F467308

General Info

Members Datasets Scaffolds Average Seq Length
594 310 1189 185

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100000045|Ga0070665_10000004549
Length 216
Sequence MPPKTDPIIEEKIAEETVVVDXXXXAAAVAPTEQRTDHRGGQGENKSDLLEKVVFINRCAKVVKGGRRFSFSALLVVGDRKGKVGVGFGKANEVTEAIRKATDAARKHLEPVSLRGNTIPHEVMGQFGGGRVFLRPASPGTGLIAGGGVRAVVEAAGIKDLLAKSLGSGNPANVVRATLQALKQLRQKEVIFQLRGKTVKPAAPAVAGESDPALAS

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
102 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
163 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
164 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
202 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
203 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
204 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
205 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
206 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
207 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
208 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
221 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
222 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
233 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
287 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
301 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
302 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
303 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
304 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
305 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
306 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
307 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
308 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
309 2718217752 Candidatus Xiphinematobacter sp. Idaho Grape Isolate Unclassified
310 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 2.02
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.04
Nodule 0
Rhizoplane 5.39
Rhizosphere 86.53
Stem 0
Stem Tuber 0
Unclassified 5.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100000045 3300005548 Bacteria 275023
2 SwRhRL3b_contig_111370 2162886006 Bacteria 2236
3 SwRhRL3b_contig_2227077 2162886006 Unclassified 1583
4 SwRhRL2b_contig_128758 2162886007 Bacteria 2329
5 JGI24743J22301_10000748 3300001991 Bacteria 4062
6 JGI24743J22301_10010320 3300001991 Bacteria 1666
7 JGI24744J21845_10011528 3300002077 Bacteria 1807
8 JGI24033J26618_1000142 3300002155 Bacteria 9538
9 JGI25406J46586_10000001 3300003203 Bacteria 251772
10 JGI25406J46586_10000007 3300003203 Bacteria 112227
11 rootH2_10050166 3300003320 Bacteria 16007
12 rootL2_10030599 3300003322 Bacteria 2291
13 rootL2_10139488 3300003322 Bacteria 1084
14 rootH1_10007007 3300003316 Bacteria 7034
15 rootH1_10007007 3300003323 Bacteria 6457
16 Ga0055530_10029193 3300003791 Bacteria 1477
17 Ga0065704_10115944 3300005289 Bacteria 1863
18 Ga0065712_10088457 3300005290 Bacteria 2519
19 Ga0065712_10145424 3300005290 Bacteria 1413
20 Ga0065715_10001491 3300005293 Bacteria 7335
21 Ga0065707_10102203 3300005295 Bacteria 2810
22 Ga0070658_10018594 3300005327 Bacteria 5565
23 Ga0070676_10079494 3300005328 Bacteria 1986
24 Ga0070676_10305976 3300005328 Bacteria 1079
25 Ga0070676_10428966 3300005328 Bacteria 925
26 Ga0070683_100055457 3300005329 Bacteria 3678
27 Ga0070670_100003742 3300005331 Bacteria 12666
28 Ga0070670_100205578 3300005331 Bacteria 1711
29 Ga0070670_100314402 3300005331 Bacteria 1371
30 Ga0070670_100359756 3300005331 Bacteria 1280
31 Ga0068869_100697020 3300005334 Bacteria 866
32 Ga0070666_10001876 3300005335 Bacteria 12791
33 Ga0070666_10002056 3300005335 Bacteria 12212
34 Ga0070666_10037886 3300005335 Bacteria 3207
35 Ga0068868_100215528 3300005338 Bacteria 1606
36 Ga0068868_100221974 3300005338 Bacteria 1582
37 Ga0070660_100151607 3300005339 Bacteria 1864
38 Ga0070689_100100534 3300005340 Bacteria 2288
39 Ga0070687_100411748 3300005343 Bacteria 889
40 Ga0070661_100000386 3300005344 Bacteria 34590
41 Ga0070661_100097194 3300005344 Bacteria 2186
42 Ga0070661_100288697 3300005344 Bacteria 1274
43 Ga0070668_100069825 3300005347 Bacteria 2734
44 Ga0070668_100182452 3300005347 Bacteria 1715
45 Ga0070668_100497705 3300005347 Bacteria 1055
46 Ga0070669_100002011 3300005353 Bacteria 14710
47 Ga0070669_100004431 3300005353 Bacteria 10120
48 Ga0070669_100033015 3300005353 Bacteria 3741
49 Ga0070669_100157939 3300005353 Bacteria 1760
50 Ga0070669_100199988 3300005353 Unclassified 1572
51 Ga0070675_100004678 3300005354 Bacteria 10447
52 Ga0070675_100133137 3300005354 Bacteria 2120
53 Ga0070675_100137843 3300005354 Bacteria 2083
54 Ga0070675_100193153 3300005354 Bacteria 1765
55 Ga0070671_100000283 3300005355 Bacteria 34469
56 Ga0070671_100011134 3300005355 Bacteria 7224
57 Ga0070671_100016515 3300005355 Bacteria 5967
58 Ga0070674_100013872 3300005356 Bacteria 4993
59 Ga0070674_100034793 3300005356 Bacteria 3368
60 Ga0070674_100048927 3300005356 Bacteria 2904
61 Ga0070674_100064027 3300005356 Bacteria 2575
62 Ga0070674_100293714 3300005356 Bacteria 1293
63 Ga0070673_100008141 3300005364 Bacteria 6955
64 Ga0070673_100014325 3300005364 Bacteria 5516
65 Ga0070673_100075213 3300005364 Bacteria 2724
66 Ga0070688_100000733 3300005365 Bacteria 16191
67 Ga0070667_100004665 3300005367 Bacteria 11504
68 Ga0070667_100072064 3300005367 Bacteria 2943
69 Ga0070667_100258686 3300005367 Bacteria 1558
70 Ga0070667_100449308 3300005367 Bacteria 1178
71 Ga0070709_10408304 3300005434 Bacteria 1015
72 Ga0070709_10499439 3300005434 Bacteria 924
73 Ga0070714_100337764 3300005435 Bacteria 1412
74 Ga0070714_100879043 3300005435 Bacteria 870
75 Ga0070713_100354871 3300005436 Bacteria 1361
76 Ga0070710_10136557 3300005437 Bacteria 1500
77 Ga0070710_10207762 3300005437 Bacteria 1240
78 Ga0070710_10236095 3300005437 Bacteria 1169
79 Ga0070701_10075691 3300005438 Bacteria 1810
80 Ga0070711_100006116 3300005439 Bacteria 7237
81 Ga0070711_100226319 3300005439 Bacteria 1456
82 Ga0070708_100054749 3300005445 Bacteria 3545
83 Ga0070708_100076149 3300005445 Bacteria 3030
84 Ga0070708_100393362 3300005445 Unclassified 1307
85 Ga0070708_100591210 3300005445 Bacteria 1046
86 Ga0070708_100903773 3300005445 Bacteria 829
87 Ga0070678_100001511 3300005456 Bacteria 12415
88 Ga0070678_100013072 3300005456 Bacteria 5189
89 Ga0070678_100033505 3300005456 Unclassified 3567
90 Ga0070678_100043541 3300005456 Bacteria 3198
91 Ga0070678_100053192 3300005456 Bacteria 2943
92 Ga0070678_100223073 3300005456 Bacteria 1567
93 Ga0070678_100444107 3300005456 Bacteria 1135
94 Ga0070662_100008169 3300005457 Bacteria 6816
95 Ga0070662_100471626 3300005457 Bacteria 1044
96 Ga0068867_100000218 3300005459 Bacteria 37862
97 Ga0068867_100007340 3300005459 Bacteria 7800
98 Ga0068867_100044767 3300005459 Bacteria 3243
99 Ga0068867_100235448 3300005459 Bacteria 1482
100 Ga0070685_10099962 3300005466 Bacteria 1770
101 Ga0070706_100006435 3300005467 Bacteria 11091
102 Ga0070706_100146613 3300005467 Bacteria 2204
103 Ga0070706_100416544 3300005467 Bacteria 1250
104 Ga0070706_100624420 3300005467 Unclassified 1001
105 Ga0070706_100729309 3300005467 Bacteria 919
106 Ga0070707_100072311 3300005468 Bacteria 3323
107 Ga0070707_100159765 3300005468 Bacteria 2196
108 Ga0070707_100411612 3300005468 Unclassified 1312
109 Ga0070698_100001910 3300005471 Bacteria 23223
110 Ga0070698_100007384 3300005471 Bacteria 11891
111 Ga0070699_100030476 3300005518 Bacteria 4657
112 Ga0070699_100036501 3300005518 Bacteria 4251
113 Ga0070699_100051877 3300005518 Unclassified 3551
114 Ga0070699_100093749 3300005518 Bacteria 2627
115 Ga0070699_100643205 3300005518 Bacteria 968
116 Ga0070697_100004958 3300005536 Bacteria 10219
117 Ga0070697_100005694 3300005536 Bacteria 9598
118 Ga0070697_100025782 3300005536 Bacteria 4689
119 Ga0070697_100031906 3300005536 Bacteria 4239
120 Ga0070697_100141887 3300005536 Bacteria 2021
121 Ga0070697_100611835 3300005536 Unclassified 958
122 Ga0070672_100004247 3300005543 Bacteria 9368
123 Ga0070672_100041736 3300005543 Bacteria 3529
124 Ga0070672_100182796 3300005543 Bacteria 1748
125 Ga0070672_100202353 3300005543 Bacteria 1661
126 Ga0070695_100561239 3300005545 Bacteria 891
127 Ga0070665_100008787 3300005548 Bacteria 10223
128 Ga0070665_100114878 3300005548 Bacteria 2694
129 Ga0070665_100476535 3300005548 Bacteria 1259
130 Ga0070665_100673722 3300005548 Bacteria 1047
131 Ga0070665_100853228 3300005548 Bacteria 924
132 Ga0070704_100083567 3300005549 Bacteria 2357
133 Ga0068855_100597968 3300005563 Bacteria 1190
134 Ga0068855_100851325 3300005563 Bacteria 966
135 Ga0070664_100000199 3300005564 Bacteria 42634
136 Ga0070664_100360619 3300005564 Bacteria 1324
137 Ga0068857_100221076 3300005577 Bacteria 1730
138 Ga0068856_100004352 3300005614 Bacteria 14113
139 Ga0068856_100017528 3300005614 Bacteria 6939
140 Ga0068859_101731931 3300005617 Bacteria 690
141 Ga0068866_10121420 3300005718 Bacteria 1473
142 Ga0068866_10623252 3300005718 Bacteria 731
143 Ga0068861_100390918 3300005719 Bacteria 1232
144 Ga0068863_100029029 3300005841 Bacteria 5284
145 Ga0068863_100054836 3300005841 Bacteria 3776
146 Ga0068858_100055768 3300005842 Bacteria 3653
147 Ga0068858_100134565 3300005842 Bacteria 2319
148 Ga0068858_100800210 3300005842 Bacteria 920
149 Ga0068860_100001380 3300005843 Bacteria 26358
150 Ga0068860_100672444 3300005843 Bacteria 1044
151 Ga0081538_10015344 3300005981 Bacteria 5937
152 Ga0081539_10000014 3300005985 Bacteria 411270
153 Ga0070717_10037326 3300006028 Bacteria 3945
154 Ga0070717_10195964 3300006028 Bacteria 1767
155 Ga0075363_100004668 3300006048 Bacteria 6026
156 Ga0075363_100128694 3300006048 Bacteria 1419
157 Ga0070715_10015930 3300006163 Bacteria 2813
158 Ga0070716_100031746 3300006173 Bacteria 2875
159 Ga0070716_100086652 3300006173 Bacteria 1884
160 Ga0070716_100677467 3300006173 Bacteria 785
161 Ga0070712_100093977 3300006175 Bacteria 2202
162 Ga0070712_100105455 3300006175 Unclassified 2093
163 Ga0070712_100996564 3300006175 Bacteria 725
164 Ga0075362_10004435 3300006177 Bacteria 5044
165 Ga0075366_10047853 3300006195 Bacteria 2535
166 Ga0097621_100024099 3300006237 Bacteria 4748
167 Ga0097621_100605107 3300006237 Bacteria 1002
168 Ga0097621_100827666 3300006237 Bacteria 859
169 Ga0075370_10306692 3300006353 Bacteria 945
170 Ga0068871_100005514 3300006358 Bacteria 8875
171 Ga0068871_100012344 3300006358 Bacteria 6294
172 Ga0068871_100084135 3300006358 Bacteria 2640
173 Ga0075433_10286694 3300006852 Unclassified 1458
174 Ga0075429_100583814 3300006880 Bacteria 979
175 Ga0068865_100000462 3300006881 Bacteria 22708
176 Ga0068865_100013318 3300006881 Bacteria 5196
177 Ga0097620_101732031 3300006931 Bacteria 690
178 Ga0075435_100470464 3300007076 Bacteria 1085
179 Ga0099795_10326251 3300007788 Unclassified 681
180 Ga0105240_10007047 3300009093 Bacteria 16398
181 Ga0111539_10048674 3300009094 Bacteria 5060
182 Ga0111539_10387272 3300009094 Bacteria 1628
183 Ga0105245_10015121 3300009098 Bacteria 6722
184 Ga0105245_10158539 3300009098 Bacteria 2146
185 Ga0105245_10823160 3300009098 Bacteria 967
186 Ga0105243_10000049 3300009148 Bacteria 145575
187 Ga0105242_10451840 3300009176 Bacteria 1211
188 Ga0105248_10312261 3300009177 Bacteria 1770
189 Ga0105237_10009019 3300009545 Bacteria 10721
190 Ga0105237_10044182 3300009545 Bacteria 4486
191 Ga0105237_10385391 3300009545 Bacteria 1407
192 Ga0099796_10040234 3300010159 Bacteria 1577
193 Ga0105239_10048890 3300010375 Bacteria 4637
194 Ga0157373_10004932 3300013100 Bacteria 10042
195 Ga0157371_10058341 3300013102 Bacteria 2738
196 Ga0157371_10247936 3300013102 Bacteria 1282
197 Ga0157374_10000026 3300013296 Bacteria 238236
198 Ga0157374_10001473 3300013296 Bacteria 19879
199 Ga0157374_10017996 3300013296 Bacteria 6230
200 Ga0157374_10055882 3300013296 Bacteria 3685
201 Ga0157374_10121480 3300013296 Bacteria 2521
202 Ga0157374_10127435 3300013296 Bacteria 2461
203 Ga0157374_10498498 3300013296 Bacteria 1222
204 Ga0157374_10569942 3300013296 Bacteria 1141
205 Ga0157374_11100808 3300013296 Bacteria 815
206 Ga0157374_11130585 3300013296 Bacteria 804
207 Ga0157374_11937884 3300013296 Bacteria 615
208 Ga0157378_10001234 3300013297 Bacteria 23136
209 Ga0157378_10005509 3300013297 Bacteria 11097
210 Ga0157378_10026553 3300013297 Bacteria 5104
211 Ga0157378_10043528 3300013297 Bacteria 3987
212 Ga0157378_10058061 3300013297 Bacteria 3451
213 Ga0157378_10107467 3300013297 Bacteria 2553
214 Ga0157378_10119918 3300013297 Bacteria 2423
215 Ga0157378_10174062 3300013297 Unclassified 2021
216 Ga0163162_10017445 3300013306 Bacteria 7024
217 Ga0163162_10023520 3300013306 Bacteria 6081
218 Ga0163162_10052794 3300013306 Bacteria 4083
219 Ga0163162_10370423 3300013306 Bacteria 1565
220 Ga0163162_10410273 3300013306 Bacteria 1487
221 Ga0157372_10167743 3300013307 Bacteria 2539
222 Ga0157372_10360562 3300013307 Bacteria 1694
223 Ga0157372_10631782 3300013307 Bacteria 1247
224 Ga0157372_11295485 3300013307 Bacteria 841
225 Ga0157375_10001868 3300013308 Bacteria 18135
226 Ga0157375_10044228 3300013308 Bacteria 4324
227 Ga0157375_10082239 3300013308 Bacteria 3261
228 Ga0157375_10144146 3300013308 Bacteria 2511
229 Ga0157375_10198646 3300013308 Bacteria 2161
230 Ga0157375_10668197 3300013308 Bacteria 1194
231 Ga0157377_10033289 3300014745 Bacteria 2813
232 Ga0157376_10000112 3300014969 Bacteria 58430
233 Ga0157376_10031061 3300014969 Bacteria 4273
234 Ga0157376_10102835 3300014969 Bacteria 2500
235 Ga0157376_10390349 3300014969 Bacteria 1343
236 Ga0157376_11254406 3300014969 Bacteria 770
237 Ga0163161_10042654 3300017792 Bacteria 3264
238 Ga0163161_10245059 3300017792 Bacteria 1395
239 Ga0206355_1200566 3300020076 Bacteria 843
240 Ga0213873_10016590 3300021358 Bacteria 1667
241 Ga0213873_10030819 3300021358 Bacteria 1330
242 Ga0213872_10010006 3300021361 Bacteria 4525
243 Ga0213872_10158708 3300021361 Bacteria 985
244 Ga0213874_10001478 3300021377 Bacteria 4877
245 Ga0213876_10000361 3300021384 Bacteria 38897
246 Ga0213876_10073114 3300021384 Bacteria 1810
247 Ga0213876_10483064 3300021384 Bacteria 659
248 Ga0213875_10079664 3300021388 Bacteria 1528
249 Ga0213871_10012351 3300021441 Bacteria 1982
250 Ga0209050_1000629 3300025298 Bacteria 54939
251 Ga0207697_10000131 3300025315 Bacteria 36154
252 Ga0207697_10002322 3300025315 Bacteria 9909
253 Ga0207697_10031631 3300025315 Bacteria 2165
254 Ga0207642_10062069 3300025899 Bacteria 1741
255 Ga0207642_10063829 3300025899 Bacteria 1724
256 Ga0207688_10001208 3300025901 Bacteria 13377
257 Ga0207688_10042403 3300025901 Bacteria 2533
258 Ga0207680_10104042 3300025903 Bacteria 1829
259 Ga0207680_10150458 3300025903 Bacteria 1551
260 Ga0207680_10205844 3300025903 Bacteria 1343
261 Ga0207685_10139437 3300025905 Unclassified 1086
262 Ga0207685_10171988 3300025905 Bacteria 997
263 Ga0207699_10181274 3300025906 Bacteria 1416
264 Ga0207645_10001641 3300025907 Bacteria 18232
265 Ga0207645_10002762 3300025907 Bacteria 13659
266 Ga0207705_10033535 3300025909 Bacteria 3669
267 Ga0207684_10019695 3300025910 Bacteria 5771
268 Ga0207684_10048446 3300025910 Bacteria 3604
269 Ga0207684_10151385 3300025910 Bacteria 1996
270 Ga0207684_10252293 3300025910 Bacteria 1522
271 Ga0207695_10002221 3300025913 Bacteria 29193
272 Ga0207695_10008540 3300025913 Bacteria 12801
273 Ga0207671_10020842 3300025914 Bacteria 4985
274 Ga0207671_10025222 3300025914 Bacteria 4465
275 Ga0207693_10000889 3300025915 Bacteria 26818
276 Ga0207693_10092069 3300025915 Bacteria 2376
277 Ga0207693_10389591 3300025915 Bacteria 1090
278 Ga0207663_10005429 3300025916 Bacteria 6420
279 Ga0207663_10396750 3300025916 Bacteria 1054
280 Ga0207662_10432993 3300025918 Bacteria 897
281 Ga0207657_10066683 3300025919 Bacteria 3063
282 Ga0207657_10073181 3300025919 Bacteria 2897
283 Ga0207649_10007825 3300025920 Bacteria 5815
284 Ga0207649_10150356 3300025920 Bacteria 1603
285 Ga0207646_10005692 3300025922 Bacteria 13070
286 Ga0207646_10084385 3300025922 Bacteria 2842
287 Ga0207646_10137954 3300025922 Bacteria 2196
288 Ga0207681_10014902 3300025923 Bacteria 4842
289 Ga0207681_10072736 3300025923 Bacteria 2402
290 Ga0207681_10175206 3300025923 Unclassified 1629
291 Ga0207650_10006836 3300025925 Bacteria 7782
292 Ga0207650_10018287 3300025925 Bacteria 4917
293 Ga0207659_10020696 3300025926 Bacteria 4353
294 Ga0207659_10045484 3300025926 Bacteria 3095
295 Ga0207659_10179827 3300025926 Bacteria 1675
296 Ga0207659_10419064 3300025926 Bacteria 1123
297 Ga0207659_10469124 3300025926 Bacteria 1062
298 Ga0207659_10682627 3300025926 Bacteria 879
299 Ga0207687_10051760 3300025927 Bacteria 2863
300 Ga0207700_10318513 3300025928 Bacteria 1347
301 Ga0207664_10120019 3300025929 Bacteria 2199
302 Ga0207644_10035251 3300025931 Bacteria 3504
303 Ga0207644_10049869 3300025931 Bacteria 2998
304 Ga0207644_10237270 3300025931 Bacteria 1451
305 Ga0207644_10266435 3300025931 Bacteria 1371
306 Ga0207690_10023803 3300025932 Bacteria 3828
307 Ga0207690_10086786 3300025932 Unclassified 2200
308 Ga0207706_10027339 3300025933 Bacteria 5102
309 Ga0207709_10000097 3300025935 Bacteria 136507
310 Ga0207669_10002532 3300025937 Bacteria 7802
311 Ga0207669_10073225 3300025937 Bacteria 2160
312 Ga0207704_10040566 3300025938 Bacteria 2722
313 Ga0207665_10025655 3300025939 Bacteria 3889
314 Ga0207665_10140744 3300025939 Bacteria 1720
315 Ga0207665_10180266 3300025939 Bacteria 1529
316 Ga0207691_10000247 3300025940 Bacteria 53502
317 Ga0207691_10016028 3300025940 Bacteria 7119
318 Ga0207691_10228367 3300025940 Bacteria 1612
319 Ga0207691_10235331 3300025940 Bacteria 1585
320 Ga0207711_10232457 3300025941 Bacteria 1689
321 Ga0207661_10077884 3300025944 Bacteria 2728
322 Ga0207679_10000541 3300025945 Bacteria 25439
323 Ga0207679_10279684 3300025945 Bacteria 1431
324 Ga0207679_10374795 3300025945 Bacteria 1246
325 Ga0207667_10766901 3300025949 Bacteria 963
326 Ga0207651_10007253 3300025960 Bacteria 5894
327 Ga0207651_10019560 3300025960 Bacteria 4061
328 Ga0207651_10027669 3300025960 Bacteria 3565
329 Ga0207651_10634914 3300025960 Bacteria 936
330 Ga0207668_10035962 3300025972 Bacteria 3303
331 Ga0207668_10057405 3300025972 Bacteria 2715
332 Ga0207668_10156576 3300025972 Bacteria 1770
333 Ga0207668_10203825 3300025972 Bacteria 1577
334 Ga0207668_10629956 3300025972 Bacteria 937
335 Ga0207668_10931305 3300025972 Bacteria 774
336 Ga0207668_10957154 3300025972 Bacteria 764
337 Ga0207658_10302012 3300025986 Bacteria 1379
338 Ga0207677_10008042 3300026023 Bacteria 5871
339 Ga0207677_10021108 3300026023 Bacteria 3973
340 Ga0207677_10021545 3300026023 Bacteria 3940
341 Ga0207677_10111866 3300026023 Bacteria 2035
342 Ga0207677_10252081 3300026023 Bacteria 1434
343 Ga0207703_10024292 3300026035 Bacteria 4768
344 Ga0207703_10175845 3300026035 Bacteria 1886
345 Ga0207639_10621551 3300026041 Bacteria 997
346 Ga0207702_10003580 3300026078 Bacteria 14118
347 Ga0207702_10038562 3300026078 Bacteria 4001
348 Ga0207641_10005226 3300026088 Bacteria 11107
349 Ga0207641_10452994 3300026088 Bacteria 1240
350 Ga0207641_10626592 3300026088 Bacteria 1055
351 Ga0207648_10000083 3300026089 Bacteria 89416
352 Ga0207648_10237363 3300026089 Bacteria 1623
353 Ga0207674_10107042 3300026116 Bacteria 2773
354 Ga0207675_100323714 3300026118 Bacteria 1506
355 Ga0207683_10006308 3300026121 Bacteria 10158
356 Ga0207683_10006977 3300026121 Bacteria 9683
357 Ga0207683_10008842 3300026121 Bacteria 8591
358 Ga0207683_10015583 3300026121 Bacteria 6470
359 Ga0207698_10222182 3300026142 Bacteria 1708
360 Ga0207698_10283620 3300026142 Bacteria 1533
361 Ga0207698_10923389 3300026142 Bacteria 881
362 Ga0209974_10022093 3300027876 Bacteria 2107
363 Ga0207428_10514354 3300027907 Bacteria 868
364 Ga0268266_10000251 3300028379 Bacteria 91204
365 Ga0268266_10097330 3300028379 Bacteria 2588
366 Ga0268266_10238441 3300028379 Bacteria 1677
367 Ga0268266_10325400 3300028379 Bacteria 1440
368 Ga0268266_10501180 3300028379 Bacteria 1159
369 Ga0268266_11148552 3300028379 Bacteria 751
370 Ga0268265_10116094 3300028380 Bacteria 2196
371 Ga0268264_10001807 3300028381 Bacteria 19555
372 Ga0268264_10149965 3300028381 Bacteria 2089
373 Ga0268264_10473591 3300028381 Bacteria 1217
374 Ga0265318_10001452 3300028577 Bacteria 13930
375 Ga0307511_10000117 3300030521 Bacteria 71587
376 Ga0307512_10104901 3300030522 Bacteria 1894
377 Ga0265328_10052198 3300031239 Bacteria 1501
378 Ga0265320_10013095 3300031240 Bacteria 4785
379 Ga0265327_10011153 3300031251 Bacteria 6230
380 Ga0265316_10186665 3300031344 Bacteria 1542
381 Ga0307408_100000009 3300031548 Bacteria 426576
382 Ga0307408_100000021 3300031548 Bacteria 312158
383 Ga0307408_100414755 3300031548 Bacteria 1159
384 Ga0265313_10004186 3300031595 Bacteria 11195
385 Ga0307413_10364847 3300031824 Bacteria 1119
386 Ga0307410_10000097 3300031852 Bacteria 30229
387 Ga0307407_10000468 3300031903 Bacteria 12384
388 Ga0307409_100000037 3300031995 Bacteria 47029
389 Ga0307416_100000018 3300032002 Bacteria 200227
390 Ga0307411_10054437 3300032005 Bacteria 2627
391 Ga0316593_10000659 3300032168 Bacteria 6648
392 Ga0373944_0080838 3300035089 Bacteria 1073
393 Ga0373945_0053651 3300035116 Bacteria 1489
394 Ga0373945_0059303 3300035116 Unclassified 1425
395 Ga0373945_0232692 3300035116 Bacteria 774
396 Ga0373957_0405744 3300035120 Bacteria 587
397 Ga0373943_0005531 3300035170 Bacteria 5673
398 Ga0373943_0092490 3300035170 Bacteria 1568
399 Ga0373946_0078616 3300035171 Bacteria 1440
400 Ga0373946_0096119 3300035171 Unclassified 1321
401 Ga0373955_0008379 3300035172 Bacteria 4800
402 Ga0316574_0010564 3300035398 Bacteria 5224
403 Ga0373931_0036970 3300035691 Bacteria 2548
404 Ga0373935_0067275 3300035692 Bacteria 2303
405 Ga0373927_0200535 3300035695 Bacteria 1310
406 Ga0373927_0608304 3300035695 Bacteria 722
407 Ga0373933_0052084 3300035724 Bacteria 2448
408 Ga0373933_0108221 3300035724 Bacteria 1731
409 Ga0373947_0015443 3300035725 Bacteria 4383
410 Ga0373947_0159967 3300035725 Unclassified 1456
411 Ga0373947_0173463 3300035725 Bacteria 1400
412 Ga0373937_0282498 3300036401 Bacteria 1567
413 Ga0373937_0331794 3300036401 Unclassified 1440
414 Ga0373937_0824342 3300036401 Unclassified 876
415 Ga0373925_0014401 3300037068 Bacteria 5718
416 Ga0373925_0155902 3300037068 Bacteria 1796
417 Ga0373925_0501751 3300037068 Bacteria 996
418 Ga0395899_0000039 3300037312 Bacteria 269620
419 Ga0395900_0002526 3300037418 Bacteria 20035
420 Ga0395898_0000226 3300037466 Bacteria 144727
421 Ga0395898_0079141 3300037466 Bacteria 3171
422 Ga0436364_0070502 3300037853 Bacteria 2321
423 Ga0436364_0339363 3300037853 Bacteria 2525
424 Ga0436364_0785290 3300037853 Bacteria 2181
425 Ga0395901_0039538 3300038443 Bacteria 4881
426 Ga0436365_0798127 3300039437 Bacteria 1243
427 Ga0436365_1314581 3300039437 Bacteria 1388
428 Ga0436365_1383407 3300039437 Bacteria 77328
429 Ga0436360_0051782 3300039438 Bacteria 1147
430 Ga0436360_0111982 3300039438 Bacteria 10219
431 Ga0436360_0751309 3300039438 Bacteria 1931
432 Ga0436360_0817873 3300039438 Bacteria 4105
433 Ga0436360_0823493 3300039438 Unclassified 2742
434 Ga0436361_0088096 3300039447 Bacteria 12647
435 Ga0436361_0096493 3300039447 Unclassified 782
436 Ga0436361_0363848 3300039447 Bacteria 21994
437 Ga0436361_0382718 3300039447 Bacteria 2021
438 Ga0436361_0960224 3300039447 Bacteria 2589
439 Ga0436361_1103431 3300039447 Bacteria 1468
440 Ga0436363_0072645 3300039450 Bacteria 6996
441 Ga0436362_0931802 3300039453 Unclassified 3056
442 Ga0436362_1110217 3300039453 Unclassified 1534
443 Ga0439453_0000086 3300041408 Bacteria 7091
444 Ga0451807_0122896 3300041486 Bacteria 635
445 Ga0451853_3388316 3300041512 Bacteria 732
446 Ga0450888_001605 3300042126 Bacteria 2179
447 Ga0450890_000001 3300042127 Bacteria 192635
448 Ga0450891_002487 3300042129 Bacteria 1853
449 Ga0450893_0005197 3300042532 Bacteria 2083
450 Ga0451577_0186388 3300042876 Bacteria 1871
451 Ga0453683_0004775 3300044673 Bacteria 9552
452 Ga0466965_0058570 3300044683 Bacteria 1921
453 Ga0453684_0000516 3300044712 Bacteria 147788
454 Ga0453684_0109566 3300044712 Bacteria 3358
455 Ga0466971_0000005 3300044719 Bacteria 137073
456 Ga0466957_0069306 3300044842 Bacteria 2178
457 Ga0451576_0024674 3300045051 Bacteria 6490
458 Ga0451576_0027216 3300045051 Bacteria 6143
459 Ga0466967_0088574 3300045976 Bacteria 2809
460 Ga0495592_0102898 3300046454 Bacteria 2033
461 Ga0495651_0162026 3300046462 Bacteria 1601
462 Ga0495580_0109086 3300046472 Bacteria 1922
463 Ga0495605_0063477 3300046474 Bacteria 1762
464 Ga0495584_0022505 3300046491 Bacteria 3197
465 Ga0495585_0065325 3300046492 Bacteria 1994
466 Ga0495608_0095489 3300046511 Bacteria 1921
467 Ga0495618_0068826 3300046514 Bacteria 2251
468 Ga0495628_0040395 3300046516 Bacteria 3728
469 Ga0495630_0017678 3300046517 Bacteria 5227
470 Ga0495663_0019332 3300046525 Bacteria 1949
471 Ga0495642_0022869 3300046528 Bacteria 2465
472 Ga0495652_0018013 3300046529 Bacteria 6301
473 Ga0495598_0000901 3300046537 Bacteria 5725
474 Ga0495598_0043361 3300046537 Unclassified 1325
475 Ga0495645_0063981 3300046543 Bacteria 2662
476 Ga0495633_0056070 3300046558 Unclassified 1852
477 Ga0495656_0049027 3300046615 Bacteria 1797
478 Ga0495634_0048412 3300046642 Bacteria 2862
479 Ga0495661_0193660 3300046665 Unclassified 1069
480 Ga0495599_0142934 3300046678 Bacteria 1484
481 Ga0495658_0011003 3300046683 Bacteria 4538
482 Ga0495669_0009247 3300046684 Bacteria 4152
483 Ga0495670_0082094 3300046691 Bacteria 1643
484 Ga0495649_0204851 3300046694 Bacteria 1024
485 Ga0495581_0106207 3300047315 Bacteria 1632
486 Ga0495674_0415532 3300047319 Bacteria 1084
487 Ga0495675_0002584 3300047444 Bacteria 10850
488 Ga0495677_0064905 3300047445 Unclassified 1357
489 Ga0495684_0164535 3300047471 Unclassified 1653
490 Ga0495602_0309980 3300048088 Bacteria 1152
491 Ga0496100_0021201 3300048903 Bacteria 3910
492 Ga0496100_0356210 3300048903 Bacteria 1106
493 Ga0496101_0031362 3300048904 Bacteria 3735
494 Ga0496102_0009851 3300048905 Bacteria 8216
495 Ga0496102_0251367 3300048905 Unclassified 1667
496 Ga0496103_0011535 3300048906 Bacteria 5238
497 Ga0496104_0014963 3300048907 Bacteria 7017
498 Ga0496104_0356276 3300048907 Bacteria 1376
499 Ga0496106_0002174 3300048909 Bacteria 14655
500 Ga0496106_0264949 3300048909 Bacteria 1375
501 Ga0496106_0292110 3300048909 Bacteria 1307
502 Ga0496107_0018540 3300048910 Bacteria 4901
503 Ga0496107_0286116 3300048910 Bacteria 1227
504 Ga0496108_0042309 3300048911 Bacteria 3803
505 Ga0496109_0040844 3300048912 Bacteria 4202
506 Ga0496109_0241538 3300048912 Unclassified 1700
507 Ga0496109_0287838 3300048912 Bacteria 1549
508 Ga0496109_0327535 3300048912 Unclassified 1446
509 Ga0496110_0132415 3300048913 Bacteria 2252
510 Ga0496110_0330391 3300048913 Bacteria 1389
511 Ga0496111_0102523 3300048914 Bacteria 2104
512 Ga0496112_0017121 3300048915 Bacteria 6804
513 Ga0496112_0046152 3300048915 Bacteria 4272
514 Ga0496112_0050307 3300048915 Bacteria 4086
515 Ga0496112_0161160 3300048915 Bacteria 2210
516 Ga0496112_0273283 3300048915 Unclassified 1638
517 Ga0496113_0188201 3300048916 Bacteria 1638
518 Ga0496113_0476967 3300048916 Unclassified 1002
519 Ga0496113_0528149 3300048916 Bacteria 947
520 Ga0496114_0172612 3300048917 Bacteria 1885
521 Ga0496115_0009615 3300048918 Bacteria 7191
522 Ga0496121_0548309 3300048924 Bacteria 724
523 Ga0496124_0198492 3300048927 Bacteria 1528
524 Ga0496125_0000110 3300048928 Bacteria 192693
525 Ga0501308_002090 3300049128 Bacteria 1710
526 Ga0501310_000737 3300049130 Bacteria 2892
527 Ga0501304_000153 3300049160 Bacteria 2865
528 Ga0501305_000001 3300049161 Bacteria 19709
529 Ga0501305_015896 3300049161 Bacteria 1067
530 Ga0501307_000001 3300049162 Bacteria 10981
531 Ga0501312_000001 3300049528 Bacteria 18666
532 Ga0501316_006032 3300049532 Bacteria 1277
533 Ga0501317_004444 3300049533 Bacteria 1459
534 Ga0501320_001877 3300049536 Bacteria 1608
535 Ga0501031_0000635 3300049568 Bacteria 20764
536 Ga0501032_0000390 3300049569 Bacteria 36137
537 Ga0501032_0046887 3300049569 Bacteria 2920
538 Ga0501032_0244194 3300049569 Bacteria 1166
539 Ga0501033_0000003 3300049570 Bacteria 586973
540 Ga0501033_0000015 3300049570 Bacteria 218502
541 Ga0501033_0006719 3300049570 Bacteria 8988
542 Ga0501036_0013849 3300049572 Bacteria 6707
543 Ga0501037_0000295 3300049573 Bacteria 42165
544 Ga0501037_0011831 3300049573 Bacteria 6427
545 Ga0501038_0000480 3300049574 Bacteria 35161
546 Ga0501038_0073690 3300049574 Bacteria 2890
547 Ga0501038_0456810 3300049574 Bacteria 981
548 Ga0501039_0022279 3300049575 Bacteria 4863
549 Ga0501039_0284451 3300049575 Bacteria 1300
550 Ga0501041_0177330 3300049577 Bacteria 1334
551 Ga0501043_0069626 3300049579 Bacteria 2763
552 Ga0501043_0289131 3300049579 Bacteria 1255
553 Ga0501046_0005999 3300049580 Bacteria 10806
554 Ga0501047_0009121 3300049581 Bacteria 9369
555 Ga0501047_0042858 3300049581 Bacteria 4372
556 Ga0501047_0086476 3300049581 Bacteria 3012
557 Ga0501048_0015870 3300049582 Bacteria 5558
558 Ga0501070_0002360 3300049586 Bacteria 16550
559 Ga0501070_0033242 3300049586 Bacteria 4316
560 Ga0501070_0142209 3300049586 Bacteria 1981
561 Ga0501071_0074202 3300049587 Bacteria 2483
562 Ga0501080_0023861 3300049742 Bacteria 5668
563 Ga0501080_0345987 3300049742 Bacteria 1343
564 Ga0501083_0059867 3300049744 Bacteria 2546
565 Ga0501035_0000004 3300049822 Bacteria 403650
566 Ga0501035_0040870 3300049822 Bacteria 4189
567 Ga0501044_0000740 3300049823 Bacteria 39382
568 Ga0501045_0827532 3300049824 Bacteria 681
569 nmdc:mga03683_281_c1 3300050489 Bacteria 15224
570 nmdc:mga03683_93017_c1 3300050489 Bacteria 1317
571 nmdc:mga03n38_195087_c1 3300050490 Bacteria 1045
572 nmdc:mga03n38_86065_c1 3300050490 Bacteria 1487
573 nmdc:mga0k408_12560_c1 3300050493 Bacteria 4632
574 nmdc:mga0k408_1699_c1 3300050493 Bacteria 11859
575 nmdc:mga08y16_168750_c1 3300050511 Bacteria 2273
576 nmdc:mga08y16_94064_c1 3300050511 Bacteria 3122
577 nmdc:mga0rr50_168592_c1 3300050513 Bacteria 1782
578 nmdc:mga08x19_555035_c1 3300050514 Unclassified 813
579 nmdc:mga08x19_81630_c1 3300050514 Bacteria 2123
580 Ga0495601_0267157 3300053077 Bacteria 1116
581 Ga0495619_0109404 3300053085 Bacteria 1887
582 Ga0500555_000015 3300053103 Bacteria 230204
583 Ga0500555_000055 3300053103 Bacteria 58298
584 Ga0500556_0000420 3300053104 Bacteria 30531
585 Ga0500556_0002977 3300053104 Bacteria 5115
586 Ga0500642_0004954 3300053130 Bacteria 4237
587 Ga0500642_0123785 3300053130 Bacteria 1210
588 Ga0500658_0073733 3300053134 Bacteria 1446
589 Ga0500559_0000861 3300053136 Bacteria 19493
590 Ga0500616_0006731 3300053153 Bacteria 7458
591 Ga0500616_0006989 3300053153 Bacteria 7263
592 Ga0500645_012211 3300053730 Bacteria 2780
593 Ga0466962_0000007 3300061719 Bacteria 157857
594 2718716241 2718217752 Bacteria 915884
595 2787506692 2786546548 Bacteria 4745694
596 Ga0070665_100000045
597 SwRhRL3b_contig_111370
598 SwRhRL3b_contig_2227077
599 SwRhRL2b_contig_128758
600 JGI24743J22301_10000748
601 JGI24743J22301_10010320
602 JGI24744J21845_10011528
603 JGI24033J26618_1000142
604 JGI25406J46586_10000001
605 JGI25406J46586_10000007
606 rootH2_10050166
607 rootL2_10030599
608 rootL2_10139488
609 rootH1_10007007
610 Ga0055530_10029193
611 Ga0065704_10115944
612 Ga0065712_10088457
613 Ga0065712_10145424
614 Ga0065715_10001491
615 Ga0065707_10102203
616 Ga0070658_10018594
617 Ga0070676_10079494
618 Ga0070676_10305976
619 Ga0070676_10428966
620 Ga0070683_100055457
621 Ga0070670_100003742
622 Ga0070670_100205578
623 Ga0070670_100314402
624 Ga0070670_100359756
625 Ga0068869_100697020
626 Ga0070666_10001876
627 Ga0070666_10002056
628 Ga0070666_10037886
629 Ga0068868_100215528
630 Ga0068868_100221974
631 Ga0070660_100151607
632 Ga0070689_100100534
633 Ga0070687_100411748
634 Ga0070661_100000386
635 Ga0070661_100097194
636 Ga0070661_100288697
637 Ga0070668_100069825
638 Ga0070668_100182452
639 Ga0070668_100497705
640 Ga0070669_100002011
641 Ga0070669_100004431
642 Ga0070669_100033015
643 Ga0070669_100157939
644 Ga0070669_100199988
645 Ga0070675_100004678
646 Ga0070675_100133137
647 Ga0070675_100137843
648 Ga0070675_100193153
649 Ga0070671_100000283
650 Ga0070671_100011134
651 Ga0070671_100016515
652 Ga0070674_100013872
653 Ga0070674_100034793
654 Ga0070674_100048927
655 Ga0070674_100064027
656 Ga0070674_100293714
657 Ga0070673_100008141
658 Ga0070673_100014325
659 Ga0070673_100075213
660 Ga0070688_100000733
661 Ga0070667_100004665
662 Ga0070667_100072064
663 Ga0070667_100258686
664 Ga0070667_100449308
665 Ga0070709_10408304
666 Ga0070709_10499439
667 Ga0070714_100337764
668 Ga0070714_100879043
669 Ga0070713_100354871
670 Ga0070710_10136557
671 Ga0070710_10207762
672 Ga0070710_10236095
673 Ga0070701_10075691
674 Ga0070711_100006116
675 Ga0070711_100226319
676 Ga0070708_100054749
677 Ga0070708_100076149
678 Ga0070708_100393362
679 Ga0070708_100591210
680 Ga0070708_100903773
681 Ga0070678_100001511
682 Ga0070678_100013072
683 Ga0070678_100033505
684 Ga0070678_100043541
685 Ga0070678_100053192
686 Ga0070678_100223073
687 Ga0070678_100444107
688 Ga0070662_100008169
689 Ga0070662_100471626
690 Ga0068867_100000218
691 Ga0068867_100007340
692 Ga0068867_100044767
693 Ga0068867_100235448
694 Ga0070685_10099962
695 Ga0070706_100006435
696 Ga0070706_100146613
697 Ga0070706_100416544
698 Ga0070706_100624420
699 Ga0070706_100729309
700 Ga0070707_100072311
701 Ga0070707_100159765
702 Ga0070707_100411612
703 Ga0070698_100001910
704 Ga0070698_100007384
705 Ga0070699_100030476
706 Ga0070699_100036501
707 Ga0070699_100051877
708 Ga0070699_100093749
709 Ga0070699_100643205
710 Ga0070697_100004958
711 Ga0070697_100005694
712 Ga0070697_100025782
713 Ga0070697_100031906
714 Ga0070697_100141887
715 Ga0070697_100611835
716 Ga0070672_100004247
717 Ga0070672_100041736
718 Ga0070672_100182796
719 Ga0070672_100202353
720 Ga0070695_100561239
721 Ga0070665_100008787
722 Ga0070665_100114878
723 Ga0070665_100476535
724 Ga0070665_100673722
725 Ga0070665_100853228
726 Ga0070704_100083567
727 Ga0068855_100597968
728 Ga0068855_100851325
729 Ga0070664_100000199
730 Ga0070664_100360619
731 Ga0068857_100221076
732 Ga0068856_100004352
733 Ga0068856_100017528
734 Ga0068859_101731931
735 Ga0068866_10121420
736 Ga0068866_10623252
737 Ga0068861_100390918
738 Ga0068863_100029029
739 Ga0068863_100054836
740 Ga0068858_100055768
741 Ga0068858_100134565
742 Ga0068858_100800210
743 Ga0068860_100001380
744 Ga0068860_100672444
745 Ga0081538_10015344
746 Ga0081539_10000014
747 Ga0070717_10037326
748 Ga0070717_10195964
749 Ga0075363_100004668
750 Ga0075363_100128694
751 Ga0070715_10015930
752 Ga0070716_100031746
753 Ga0070716_100086652
754 Ga0070716_100677467
755 Ga0070712_100093977
756 Ga0070712_100105455
757 Ga0070712_100996564
758 Ga0075362_10004435
759 Ga0075366_10047853
760 Ga0097621_100024099
761 Ga0097621_100605107
762 Ga0097621_100827666
763 Ga0075370_10306692
764 Ga0068871_100005514
765 Ga0068871_100012344
766 Ga0068871_100084135
767 Ga0075433_10286694
768 Ga0075429_100583814
769 Ga0068865_100000462
770 Ga0068865_100013318
771 Ga0097620_101732031
772 Ga0075435_100470464
773 Ga0099795_10326251
774 Ga0105240_10007047
775 Ga0111539_10048674
776 Ga0111539_10387272
777 Ga0105245_10015121
778 Ga0105245_10158539
779 Ga0105245_10823160
780 Ga0105243_10000049
781 Ga0105242_10451840
782 Ga0105248_10312261
783 Ga0105237_10009019
784 Ga0105237_10044182
785 Ga0105237_10385391
786 Ga0099796_10040234
787 Ga0105239_10048890
788 Ga0157373_10004932
789 Ga0157371_10058341
790 Ga0157371_10247936
791 Ga0157374_10000026
792 Ga0157374_10001473
793 Ga0157374_10017996
794 Ga0157374_10055882
795 Ga0157374_10121480
796 Ga0157374_10127435
797 Ga0157374_10498498
798 Ga0157374_10569942
799 Ga0157374_11100808
800 Ga0157374_11130585
801 Ga0157374_11937884
802 Ga0157378_10001234
803 Ga0157378_10005509
804 Ga0157378_10026553
805 Ga0157378_10043528
806 Ga0157378_10058061
807 Ga0157378_10107467
808 Ga0157378_10119918
809 Ga0157378_10174062
810 Ga0163162_10017445
811 Ga0163162_10023520
812 Ga0163162_10052794
813 Ga0163162_10370423
814 Ga0163162_10410273
815 Ga0157372_10167743
816 Ga0157372_10360562
817 Ga0157372_10631782
818 Ga0157372_11295485
819 Ga0157375_10001868
820 Ga0157375_10044228
821 Ga0157375_10082239
822 Ga0157375_10144146
823 Ga0157375_10198646
824 Ga0157375_10668197
825 Ga0157377_10033289
826 Ga0157376_10000112
827 Ga0157376_10031061
828 Ga0157376_10102835
829 Ga0157376_10390349
830 Ga0157376_11254406
831 Ga0163161_10042654
832 Ga0163161_10245059
833 Ga0206355_1200566
834 Ga0213873_10016590
835 Ga0213873_10030819
836 Ga0213872_10010006
837 Ga0213872_10158708
838 Ga0213874_10001478
839 Ga0213876_10000361
840 Ga0213876_10073114
841 Ga0213876_10483064
842 Ga0213875_10079664
843 Ga0213871_10012351
844 Ga0209050_1000629
845 Ga0207697_10000131
846 Ga0207697_10002322
847 Ga0207697_10031631
848 Ga0207642_10062069
849 Ga0207642_10063829
850 Ga0207688_10001208
851 Ga0207688_10042403
852 Ga0207680_10104042
853 Ga0207680_10150458
854 Ga0207680_10205844
855 Ga0207685_10139437
856 Ga0207685_10171988
857 Ga0207699_10181274
858 Ga0207645_10001641
859 Ga0207645_10002762
860 Ga0207705_10033535
861 Ga0207684_10019695
862 Ga0207684_10048446
863 Ga0207684_10151385
864 Ga0207684_10252293
865 Ga0207695_10002221
866 Ga0207695_10008540
867 Ga0207671_10020842
868 Ga0207671_10025222
869 Ga0207693_10000889
870 Ga0207693_10092069
871 Ga0207693_10389591
872 Ga0207663_10005429
873 Ga0207663_10396750
874 Ga0207662_10432993
875 Ga0207657_10066683
876 Ga0207657_10073181
877 Ga0207649_10007825
878 Ga0207649_10150356
879 Ga0207646_10005692
880 Ga0207646_10084385
881 Ga0207646_10137954
882 Ga0207681_10014902
883 Ga0207681_10072736
884 Ga0207681_10175206
885 Ga0207650_10006836
886 Ga0207650_10018287
887 Ga0207659_10020696
888 Ga0207659_10045484
889 Ga0207659_10179827
890 Ga0207659_10419064
891 Ga0207659_10469124
892 Ga0207659_10682627
893 Ga0207687_10051760
894 Ga0207700_10318513
895 Ga0207664_10120019
896 Ga0207644_10035251
897 Ga0207644_10049869
898 Ga0207644_10237270
899 Ga0207644_10266435
900 Ga0207690_10023803
901 Ga0207690_10086786
902 Ga0207706_10027339
903 Ga0207709_10000097
904 Ga0207669_10002532
905 Ga0207669_10073225
906 Ga0207704_10040566
907 Ga0207665_10025655
908 Ga0207665_10140744
909 Ga0207665_10180266
910 Ga0207691_10000247
911 Ga0207691_10016028
912 Ga0207691_10228367
913 Ga0207691_10235331
914 Ga0207711_10232457
915 Ga0207661_10077884
916 Ga0207679_10000541
917 Ga0207679_10279684
918 Ga0207679_10374795
919 Ga0207667_10766901
920 Ga0207651_10007253
921 Ga0207651_10019560
922 Ga0207651_10027669
923 Ga0207651_10634914
924 Ga0207668_10035962
925 Ga0207668_10057405
926 Ga0207668_10156576
927 Ga0207668_10203825
928 Ga0207668_10629956
929 Ga0207668_10931305
930 Ga0207668_10957154
931 Ga0207658_10302012
932 Ga0207677_10008042
933 Ga0207677_10021108
934 Ga0207677_10021545
935 Ga0207677_10111866
936 Ga0207677_10252081
937 Ga0207703_10024292
938 Ga0207703_10175845
939 Ga0207639_10621551
940 Ga0207702_10003580
941 Ga0207702_10038562
942 Ga0207641_10005226
943 Ga0207641_10452994
944 Ga0207641_10626592
945 Ga0207648_10000083
946 Ga0207648_10237363
947 Ga0207674_10107042
948 Ga0207675_100323714
949 Ga0207683_10006308
950 Ga0207683_10006977
951 Ga0207683_10008842
952 Ga0207683_10015583
953 Ga0207698_10222182
954 Ga0207698_10283620
955 Ga0207698_10923389
956 Ga0209974_10022093
957 Ga0207428_10514354
958 Ga0268266_10000251
959 Ga0268266_10097330
960 Ga0268266_10238441
961 Ga0268266_10325400
962 Ga0268266_10501180
963 Ga0268266_11148552
964 Ga0268265_10116094
965 Ga0268264_10001807
966 Ga0268264_10149965
967 Ga0268264_10473591
968 Ga0265318_10001452
969 Ga0307511_10000117
970 Ga0307512_10104901
971 Ga0265328_10052198
972 Ga0265320_10013095
973 Ga0265327_10011153
974 Ga0265316_10186665
975 Ga0307408_100000009
976 Ga0307408_100000021
977 Ga0307408_100414755
978 Ga0265313_10004186
979 Ga0307413_10364847
980 Ga0307410_10000097
981 Ga0307407_10000468
982 Ga0307409_100000037
983 Ga0307416_100000018
984 Ga0307411_10054437
985 Ga0316593_10000659
986 Ga0373944_0080838
987 Ga0373945_0053651
988 Ga0373945_0059303
989 Ga0373945_0232692
990 Ga0373957_0405744
991 Ga0373943_0005531
992 Ga0373943_0092490
993 Ga0373946_0078616
994 Ga0373946_0096119
995 Ga0373955_0008379
996 Ga0316574_0010564
997 Ga0373931_0036970
998 Ga0373935_0067275
999 Ga0373927_0200535
1000 Ga0373927_0608304
1001 Ga0373933_0052084
1002 Ga0373933_0108221
1003 Ga0373947_0015443
1004 Ga0373947_0159967
1005 Ga0373947_0173463
1006 Ga0373937_0282498
1007 Ga0373937_0331794
1008 Ga0373937_0824342
1009 Ga0373925_0014401
1010 Ga0373925_0155902
1011 Ga0373925_0501751
1012 Ga0395899_0000039
1013 Ga0395900_0002526
1014 Ga0395898_0000226
1015 Ga0395898_0079141
1016 Ga0436364_0070502
1017 Ga0436364_0339363
1018 Ga0436364_0785290
1019 Ga0395901_0039538
1020 Ga0436365_0798127
1021 Ga0436365_1314581
1022 Ga0436365_1383407
1023 Ga0436360_0051782
1024 Ga0436360_0111982
1025 Ga0436360_0751309
1026 Ga0436360_0817873
1027 Ga0436360_0823493
1028 Ga0436361_0088096
1029 Ga0436361_0096493
1030 Ga0436361_0363848
1031 Ga0436361_0382718
1032 Ga0436361_0960224
1033 Ga0436361_1103431
1034 Ga0436363_0072645
1035 Ga0436362_0931802
1036 Ga0436362_1110217
1037 Ga0439453_0000086
1038 Ga0451807_0122896
1039 Ga0451853_3388316
1040 Ga0450888_001605
1041 Ga0450890_000001
1042 Ga0450891_002487
1043 Ga0450893_0005197
1044 Ga0451577_0186388
1045 Ga0453683_0004775
1046 Ga0466965_0058570
1047 Ga0453684_0000516
1048 Ga0453684_0109566
1049 Ga0466971_0000005
1050 Ga0466957_0069306
1051 Ga0451576_0024674
1052 Ga0451576_0027216
1053 Ga0466967_0088574
1054 Ga0495592_0102898
1055 Ga0495651_0162026
1056 Ga0495580_0109086
1057 Ga0495605_0063477
1058 Ga0495584_0022505
1059 Ga0495585_0065325
1060 Ga0495608_0095489
1061 Ga0495618_0068826
1062 Ga0495628_0040395
1063 Ga0495630_0017678
1064 Ga0495663_0019332
1065 Ga0495642_0022869
1066 Ga0495652_0018013
1067 Ga0495598_0000901
1068 Ga0495598_0043361
1069 Ga0495645_0063981
1070 Ga0495633_0056070
1071 Ga0495656_0049027
1072 Ga0495634_0048412
1073 Ga0495661_0193660
1074 Ga0495599_0142934
1075 Ga0495658_0011003
1076 Ga0495669_0009247
1077 Ga0495670_0082094
1078 Ga0495649_0204851
1079 Ga0495581_0106207
1080 Ga0495674_0415532
1081 Ga0495675_0002584
1082 Ga0495677_0064905
1083 Ga0495684_0164535
1084 Ga0495602_0309980
1085 Ga0496100_0021201
1086 Ga0496100_0356210
1087 Ga0496101_0031362
1088 Ga0496102_0009851
1089 Ga0496102_0251367
1090 Ga0496103_0011535
1091 Ga0496104_0014963
1092 Ga0496104_0356276
1093 Ga0496106_0002174
1094 Ga0496106_0264949
1095 Ga0496106_0292110
1096 Ga0496107_0018540
1097 Ga0496107_0286116
1098 Ga0496108_0042309
1099 Ga0496109_0040844
1100 Ga0496109_0241538
1101 Ga0496109_0287838
1102 Ga0496109_0327535
1103 Ga0496110_0132415
1104 Ga0496110_0330391
1105 Ga0496111_0102523
1106 Ga0496112_0017121
1107 Ga0496112_0046152
1108 Ga0496112_0050307
1109 Ga0496112_0161160
1110 Ga0496112_0273283
1111 Ga0496113_0188201
1112 Ga0496113_0476967
1113 Ga0496113_0528149
1114 Ga0496114_0172612
1115 Ga0496115_0009615
1116 Ga0496121_0548309
1117 Ga0496124_0198492
1118 Ga0496125_0000110
1119 Ga0501308_002090
1120 Ga0501310_000737
1121 Ga0501304_000153
1122 Ga0501305_000001
1123 Ga0501305_015896
1124 Ga0501307_000001
1125 Ga0501312_000001
1126 Ga0501316_006032
1127 Ga0501317_004444
1128 Ga0501320_001877
1129 Ga0501031_0000635
1130 Ga0501032_0000390
1131 Ga0501032_0046887
1132 Ga0501032_0244194
1133 Ga0501033_0000003
1134 Ga0501033_0000015
1135 Ga0501033_0006719
1136 Ga0501036_0013849
1137 Ga0501037_0000295
1138 Ga0501037_0011831
1139 Ga0501038_0000480
1140 Ga0501038_0073690
1141 Ga0501038_0456810
1142 Ga0501039_0022279
1143 Ga0501039_0284451
1144 Ga0501041_0177330
1145 Ga0501043_0069626
1146 Ga0501043_0289131
1147 Ga0501046_0005999
1148 Ga0501047_0009121
1149 Ga0501047_0042858
1150 Ga0501047_0086476
1151 Ga0501048_0015870
1152 Ga0501070_0002360
1153 Ga0501070_0033242
1154 Ga0501070_0142209
1155 Ga0501071_0074202
1156 Ga0501080_0023861
1157 Ga0501080_0345987
1158 Ga0501083_0059867
1159 Ga0501035_0000004
1160 Ga0501035_0040870
1161 Ga0501044_0000740
1162 Ga0501045_0827532
1163 nmdc:mga03683_281_c1
1164 nmdc:mga03683_93017_c1
1165 nmdc:mga03n38_195087_c1
1166 nmdc:mga03n38_86065_c1
1167 nmdc:mga0k408_12560_c1
1168 nmdc:mga0k408_1699_c1
1169 nmdc:mga08y16_168750_c1
1170 nmdc:mga08y16_94064_c1
1171 nmdc:mga0rr50_168592_c1
1172 nmdc:mga08x19_555035_c1
1173 nmdc:mga08x19_81630_c1
1174 Ga0495601_0267157
1175 Ga0495619_0109404
1176 Ga0500555_000015
1177 Ga0500555_000055
1178 Ga0500556_0000420
1179 Ga0500556_0002977
1180 Ga0500642_0004954
1181 Ga0500642_0123785
1182 Ga0500658_0073733
1183 Ga0500559_0000861
1184 Ga0500616_0006731
1185 Ga0500616_0006989
1186 Ga0500645_012211
1187 Ga0466962_0000007
1188 2718716241
1189 2787506692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00333

Ribosomal_S5

Ribosomal protein S5, N-terminal domain

49

113

0.97

PF03719

Ribosomal_S5_C

Ribosomal protein S5, C-terminal domain

125

195

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cvo-assembly1.cif.gz_E cutibacterium acnes 30s ribosomal subunit with sarecycline bound, head domain only in the local refined map 0.9416 24 76
6spf-assembly1.cif.gz_e pseudomonas aeruginosa 70s ribosome from an aminoglycoside resistant clinical isolate 0.9299 26 158
7unu-assembly1.cif.gz_e pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.9158 25 164
4v7h-assembly1.cif.gz_AE structure of the 80s rrna and proteins and p/e trna for eukaryotic ribosome based on cryo-em map of thermomyces lanuginosus ribosome at 8.9a resolution 0.9123 24 154
6zto-assembly1.cif.gz_AE e. coli 70s-rnap expressome complex in uncoupled state 1 0.8915 23 168
ID Description Score Start End Superfamily
af_A0A1D8PEV9_173_236_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9718 24 82 3.30.160.20
af_Q54CA5_1734_1797_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9555 25 82 3.30.160.20
3j81C02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.932 90 157 3.30.230.10
af_D3ZQW7_1_92_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9244 24 76 3.30.160.20
3ms0E01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.922 23 83 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A1G4AJ55-F1-model_v4 Small ribosomal subunit protein uS5 0.9129 25 168 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A7C4EL12-F1-model_v4 Small ribosomal subunit protein uS5 0.9122 23 167 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A1G1H0X9-F1-model_v4 Small ribosomal subunit protein uS5 0.9115 23 168 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A2M6X406-F1-model_v4 Small ribosomal subunit protein uS5 0.9089 23 167 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A2E7GD17-F1-model_v4 deleted 0.9084 24 168

Map