_0000098 Ga0495610_0000098_63884_64624 246
565 3300046512 Ga0495610_0002031 Ga0495610_0002031_4284_5024 246
566 3300046513 Ga0495616_0004654 Ga0495616_0004654_6418_7206 246
567 3300046522 Ga0495643_0000554 Ga0495643_0000554_26410_27198 246
568 3300046530 Ga0495654_0124579 Ga0495654_0124579_32_772 246
569 3300046558 Ga0495633_0028540 Ga0495633_0028540_1938_2678 246
570 3300046660 Ga0495625_0027261 Ga0495625_0027261_2450_3238 246
571 3300048090 Ga0495615_0011642 Ga0495615_0011642_11_793 246
572 3300048918 Ga0496115_0020081 Ga0496115_0020081_1064_1849 246
573 3300048919 Ga0496116_0000024 Ga0496116_0000024_195147_195887 246
574 3300048920 Ga0496117_0112964 Ga0496117_0112964_114_854 246
575 3300048924 Ga0496121_0042859 Ga0496121_0042859_2860_3600 246
576 3300048926 Ga0496123_0073904 Ga0496123_0073904_1248_2018 246
577 3300048927 Ga0496124_0021869 Ga0496124_0021869_4194_4934 246
578 3300048928 Ga0496125_0000031 Ga0496125_0000031_116234_117019 246
579 3300048929 Ga0496126_0011956 Ga0496126_0011956_2443_3228 246
580 3300048929 Ga0496126_0058034 Ga0496126_0058034_982_1722 246
581 3300049571 Ga0501034_0576178 Ga0501034_0576178_133_951 246
582 3300049663 Ga0501223_002272 Ga0501223_002272_292_1056 246
583 3300049679 Ga0501249_000029 Ga0501249_000029_79402_80142 246
584 3300049679 Ga0501249_012179 Ga0501249_012179_531_1271 246
585 3300049763 Ga0501266_000002 Ga0501266_000002_254297_255037 246
586 3300049764 Ga0501267_011193 Ga0501267_011193_98_880 246
587 3300049766 Ga0501269_002275 Ga0501269_002275_843_1583 246
588 3300049776 Ga0501280_000161 Ga0501280_000161_11477_12217 246
589 3300053096 Ga0500641_0000028 Ga0500641_0000028_17439_18179 246
590 3300053096 Ga0500641_0000201 Ga0500641_0000201_7827_8567 246
591 3300053096 Ga0500641_0000602 Ga0500641_0000602_4014_4799 246
592 3300053134 Ga0500658_0000002 Ga0500658_0000002_286124_286864 246
593 3300053136 Ga0500559_0119394 Ga0500559_0119394_39_779 246
594 3300053726 Ga0500584_004413 Ga0500584_004413_3592_4332 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

40

186

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x5y-assembly1.cif.gz_A a membrane protein complex 0.9765 1 238
4wbs-assembly1.cif.gz_A crystal structure of an abc transporter related protein from burkholderia phymatum 0.9736 2 239
6hs3-assembly1.cif.gz_A crystal structure of an abc transporter related protein from burkholderia pseudomallei 0.9701 2 239
6mjp-assembly1.cif.gz_B lptb(e163q)fgc from vibrio cholerae 0.9697 1 239
4wbs-assembly2.cif.gz_B crystal structure of an abc transporter related protein from burkholderia phymatum 0.9696 2 239
ID Description Score Start End Superfamily
4wbsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9736 2 239 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9429 3 234 3.40.50.300
af_Q9VVK6_333_568_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9313 3 224 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9215 3 231 3.40.50.300
af_Q9VVJ9_503_747_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9213 3 212 3.40.50.300
ID Description Score Start End GO Terms
AF-R7HP41-F1-model_v4 ABC transporter domain-containing protein 0.993 2 245 GO:0005524
GO:0016887
GO:0043190
GO:0055085
AF-A0A1I2K4U1-F1-model_v4 Lipopolysaccharide export system ATP-binding protein LptB 0.9838 2 239 GO:0005524
GO:0005737
GO:0016887
GO:0043190
GO:0055085
AF-A0A3B0TB19-F1-model_v4 Lipopolysaccharide export system ATP-binding protein LptB 0.9819 2 238 GO:0005524
GO:0005737
GO:0016887
GO:0043190
GO:0055085
AF-A0A3B9BUL9-F1-model_v4 LPS export ABC transporter ATP-binding protein 0.9811 133 240 GO:0005524
GO:0005886
GO:0016887
AF-R7HP41-F1-model_v4 ABC transporter domain-containing protein 0.981 2 245 GO:0005524
GO:0016887
GO:0043190
GO:0055085

Feature Viewer

pLDDT pTM Quality
94.04 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map